Psyllid ID: psy4290


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MTGTSNQFCENEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESLVPFHFVSGHINELRIKVPWTSLGSSSVEVVIDTIGYLSGIFECMAAIHALNGRYATALQYAILLVPIGHSAPTAWCFKDRCTTTQAD
cHHHHHHHHHHHHHHHHccccccEEEEEEcEEEEEEccEEcHHHHHccccEEEEEEEEEEEEEEEEccccccccEEEEEEcEEEEEEEccHHHHHHHHcHHHHHHHHHHHHcccccccccccccccccccccccc
cccccccccccEEEEcccccHHHcEEEEEcccEEEcccccHHHHHHHcccEEEEEEEEEEEEEEEEcHHcccccEEEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHEEcccccccccc
mtgtsnqfCENEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESlvpfhfvsghinelrikvpwtslgsssVEVVIDTIGYLSGIFECMAAIHALNGRYATALQYAILLvpighsaptawcfkdrctttqad
mtgtsnqfcENEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESLVPFHFVSGHINELRIKVpwtslgssSVEVVIDTIGYLSGIFECMAAIHALNGRYATALQYAILLVPIGhsaptawcFKDRCTTTQAD
MTGTSNQFCENEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESLVPFHFVSGHINELRIKVPWTSLGSSSVEVVIDTIGYLSGIFECMAAIHALNGRYATALQYAILLVPIGHSAPTAWCFKDRCTTTQAD
********CENEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESLVPFHFVSGHINELRIKVPWTSLGSSSVEVVIDTIGYLSGIFECMAAIHALNGRYATALQYAILLVPIGHSAPTAWCFKDRCT*****
MTGTSNQFCENEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESLVPFHFVSGHINELRIKVPWTSLGSSSVEVVIDTIGYLSGI***********************************************
********CENEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESLVPFHFVSGHINELRIKVPWTSLGSSSVEVVIDTIGYLSGIFECMAAIHALNGRYATALQYAILLVPIGHSAPTAWCFKD********
****SNQFCENEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESLVPFHFVSGHINELRIKVPWTSLGSSSVEVVIDTIGYLSGIFECMAAIHALNGRYATALQYAILLVPIGHSAPTAWCFKDRCT*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGTSNQFCENEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESLVPFHFVSGHINELRIKVPWTSLGSSSVEVVIDTIGYLSGIFECMAAIHALNGRYATALQYAILLVPIGHSAPTAWCFKDRCTTTQAD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
Q80TY5 4013 Vacuolar protein sorting- yes N/A 0.496 0.016 0.492 3e-11
Q7Z7G8 4022 Vacuolar protein sorting- no N/A 0.496 0.016 0.492 3e-11
Q5H8C4 3166 Vacuolar protein sorting- no N/A 0.548 0.023 0.384 2e-07
Q96RL7 3174 Vacuolar protein sorting- no N/A 0.548 0.023 0.358 2e-06
Q54KX3 4246 Putative vacuolar protein yes N/A 0.496 0.015 0.347 5e-06
Q555C6 6061 Putative vacuolar protein no N/A 0.437 0.009 0.416 2e-05
O42926 3131 Vacuolar protein sorting- yes N/A 0.666 0.028 0.315 5e-05
P87319 3011 Vacuolar protein sorting- no N/A 0.459 0.020 0.359 6e-05
Q8BX70 3748 Vacuolar protein sorting- no N/A 0.533 0.019 0.328 6e-05
Q709C8 3753 Vacuolar protein sorting- no N/A 0.533 0.019 0.328 6e-05
>sp|Q80TY5|VP13B_MOUSE Vacuolar protein sorting-associated protein 13B OS=Mus musculus GN=Vps13b PE=1 SV=2 Back     alignment and function desciption
 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 16 LQEFFRSTLQLHLWEGQACFHNLELDLEALES--LVPFHFVSGHINELRIKVPWTSLGSS 73
          ++    S LQL LW G      LEL L+ LE    +PF F+SGHI+ELRI VPWT LGS 
Sbjct: 18 IKNLKPSDLQLSLWGGDVVLSKLELKLDVLEQELKLPFTFLSGHIHELRIHVPWTKLGSE 77

