Psyllid ID: psy4316
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 377 | ||||||
| 395504589 | 218 | PREDICTED: nucleoside diphosphate kinase | 0.503 | 0.871 | 0.434 | 4e-38 | |
| 126290644 | 217 | PREDICTED: nucleoside diphosphate kinase | 0.503 | 0.875 | 0.414 | 5e-37 | |
| 291387400 | 211 | PREDICTED: non-metastatic cells 5, prote | 0.503 | 0.900 | 0.404 | 1e-35 | |
| 443731813 | 217 | hypothetical protein CAPTEDRAFT_177417 [ | 0.506 | 0.880 | 0.412 | 1e-35 | |
| 260803201 | 207 | hypothetical protein BRAFLDRAFT_61845 [B | 0.506 | 0.922 | 0.412 | 2e-35 | |
| 345318779 | 220 | PREDICTED: nucleoside diphosphate kinase | 0.527 | 0.904 | 0.397 | 2e-35 | |
| 296192829 | 212 | PREDICTED: nucleoside diphosphate kinase | 0.503 | 0.896 | 0.414 | 2e-35 | |
| 50540094 | 217 | nucleoside diphosphate kinase homolog 5 | 0.503 | 0.875 | 0.395 | 2e-35 | |
| 209735268 | 217 | Nucleoside diphosphate kinase homolog 5 | 0.503 | 0.875 | 0.385 | 2e-35 | |
| 403285359 | 212 | PREDICTED: nucleoside diphosphate kinase | 0.503 | 0.896 | 0.409 | 3e-35 |
| >gi|395504589|ref|XP_003756630.1| PREDICTED: nucleoside diphosphate kinase homolog 5 [Sarcophilus harrisii] | Back alignment and taxonomy information |
|---|
Score = 165 bits (417), Expect = 4e-38, Method: Compositional matrix adjust.
Identities = 89/205 (43%), Positives = 123/205 (60%), Gaps = 15/205 (7%)
Query: 163 EYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRL 222
E TLAL+KP E+IE I + GFTIV+++ +F+PEQ + F++ E+ + P L
Sbjct: 13 ERTLALIKPDIVDKEEEIEDIILKSGFTIVQRRKLRFSPEQCSNFYV--EQYGKMFFPNL 70
Query: 223 VCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNAIYGSR 282
YM SGP+ M+LA+ AI WL LMGP + KAK +P SLRA YG +D+ NA++GS+
Sbjct: 71 TAYMSSGPLVAMILARHNAISYWLDLMGPFNSFKAKETHPDSLRAIYGTDDLRNALHGSK 130
Query: 283 NEEEAARDIRFFFKDIIIEPSNAMESDISCEPSSNSFLAHKIYLREFVYPTLQKGLAELV 342
N A R+IRF F ++IIEP P A K YL +V PTL GL+EL
Sbjct: 131 NFAAAEREIRFMFPEVIIEPI----------PIGG---AAKDYLNMYVNPTLLAGLSELC 177
Query: 343 RMKPAHSYEWFVNWLLENDPFSPKL 367
+ KPA + W +WLL+N+P P+
Sbjct: 178 KHKPADPFIWLADWLLKNNPNKPRF 202
|
Source: Sarcophilus harrisii Species: Sarcophilus harrisii Genus: Sarcophilus Family: Dasyuridae Order: Dasyuromorphia Class: Mammalia Phylum: Chordata Superkingdom: Eukaryota |
| >gi|126290644|ref|XP_001375993.1| PREDICTED: nucleoside diphosphate kinase homolog 5-like [Monodelphis domestica] | Back alignment and taxonomy information |
|---|
| >gi|291387400|ref|XP_002710156.1| PREDICTED: non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) [Oryctolagus cuniculus] | Back alignment and taxonomy information |
|---|
| >gi|443731813|gb|ELU16784.1| hypothetical protein CAPTEDRAFT_177417 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|260803201|ref|XP_002596479.1| hypothetical protein BRAFLDRAFT_61845 [Branchiostoma floridae] gi|229281736|gb|EEN52491.1| hypothetical protein BRAFLDRAFT_61845 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|345318779|ref|XP_003430066.1| PREDICTED: nucleoside diphosphate kinase homolog 5-like isoform 2 [Ornithorhynchus anatinus] gi|345318781|ref|XP_001521837.2| PREDICTED: nucleoside diphosphate kinase homolog 5-like isoform 1 [Ornithorhynchus anatinus] gi|345318783|ref|XP_003430067.1| PREDICTED: nucleoside diphosphate kinase homolog 5-like isoform 3 [Ornithorhynchus anatinus] | Back alignment and taxonomy information |
|---|
| >gi|296192829|ref|XP_002744241.1| PREDICTED: nucleoside diphosphate kinase homolog 5 [Callithrix jacchus] | Back alignment and taxonomy information |
|---|
| >gi|50540094|ref|NP_001002516.1| nucleoside diphosphate kinase homolog 5 [Danio rerio] gi|49903033|gb|AAH76282.1| Zgc:92812 [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|209735268|gb|ACI68503.1| Nucleoside diphosphate kinase homolog 5 [Salmo salar] | Back alignment and taxonomy information |
|---|
| >gi|403285359|ref|XP_003933998.1| PREDICTED: nucleoside diphosphate kinase homolog 5 [Saimiri boliviensis boliviensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 377 | ||||||
| UNIPROTKB|P56597 | 212 | NME5 "Nucleoside diphosphate k | 0.527 | 0.938 | 0.359 | 8.4e-26 | |
| ZFIN|ZDB-GENE-040718-221 | 217 | nme5 "non-metastatic cells 5, | 0.503 | 0.875 | 0.341 | 8.4e-26 | |
| UNIPROTKB|E2RLI0 | 211 | BRD8 "Uncharacterized protein" | 0.503 | 0.900 | 0.360 | 3.6e-25 | |
| UNIPROTKB|E1BDQ6 | 209 | NME5 "Uncharacterized protein" | 0.503 | 0.909 | 0.346 | 2e-24 | |
| UNIPROTKB|I3LN92 | 212 | NME5 "Uncharacterized protein" | 0.503 | 0.896 | 0.351 | 2e-24 | |
| MGI|MGI:1922783 | 211 | Nme5 "NME/NM23 family member 5 | 0.533 | 0.952 | 0.339 | 2e-24 | |
| UNIPROTKB|E1C8A0 | 210 | NME5 "Uncharacterized protein" | 0.506 | 0.909 | 0.325 | 4.3e-22 | |
| UNIPROTKB|E1BXX8 | 592 | TXNDC3 "Uncharacterized protei | 0.326 | 0.207 | 0.373 | 5.5e-15 | |
| TAIR|locus:2018832 | 181 | AT1G17410 [Arabidopsis thalian | 0.326 | 0.679 | 0.362 | 2e-14 | |
| RGD|735069 | 587 | Nme8 "NME/NM23 family member 8 | 0.320 | 0.206 | 0.365 | 3.2e-13 |
| UNIPROTKB|P56597 NME5 "Nucleoside diphosphate kinase homolog 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 292 (107.8 bits), Expect = 8.4e-26, P = 8.4e-26
Identities = 77/214 (35%), Positives = 107/214 (50%)
Query: 163 EYTLALVKPHAFRHVEDIEQTIQEXXXXXXXXXXXXXXPEQAAEFFITREERDPVKVPRL 222
E TLA++KP E+I+ I PEQ + F++ E+ + P L
Sbjct: 13 EKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYV--EKYGKMFFPNL 70
Query: 223 VCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNAIYGSR 282
YM SGP+ M+LA+ KAI WL L+GP + AK +P SLRA YG +D+ NA++GS
Sbjct: 71 TAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGS- 129
Query: 283 NEEEAAXXXXXXXXXXXXEPSNAMESDISCEPSSNSFLAHKIYLREFVYPTLQKGLAELV 342
N+ AA M ++ EP A K YL + PTL +GL EL
Sbjct: 130 NDFAAAEREIRF-----------MFPEVIVEPIPIGQAA-KDYLNLHIMPTLLEGLTELC 177
Query: 343 RMKPAHSYEWFVNWLLENDPFSPKLKPCDLVKIP 376
+ KPA W +WLL+N+P PKL +V+ P
Sbjct: 178 KQKPADPLIWLADWLLKNNPNKPKLCHHPIVEEP 211
|
|
| ZFIN|ZDB-GENE-040718-221 nme5 "non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RLI0 BRD8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BDQ6 NME5 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LN92 NME5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1922783 Nme5 "NME/NM23 family member 5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8A0 NME5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BXX8 TXNDC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018832 AT1G17410 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|735069 Nme8 "NME/NM23 family member 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 377 | |||
| cd04418 | 132 | cd04418, NDPk5, Nucleoside diphosphate kinase homo | 2e-41 | |
| smart00562 | 135 | smart00562, NDK, Enzymes that catalyze nonsubstrat | 2e-41 | |
| cd00595 | 133 | cd00595, NDPk, Nucleoside diphosphate kinases (NDP | 4e-41 | |
| cd04416 | 132 | cd04416, NDPk_TX, NDP kinase domain of thioredoxin | 4e-39 | |
| pfam00334 | 135 | pfam00334, NDK, Nucleoside diphosphate kinase | 1e-37 | |
| cd04414 | 135 | cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N | 2e-34 | |
| PLN02931 | 177 | PLN02931, PLN02931, nucleoside diphosphate kinase | 2e-29 | |
| cd04413 | 130 | cd04413, NDPk_I, Nucleoside diphosphate kinase Gro | 5e-28 | |
| cd04412 | 134 | cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d | 2e-27 | |
| cd04415 | 131 | cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d | 4e-25 | |
| PRK00668 | 134 | PRK00668, ndk, mulitfunctional nucleoside diphosph | 1e-24 | |
| COG0105 | 135 | COG0105, Ndk, Nucleoside diphosphate kinase [Nucle | 9e-24 | |
| PRK14542 | 137 | PRK14542, PRK14542, nucleoside diphosphate kinase; | 2e-17 | |
| PRK14544 | 183 | PRK14544, PRK14544, nucleoside diphosphate kinase; | 2e-16 | |
| PRK14540 | 134 | PRK14540, PRK14540, nucleoside diphosphate kinase; | 2e-15 | |
| PRK14541 | 140 | PRK14541, PRK14541, nucleoside diphosphate kinase; | 3e-13 | |
| PRK14545 | 139 | PRK14545, PRK14545, nucleoside diphosphate kinase; | 2e-12 | |
| PTZ00093 | 149 | PTZ00093, PTZ00093, nucleoside diphosphate kinase, | 2e-10 | |
| pfam05186 | 42 | pfam05186, Dpy-30, Dpy-30 motif | 2e-05 | |
| PLN02619 | 238 | PLN02619, PLN02619, nucleoside-diphosphate kinase | 2e-04 |
| >gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species | Back alignment and domain information |
|---|
Score = 141 bits (358), Expect = 2e-41
Identities = 62/134 (46%), Positives = 84/134 (62%), Gaps = 2/134 (1%)
Query: 163 EYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRL 222
E TLA++KP A E+IE I E GFTIV+K+ + +PEQ ++F+ E + P L
Sbjct: 1 ERTLAIIKPDAVHKAEEIEDIILESGFTIVQKRKLQLSPEQCSDFYA--EHYGKMFFPHL 58
Query: 223 VCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNAIYGSR 282
V YM SGP+ MVLA+ AI W L+GP + KAK +P SLRA YG +D+ NA++GS