Query: 74 SVEVVIDTI 82
           V + I+T+
Sbjct: 78 PVVITINTM 86




May be involved in protein sorting in post Golgi membrane traffic.
Mus musculus (taxid: 10090)
>sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 Back     alignment and function description
>sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 Back     alignment and function description
>sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 Back     alignment and function description
>sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 Back     alignment and function description
>sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 Back     alignment and function description
>sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 Back     alignment and function description
>sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13a PE=3 SV=2 Back     alignment and function description
>sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 Back     alignment and function description
>sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
328716262 3698 PREDICTED: vacuolar protein sorting-asso 0.459 0.016 0.546 2e-12
195452432 3785 GK13201 [Drosophila willistoni] gi|19416 0.577 0.020 0.469 3e-11
321458134 296 hypothetical protein DAPPUDRAFT_217952 [ 0.533 0.243 0.456 1e-10
431901767 1760 Vacuolar protein sorting-associated prot 0.659 0.050 0.428 2e-10
195113777 3743 GI10796 [Drosophila mojavensis] gi|19391 0.474 0.017 0.5 3e-10
189241022 3667 PREDICTED: similar to vacuolar protein s 0.607 0.022 0.417 3e-10
241568969 3547 vacuolar protein-sorting protein, putati 0.429 0.016 0.6 4e-10
432107636 1770 Vacuolar protein sorting-associated prot 0.659 0.050 0.417 6e-10
301609817 4023 PREDICTED: LOW QUALITY PROTEIN: vacuolar 0.496 0.016 0.507 6e-10
291388345 3980 PREDICTED: vacuolar protein sorting 13B 0.785 0.026 0.377 7e-10
>gi|328716262|ref|XP_001946415.2| PREDICTED: vacuolar protein sorting-associated protein 13B-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 77.4 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 21 RSTLQLHLWEGQACFHNLELDLEALESLV--PFHFVSGHINELRIKVPWTSLGSSSVEVV 78
          R   Q+ LW+G+  F NLELDL+ LE  +  PF  +SGHIN+L I+VPWT LGS +V++ 
Sbjct: 25 RQDAQVSLWDGEGLFQNLELDLDVLEKELNLPFIVISGHINQLLIRVPWTKLGSEAVKIT 84

Query: 79 IDTI 82
          IDTI
Sbjct: 85 IDTI 88




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195452432|ref|XP_002073351.1| GK13201 [Drosophila willistoni] gi|194169436|gb|EDW84337.1| GK13201 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|321458134|gb|EFX69207.1| hypothetical protein DAPPUDRAFT_217952 [Daphnia pulex] Back     alignment and taxonomy information
>gi|431901767|gb|ELK08644.1| Vacuolar protein sorting-associated protein 13B [Pteropus alecto] Back     alignment and taxonomy information
>gi|195113777|ref|XP_002001444.1| GI10796 [Drosophila mojavensis] gi|193918038|gb|EDW16905.1| GI10796 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|189241022|ref|XP_970618.2| PREDICTED: similar to vacuolar protein sorting-associated protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|241568969|ref|XP_002402615.1| vacuolar protein-sorting protein, putative [Ixodes scapularis] gi|215500056|gb|EEC09550.1| vacuolar protein-sorting protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|432107636|gb|ELK32869.1| Vacuolar protein sorting-associated protein 13B [Myotis davidii] Back     alignment and taxonomy information
>gi|301609817|ref|XP_002934455.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar protein sorting-associated protein 13B-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|291388345|ref|XP_002710632.1| PREDICTED: vacuolar protein sorting 13B [Oryctolagus cuniculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
MGI|MGI:1916380 4013 Vps13b "vacuolar protein sorti 0.451 0.015 0.539 7.3e-10
UNIPROTKB|Q7Z7G8 4022 VPS13B "Vacuolar protein sorti 0.451 0.015 0.539 7.3e-10
UNIPROTKB|F1SIL5 3172 VPS13A "Uncharacterized protei 0.562 0.023 0.395 5e-07
UNIPROTKB|E1C549 3008 E1C549 "Uncharacterized protei 0.562 0.025 0.382 6.4e-07
MGI|MGI:2444304 3166 Vps13a "vacuolar protein sorti 0.548 0.023 0.384 1.4e-06
UNIPROTKB|Q96RL7 3174 VPS13A "Vacuolar protein sorti 0.562 0.023 0.370 1.6e-06
ASPGD|ASPL0000032755 3169 AN5579 [Emericella nidulans (t 0.525 0.022 0.347 2.9e-06
UNIPROTKB|G4N6L6 3223 MGG_06537 "Vacuolar protein so 0.525 0.022 0.333 1e-05
UNIPROTKB|D4A899 3062 Vps13a "Protein Vps13a" [Rattu 0.562 0.024 0.370 2e-05
DICTYBASE|DDB_G0287055 4246 vps13F "vacuolar protein sorti 0.518 0.016 0.342 3.6e-05
MGI|MGI:1916380 Vps13b "vacuolar protein sorting 13B (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 161 (61.7 bits), Expect = 7.3e-10, P = 7.3e-10
 Identities = 34/63 (53%), Positives = 41/63 (65%)

Query:    22 STLQLHLWEGQACFHNLELDLEALES--LVPFHFVSGHINELRIKVPWTSLGSSSVEVVI 79
             S LQL LW G      LEL L+ LE    +PF F+SGHI+ELRI VPWT LGS  V + I
Sbjct:    24 SDLQLSLWGGDVVLSKLELKLDVLEQELKLPFTFLSGHIHELRIHVPWTKLGSEPVVITI 83