Sbjct: 59 VAYMSSGPIVAMVLARHNAISYWKELLGPTNSLKAKETHPDSLRAIYGTDDLRNAVHGSD 118
Query: 283 NEEEAARDIRFFFK 296
+ A R+IRF F
Sbjct: 119 SFSSAEREIRFMFP 132
|
It belongs to the nm23 Group II genes and appears to differ from the other human NDPks in that it lacks two important catalytic site residues, and thus does not appear to possess NDP kinase activity. NDPk5 confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes, including glutathione peroxidase 5 (Gpx5). Length = 132 |
| >gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates | Back alignment and domain information |
|---|
| >gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation | Back alignment and domain information |
|---|
| >gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues | Back alignment and domain information |
|---|
| >gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate | Back alignment and domain information |
|---|
| >gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|147395 pfam05186, Dpy-30, Dpy-30 motif | Back alignment and domain information |
|---|
| >gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| cd04415 | 131 | NDPk7A Nucleoside diphosphate kinase 7 domain A (N | 100.0 | |
| cd04418 | 132 | NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP | 100.0 | |
| PLN02931 | 177 | nucleoside diphosphate kinase family protein | 100.0 | |
| PRK14542 | 137 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| PRK14541 | 140 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| cd04414 | 135 | NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase | 100.0 | |
| PRK14545 | 139 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| PTZ00093 | 149 | nucleoside diphosphate kinase, cytosolic; Provisio | 100.0 | |
| COG0105 | 135 | Ndk Nucleoside diphosphate kinase [Nucleotide tran | 100.0 | |
| PRK14540 | 134 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| cd04412 | 134 | NDPk7B Nucleoside diphosphate kinase 7 domain B (N | 100.0 | |
| cd04416 | 132 | NDPk_TX NDP kinase domain of thioredoxin domain-co | 100.0 | |
| cd00595 | 133 | NDPk Nucleoside diphosphate kinases (NDP kinases, | 100.0 | |
| PRK00668 | 134 | ndk mulitfunctional nucleoside diphosphate kinase/ | 100.0 | |
| PRK14543 | 169 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| cd04413 | 130 | NDPk_I Nucleoside diphosphate kinase Group I (NDPk | 100.0 | |
| PF00334 | 135 | NDK: Nucleoside diphosphate kinase; InterPro: IPR0 | 100.0 | |
| PLN02619 | 238 | nucleoside-diphosphate kinase | 100.0 | |
| smart00562 | 135 | NDK These are enzymes that catalyze nonsubstrate s | 100.0 | |
| PRK14544 | 183 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| KOG0888|consensus | 156 | 100.0 | ||
| PF05186 | 42 | Dpy-30: Dpy-30 motif; InterPro: IPR007858 This mot | 99.66 | |
| KOG4109|consensus | 116 | 99.09 | ||
| KOG0888|consensus | 156 | 98.5 | ||
| COG0105 | 135 | Ndk Nucleoside diphosphate kinase [Nucleotide tran | 98.03 | |
| PRK14542 | 137 | nucleoside diphosphate kinase; Provisional | 97.9 | |
| PRK14541 | 140 | nucleoside diphosphate kinase; Provisional | 97.78 | |
| PLN02619 | 238 | nucleoside-diphosphate kinase | 97.75 | |
| cd04415 | 131 | NDPk7A Nucleoside diphosphate kinase 7 domain A (N | 97.66 | |
| PRK14540 | 134 | nucleoside diphosphate kinase; Provisional | 97.65 | |
| PRK14545 | 139 | nucleoside diphosphate kinase; Provisional | 97.61 | |
| PTZ00093 | 149 | nucleoside diphosphate kinase, cytosolic; Provisio | 97.53 | |
| PRK00668 | 134 | ndk mulitfunctional nucleoside diphosphate kinase/ | 97.38 | |
| cd04418 | 132 | NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP | 97.34 | |
| cd04413 | 130 | NDPk_I Nucleoside diphosphate kinase Group I (NDPk | 97.28 | |
| PRK14543 | 169 | nucleoside diphosphate kinase; Provisional | 97.14 | |
| cd04414 | 135 | NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase | 97.02 | |
| PLN02931 | 177 | nucleoside diphosphate kinase family protein | 96.96 | |
| cd00595 | 133 | NDPk Nucleoside diphosphate kinases (NDP kinases, | 96.92 | |
| cd04412 | 134 | NDPk7B Nucleoside diphosphate kinase 7 domain B (N | 96.88 | |
| PRK14544 | 183 | nucleoside diphosphate kinase; Provisional | 96.79 | |
| cd04416 | 132 | NDPk_TX NDP kinase domain of thioredoxin domain-co | 96.75 | |
| smart00562 | 135 | NDK These are enzymes that catalyze nonsubstrate s | 96.28 | |
| PF02197 | 38 | RIIa: Regulatory subunit of type II PKA R-subunit; | 95.93 | |
| PF00334 | 135 | NDK: Nucleoside diphosphate kinase; InterPro: IPR0 | 95.44 | |
| smart00394 | 38 | RIIa RIIalpha, Regulatory subunit portion of type | 94.74 | |
| PTZ00378 | 518 | hypothetical protein; Provisional | 87.49 | |
| KOG4109|consensus | 116 | 84.17 |
| >cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.7e-44 Score=311.22 Aligned_cols=131 Identities=39% Similarity=0.638 Sum_probs=129.6
Q ss_pred ceEEEEEcCccccchHHHHHHHHHcCCeEEEEEEeecCHHHHHHhcccccccCCCCcccccceeecCcEEEEEEeeccHH
Q psy4316 163 EYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAI 242 (377)
Q Consensus 163 ErTLaLIKPDAv~~~G~II~~I~e~GF~Iv~~Kmv~Ls~e~A~efY~~~e~~gk~ff~~LV~~MtSGPvVaL~L~G~NAV 242 (377)
|+||+|||||+++++|+||++|+++||.|+++||++||+++|++||. +|+|++||++|+++|+|||++||+|.|+|||
T Consensus 1 erTl~iIKPdav~~~g~Il~~i~~~Gf~I~~~k~~~lt~~~a~~~y~--~~~gk~f~~~Lv~~m~sgp~va~~l~g~nav 78 (131)
T cd04415 1 EKTLALIKPDAYSKIGKIIQIIEDAGFTITKAKMTKLSRKEAQDFYA--EHQSKPFYNELVQFMTSGPIVAMELVGDDAI 78 (131)
T ss_pred CeEEEEECcHHHHhHHHHHHHHHHCCCEEEEeeeecCCHHHHHHHHH--HhCCCCchHHHHHHHhcCCeEEEEEECCcHH
Confidence 68999999999999999999999999999999999999999999999 9999999999999999999999999999999
Q ss_pred HHHHHHhCCCChhhhhhcCCCcccccccCCCccceEEcCCCHHHHHHHHHhcc
Q psy4316 243 RRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNAIYGSRNEEEAARDIRFFF 295 (377)
Q Consensus 243 ~~wReLiGPtdP~~Ar~~~P~SLRA~fG~d~~rNaVHgSDs~esA~rEi~fFF 295 (377)
++||++|||+||..|+...|+|||++||.+.++|+|||||++++|.+|+.|||
T Consensus 79 ~~~R~l~Gpt~p~~A~~~~p~siR~~fg~~~~~N~vH~Sds~e~a~~Ei~~fF 131 (131)
T cd04415 79 SEWRKLLGPTNSSVARSDAPNSIRALFGTDGTRNAAHGSDSVASAARELEFFF 131 (131)
T ss_pred HHHHHHhCCCChHHhhccCCCcchhhhcccccceeEECCCCHHHHHHHHHhhC
Confidence 99999999999999999999999999999999999999999999999999998
|
The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner. |
| >cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species | Back alignment and domain information |
|---|
| >PLN02931 nucleoside diphosphate kinase family protein | Back alignment and domain information |
|---|
| >PRK14542 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14541 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues | Back alignment and domain information |
|---|
| >PRK14545 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional | Back alignment and domain information |
|---|
| >COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14540 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively | Back alignment and domain information |
|---|
| >cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation | Back alignment and domain information |
|---|
| >PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated | Back alignment and domain information |
|---|
| >PRK14543 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate | Back alignment and domain information |
|---|
| >PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 | Back alignment and domain information |
|---|
| >PLN02619 nucleoside-diphosphate kinase | Back alignment and domain information |
|---|
| >smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates | Back alignment and domain information |
|---|
| >PRK14544 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0888|consensus | Back alignment and domain information |
|---|
| >PF05186 Dpy-30: Dpy-30 motif; InterPro: IPR007858 This motif is about 40 residues long and is probably formed of two alpha-helices | Back alignment and domain information |
|---|
| >KOG4109|consensus | Back alignment and domain information |
|---|
| >KOG0888|consensus | Back alignment and domain information |
|---|
| >COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14542 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14541 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02619 nucleoside-diphosphate kinase | Back alignment and domain information |
|---|
| >cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >PRK14540 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14545 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional | Back alignment and domain information |
|---|
| >PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated | Back alignment and domain information |
|---|
| >cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species | Back alignment and domain information |
|---|
| >cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate | Back alignment and domain information |