Query:    80 DTI 82
             +T+
Sbjct:    84 NTM 86




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0006810 "transport" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0015031 "protein transport" evidence=IEA
UNIPROTKB|Q7Z7G8 VPS13B "Vacuolar protein sorting-associated protein 13B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIL5 VPS13A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C549 E1C549 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2444304 Vps13a "vacuolar protein sorting 13A (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q96RL7 VPS13A "Vacuolar protein sorting-associated protein 13A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ASPGD|ASPL0000032755 AN5579 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4N6L6 MGG_06537 "Vacuolar protein sorting-associated protein 13" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|D4A899 Vps13a "Protein Vps13a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287055 vps13F "vacuolar protein sorting-associated protein 13 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
pfam12624117 pfam12624, Chorein_N, N-terminal region of Chorein 7e-20
COG5043 2552 COG5043, MRS6, Vacuolar protein sorting-associated 7e-09
>gnl|CDD|204985 pfam12624, Chorein_N, N-terminal region of Chorein, a TM vesicle-mediated sorter Back     alignment and domain information
 Score = 78.4 bits (194), Expect = 7e-20
 Identities = 25/63 (39%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 21 RSTLQLHLWEGQACFHNLELDLEALESL-VPFHFVSGHINELRIKVPWTSLGSSSVEVVI 79
          +  L + +W G     NL L  +AL+ L +P    SGHI +L +K+PW SLGS  V + I
Sbjct: 22 KEQLSVSIWSGDVELENLRLKKDALDKLDLPIEVKSGHIGKLTLKIPWKSLGSEPVVITI 81

Query: 80 DTI 82
          D +
Sbjct: 82 DDV 84


Although mutations in the full-length vacuolar protein sorting 13A (VPS13A) protein in vertebrates lead to the disease of chorea-acanthocytosis, the exact function of any of the regions within the protein is not yet known. This region is the proposed leucine zipper at the N-terminus. The full-length protein is a transmembrane protein with a presumed role in vesicle-mediated sorting and intracellular protein transport. Length = 117

>gnl|CDD|227376 COG5043, MRS6, Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
PF12624118 Chorein_N: N-terminal region of Chorein, a TM vesi 99.94
COG5043 2552 MRS6 Vacuolar protein sorting-associated protein [ 99.86
KOG1809|consensus 1827 99.73
KOG2955|consensus 1069 99.48
>PF12624 Chorein_N: N-terminal region of Chorein, a TM vesicle-mediated sorter Back     alignment and domain information
Probab=99.94  E-value=2.7e-27  Score=172.37  Aligned_cols=88  Identities=31%  Similarity=0.443  Sum_probs=82.9

Q ss_pred             HhhcccccCCcCCeeEEEeceeEEEeeceecHHHhhhc-CCeEEeEEEEeEEEEEEecCCCCCccEEEEeCceEEeeeec
Q psy4290          11 NEVAELQEFFRSTLQLHLWEGQACFHNLELDLEALESL-VPFHFVSGHINELRIKVPWTSLGSSSVEVVIDTIGYLSGIF   89 (135)
Q Consensus        11 ~lg~Yienld~~qL~lsL~~G~v~L~nL~Lk~daL~~l-lP~~v~~G~Ig~L~i~IPW~~L~s~pv~I~I~~V~I~l~~~   89 (135)
                      .||+||+|++.+|+++++|+|+++|+||+||+++|+.+ +|+++++|+||+++++|||++|+++|++|+|+||+++++|.
T Consensus        12 ~Lg~yi~~l~~~ql~vsl~~G~v~L~nl~l~~~~l~~~~lP~~v~~g~i~~l~i~IPw~~l~~~pv~i~I~~v~l~~~~~   91 (118)
T PF12624_consen   12 YLGRYIENLDKDQLSVSLWNGEVELRNLELKKDALNNLGLPIEVKSGSIGKLRIKIPWTSLWSKPVVIEIEDVFLVLKPK   91 (118)
T ss_pred             HHHHHHhcCCHHHeeeeeccCceEEEccEeeHHHhcCcCCCeEEeEEEeeeEEEEEEhHHhCCCCEEEEEeeEEEEEEEC
Confidence            44799999999999999999999999999999999999 99999999999999999999999999999999999999998


Q ss_pred             chhhhhHHh
Q psy4290          90 ECMAAIHAL   98 (135)
Q Consensus        90 ~~~~~~~~~   98 (135)
                      +...+..+.
T Consensus        92 ~~~~~~~~~  100 (118)
T PF12624_consen   92 DQDEWDNEE  100 (118)
T ss_pred             CccccChHH
Confidence            876665554



>COG5043 MRS6 Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1809|consensus Back     alignment and domain information
>KOG2955|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00