|---|
| >PRK14543 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues | Back alignment and domain information |
|---|
| >PLN02931 nucleoside diphosphate kinase family protein | Back alignment and domain information |
|---|
| >cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation | Back alignment and domain information |
|---|
| >cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >PRK14544 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively | Back alignment and domain information |
|---|
| >smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates | Back alignment and domain information |
|---|
| >PF02197 RIIa: Regulatory subunit of type II PKA R-subunit; InterPro: IPR003117 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 | Back alignment and domain information |
|---|
| >smart00394 RIIa RIIalpha, Regulatory subunit portion of type II PKA R-subunit | Back alignment and domain information |
|---|
| >PTZ00378 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4109|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 377 | ||||
| 3ztq_A | 142 | Hexagonal Crystal Form P61 Of The Aquifex Aeolicus | 6e-11 | ||
| 3vgs_A | 141 | Wild-Type Nucleoside Diphosphate Kinase Derived Fro | 3e-07 | ||
| 3vgu_A | 141 | E134a Mutant Nucleoside Diphosphate Kinase Derived | 3e-07 | ||
| 2zua_A | 174 | Crystal Structure Of Nucleoside Diphosphate Kinase | 4e-07 | ||
| 3pj9_A | 140 | Crystal Structure Of A Nucleoside Diphosphate Kinas | 1e-06 | ||
| 4dut_A | 145 | The Structure Of Nucleoside Diphosphate Kinase (Ndk | 8e-06 | ||
| 2az3_A | 164 | Structure Of A Halophilic Nucleoside Diphosphate Ki | 1e-05 | ||
| 2az1_A | 181 | Structure Of A Halophilic Nucleoside Diphosphate Ki | 1e-05 | ||
| 2hur_A | 142 | Escherichia Coli Nucleoside Diphosphate Kinase Leng | 5e-04 | ||
| 2vu5_A | 148 | Crystal Structure Of Pndk From Bacillus Anthracis L | 9e-04 |
| >pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 | Back alignment and structure |
|
| >pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 | Back alignment and structure |
| >pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 | Back alignment and structure |
| >pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 | Back alignment and structure |
| >pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 | Back alignment and structure |
| >pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 | Back alignment and structure |
| >pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 | Back alignment and structure |
| >pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 | Back alignment and structure |
| >pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 | Back alignment and structure |
| >pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 377 | |||
| 3ztp_A | 142 | Nucleoside diphosphate kinase; transferase; HET: G | 2e-28 | |
| 4ek2_A | 145 | Nucleoside diphosphate kinase; seattle structural | 5e-26 | |
| 2hur_A | 142 | NDK, nucleoside diphosphate kinase, NDP kinase; ty | 8e-26 | |
| 1nhk_R | 144 | Nucleoside diphosphate kinase; phosphotransferase; | 2e-25 | |
| 3mpd_A | 151 | Nucleoside diphosphate kinase; ssgcid, NIH, niaid, | 3e-25 | |
| 1wkj_A | 137 | Nucleoside diphosphate kinase; thermus thermophilu | 9e-25 | |
| 1u8w_A | 149 | Nucleoside diphosphate kinase I; nucleotide diphos | 1e-24 | |
| 1zs6_A | 169 | Nucleoside diphosphate kinase 3; nucleotide metabo | 2e-24 | |
| 2dxe_A | 160 | Nucleoside diphosphate kinase; nucleoside binding, | 2e-24 | |
| 1ehw_A | 162 | NDPK H4, nucleoside diphosphate kinase; NM23, mito | 2e-24 | |
| 4fkx_A | 161 | NDK B, nucleoside diphosphate kinase; structural g | 2e-24 | |
| 1pku_A | 150 | Nucleoside diphosphate kinase I; RICE, transferase | 3e-24 | |
| 3bbb_A | 151 | Nucleoside diphosphate kinase B; transcription fac | 3e-24 | |
| 4dz6_A | 190 | Nucleoside diphosphate kinase; ssgcid, niaid, vana | 3e-24 | |
| 2vu5_A | 148 | Nucleoside diphosphate kinase; nucleotide-binding, | 3e-24 | |
| 3r9l_A | 155 | Nucleoside diphosphate kinase; structural genomics | 5e-24 | |
| 1k44_A | 136 | Nucleoside diphosphate kinase; nucleoside triphosp | 5e-24 | |
| 3fkb_A | 155 | NDP kinase, NDK, nucleoside diphosphate kinase, cy | 6e-24 | |
| 3l7u_A | 172 | Nucleoside diphosphate kinase A; ATP-binding, nucl | 6e-24 | |
| 1w7w_A | 182 | Nucleoside diphosphate kinase; NDPK3, transferase; | 7e-24 | |
| 3js9_A | 156 | Nucleoside diphosphate kinase family protein; niai | 7e-24 | |
| 1s57_A | 153 | Nucleoside diphosphate kinase II; transferase; HET | 8e-24 | |
| 3b54_A | 161 | NDK, NDP kinase, nucleoside diphosphate kinase; al | 1e-23 | |
| 3evo_A | 146 | NDP kinase, NDK, nucleoside diphosphate kinase; ph | 2e-23 | |
| 3q8u_A | 157 | Nucleoside diphosphate kinase; ferridoxin fold, al | 2e-23 | |
| 1nb2_A | 150 | Nucleoside diphosphate kinase; bacillus halodenitr | 2e-23 | |
| 1xiq_A | 157 | Nucleoside diphosphate kinase B; protein structure | 3e-23 | |
| 2az3_A | 164 | Nucleoside diphosphate kinase; halophilic, transfe | 2e-22 | |
| 1xqi_A | 195 | Nucleoside diphosphate kinase; alpha/beta sandwich | 7e-19 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 3g36_A | 55 | Protein DPY-30 homolog; X-type four-helix bundle, | 5e-07 |
| >3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 | Back alignment and structure |
|---|
Score = 106 bits (268), Expect = 2e-28
Identities = 53/137 (38%), Positives = 77/137 (56%), Gaps = 4/137 (2%)
Query: 163 EYTLALVKPHAFR--HVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVP 220
E TL +VKP A + I ++GF I K F+FTPE+A EF+ ER P
Sbjct: 4 ERTLIIVKPDAMEKGALGKILDRFIQEGFQIKALKMFRFTPEKAGEFYYVHRER-PF-FQ 61
Query: 221 RLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNAIYG 280
LV +M SGPV VL + AI+R ++GP D ++A+++ P S+RA++G + NAI+
Sbjct: 62 ELVEFMSSGPVVAAVLEGEDAIKRVREIIGPTDSEEARKVAPNSIRAQFGTDKGKNAIHA 121
Query: 281 SRNEEEAARDIRFFFKD 297
S + E A +I F F
Sbjct: 122 SDSPESAQYEICFIFSG 138
|
| >4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 | Back alignment and structure |
|---|
| >2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 | Back alignment and structure |
|---|
| >1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 | Back alignment and structure |
|---|
| >3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 | Back alignment and structure |
|---|
| >1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 | Back alignment and structure |
|---|
| >1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 | Back alignment and structure |
|---|
| >1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 | Back alignment and structure |
|---|
| >2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 | Back alignment and structure |
|---|
| >1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 | Back alignment and structure |
|---|
| >4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 | Back alignment and structure |
|---|
| >1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 | Back alignment and structure |
|---|
| >3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 | Back alignment and structure |
|---|
| >4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 | Back alignment and structure |
|---|
| >2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 | Back alignment and structure |
|---|
| >3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 | Back alignment and structure |
|---|
| >1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 | Back alignment and structure |
|---|
| >3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 | Back alignment and structure |
|---|
| >3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 | Back alignment and structure |
|---|
| >3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 | Back alignment and structure |
|---|
| >1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 | Back alignment and structure |
|---|
| >3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 | Back alignment and structure |
|---|
| >3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 | Back alignment and structure |
|---|
| >3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 | Back alignment and structure |
|---|
| >1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 | Back alignment and structure |
|---|
| >1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 | Back alignment and structure |
|---|
| >2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 | Back alignment and structure |
|---|
| >1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3g36_A Protein DPY-30 homolog; X-type four-helix bundle, nucleus, nuclear protein; 1.20A {Homo sapiens} Length = 55 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| 4hr2_A | 145 | Nucleoside diphosphate kinase; ssgcid, seattle str | 100.0 | |
| 3ztp_A | 142 | Nucleoside diphosphate kinase; transferase; HET: G | 100.0 | |
| 3evo_A | 146 | NDP kinase, NDK, nucleoside diphosphate kinase; ph | 100.0 | |
| 3fkb_A | 155 | NDP kinase, NDK, nucleoside diphosphate kinase, cy | 100.0 | |
| 3q8u_A | 157 | Nucleoside diphosphate kinase; ferridoxin fold, al | 100.0 | |
| 3mpd_A | 151 | Nucleoside diphosphate kinase; ssgcid, NIH, niaid, | 100.0 | |
| 1wkj_A | 137 | Nucleoside diphosphate kinase; thermus thermophilu | 100.0 | |
| 1k44_A | 136 | Nucleoside diphosphate kinase; nucleoside triphosp | 100.0 | |
| 4fkx_A | 161 | NDK B, nucleoside diphosphate kinase; structural g | 100.0 | |
| 2hur_A | 142 | NDK, nucleoside diphosphate kinase, NDP kinase; ty | 100.0 | |
| 3r9l_A | 155 | Nucleoside diphosphate kinase; structural genomics | 100.0 | |
| 1nhk_R | 144 | Nucleoside diphosphate kinase; phosphotransferase; | 100.0 | |
| 1u8w_A | 149 | Nucleoside diphosphate kinase I; nucleotide diphos | 100.0 | |
| 3l7u_A | 172 | Nucleoside diphosphate kinase A; ATP-binding, nucl | 100.0 | |
| 1pku_A | 150 | Nucleoside diphosphate kinase I; RICE, transferase | 100.0 | |
| 2vu5_A | 148 | Nucleoside diphosphate kinase; nucleotide-binding, | 100.0 | |
| 1xiq_A | 157 | Nucleoside diphosphate kinase B; protein structure | 100.0 | |
| 1s57_A | 153 | Nucleoside diphosphate kinase II; transferase; HET | 100.0 | |
| 3bbb_A | 151 | Nucleoside diphosphate kinase B; transcription fac | 100.0 | |
| 1nb2_A | 150 | Nucleoside diphosphate kinase; bacillus halodenitr | 100.0 | |
| 3js9_A | 156 | Nucleoside diphosphate kinase family protein; niai | 100.0 | |
| 1ehw_A | 162 | NDPK H4, nucleoside diphosphate kinase; NM23, mito | 100.0 | |
| 3b54_A | 161 | NDK, NDP kinase, nucleoside diphosphate kinase; al | 100.0 | |
| 2dxe_A | 160 | Nucleoside diphosphate kinase; nucleoside binding, | 100.0 | |
| 1zs6_A | 169 | Nucleoside diphosphate kinase 3; nucleotide metabo | 100.0 | |
| 1w7w_A | 182 | Nucleoside diphosphate kinase; NDPK3, transferase; | 100.0 | |
| 2az3_A | 164 | Nucleoside diphosphate kinase; halophilic, transfe | 100.0 | |
| 4dz6_A | 190 | Nucleoside diphosphate kinase; ssgcid, niaid, vana | 100.0 | |
| 1xqi_A | 195 | Nucleoside diphosphate kinase; alpha/beta sandwich | 100.0 | |
| 3bh7_B | 352 | Protein XRP2; protein-protein complex, GTPase acti | 99.96 | |
| 3g36_A | 55 | Protein DPY-30 homolog; X-type four-helix bundle, | 99.71 | |
| 3evo_A | 146 | NDP kinase, NDK, nucleoside diphosphate kinase; ph | 98.41 | |
| 4fkx_A | 161 | NDK B, nucleoside diphosphate kinase; structural g | 98.36 | |
| 3r9l_A | 155 | Nucleoside diphosphate kinase; structural genomics | 98.34 | |
| 3mpd_A | 151 | Nucleoside diphosphate kinase; ssgcid, NIH, niaid, | 98.32 | |
| 3fkb_A | 155 | NDP kinase, NDK, nucleoside diphosphate kinase, cy | 98.3 | |
| 4hr2_A | 145 | Nucleoside diphosphate kinase; ssgcid, seattle str | 98.3 | |
| 1nb2_A | 150 | Nucleoside diphosphate kinase; bacillus halodenitr | 98.28 | |
| 3l7u_A | 172 | Nucleoside diphosphate kinase A; ATP-binding, nucl | 98.27 | |
| 3js9_A | 156 | Nucleoside diphosphate kinase family protein; niai | 98.27 | |
| 3q8u_A | 157 | Nucleoside diphosphate kinase; ferridoxin fold, al | 98.25 | |
| 2vu5_A | 148 | Nucleoside diphosphate kinase; nucleotide-binding, | 98.25 | |
| 3bbb_A | 151 | Nucleoside diphosphate kinase B; transcription fac | 98.23 | |
| 1wkj_A | 137 | Nucleoside diphosphate kinase; thermus thermophilu | 98.22 | |
| 1k44_A | 136 | Nucleoside diphosphate kinase; nucleoside triphosp | 98.21 | |
| 1nhk_R | 144 | Nucleoside diphosphate kinase; phosphotransferase; | 98.2 | |
| 2hur_A | 142 | NDK, nucleoside diphosphate kinase, NDP kinase; ty | 98.2 | |
| 1pku_A | 150 | Nucleoside diphosphate kinase I; RICE, transferase | 98.2 | |
| 1s57_A | 153 | Nucleoside diphosphate kinase II; transferase; HET | 98.19 | |
| 1u8w_A | 149 | Nucleoside diphosphate kinase I; nucleotide diphos | 98.19 | |
| 1xiq_A | 157 | Nucleoside diphosphate kinase B; protein structure | 98.18 | |
| 2az3_A | 164 | Nucleoside diphosphate kinase; halophilic, transfe | 98.17 | |
| 1ehw_A | 162 | NDPK H4, nucleoside diphosphate kinase; NM23, mito | 98.16 | |
| 1zs6_A | 169 | Nucleoside diphosphate kinase 3; nucleotide metabo | 98.16 | |
| 3b54_A | 161 | NDK, NDP kinase, nucleoside diphosphate kinase; al | 98.13 | |
| 3ztp_A | 142 | Nucleoside diphosphate kinase; transferase; HET: G | 98.12 | |
| 2dxe_A | 160 | Nucleoside diphosphate kinase; nucleoside binding, | 98.12 | |
| 1w7w_A | 182 | Nucleoside diphosphate kinase; NDPK3, transferase; | 98.12 | |
| 4dz6_A | 190 | Nucleoside diphosphate kinase; ssgcid, niaid, vana | 98.01 | |
| 1xqi_A | 195 | Nucleoside diphosphate kinase; alpha/beta sandwich | 97.48 | |
| 4f9k_A | 95 | CAMP-dependent protein kinase type I-beta regulat | 96.77 | |
| 3bh7_B | 352 | Protein XRP2; protein-protein complex, GTPase acti | 96.34 | |
| 2izx_A | 41 | CAMP-dependent protein kinase type II-alpha regula | 94.15 | |
| 2kyg_A | 50 | CAMP-dependent protein kinase type II-alpha regul | 93.79 | |
| 2izy_A | 54 | CAMP-dependent protein kinase regulatory subunit I | 93.61 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 85.23 |
| >4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-46 Score=330.71 Aligned_cols=136 Identities=31% Similarity=0.477 Sum_probs=131.6
Q ss_pred cccceEEEEEcCccccc--hHHHHHHHHHcCCeEEEEEEeecCHHHHHHhcccccccCCCCcccccceeecCcEEEEEEe
Q psy4316 160 HCYEYTLALVKPHAFRH--VEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLA 237 (377)
Q Consensus 160 ~~~ErTLaLIKPDAv~~--~G~II~~I~e~GF~Iv~~Kmv~Ls~e~A~efY~~~e~~gk~ff~~LV~~MtSGPvVaL~L~ 237 (377)
..+|+||+||||||+++ +|+||++|+++||.|+++||++||+++|++||. +|++++||++|++||+||||+||+|+
T Consensus 5 m~~ErTl~iIKPDav~~~l~g~Ii~rie~~Gf~I~~~k~~~lt~e~a~~fY~--~h~~kpff~~Lv~~mtSGPvva~vle 82 (145)
T 4hr2_A 5 MALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYA--VHAERPFFKDLVEFMISGPVMIQVLE 82 (145)
T ss_dssp CCEEEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTG--GGTTSTTHHHHHHHHTSSCEEEEEEE
T ss_pred chHHHeEEEEChHHhhcCCHHHHHHHHHHCCCEEEEEeeecCCHHHHHHHHH--HHhcCchHHHHHHHhcCCCEEEEEEE
Confidence 34799999999999987 799999999999999999999999999999999 99999999999999999999999999
Q ss_pred eccHHHHHHHHhCCCChhhhhhcCCCcccccccCCCccceEEcCCCHHHHHHHHHhccCCCcc
Q psy4316 238 KQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNAIYGSRNEEEAARDIRFFFKDIII 300 (377)
Q Consensus 238 G~NAV~~wReLiGPtdP~~Ar~~~P~SLRA~fG~d~~rNaVHgSDs~esA~rEi~fFFp~~~~ 300 (377)
|+|||+.||+|+|||||..| .|+|||++||.+..+|+||||||+++|++||.||||+..+
T Consensus 83 g~~aV~~~R~l~G~tdp~~A---~pgtIR~~fg~~~~~N~vHgSDs~e~A~rEi~~fF~~~ei 142 (145)
T 4hr2_A 83 GEDAILKNRDLMGATDPKKA---EKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNV 142 (145)
T ss_dssp EETHHHHHHHHHCCSSTTTS---CTTSHHHHHCSBTTBCSEEECCSHHHHHHHHHHHCCGGGC
T ss_pred cCCcHhHHhhccCCCCcccC---CCCCcHHHhcCCcCccceECCCCHHHHHHHHHHhCChhhc
Confidence 99999999999999999999 6999999999999999999999999999999999998655
|
| >3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A | Back alignment and structure |
|---|
| >3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... | Back alignment and structure |
|---|
| >3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... | Back alignment and structure |
|---|
| >3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* | Back alignment and structure |
|---|
| >3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* | Back alignment and structure |
|---|
| >1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* | Back alignment and structure |
|---|
| >2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} | Back alignment and structure |
|---|
| >3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A | Back alignment and structure |
|---|
| >1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* | Back alignment and structure |
|---|
| >3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* | Back alignment and structure |
|---|
| >1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* | Back alignment and structure |
|---|
| >1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A | Back alignment and structure |
|---|
| >4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* | Back alignment and structure |
|---|
| >1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A | Back alignment and structure |
|---|
| >3g36_A Protein DPY-30 homolog; X-type four-helix bundle, nucleus, nuclear protein; 1.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... | Back alignment and structure |
|---|
| >4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* | Back alignment and structure |
|---|
| >3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... | Back alignment and structure |
|---|
| >4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* | Back alignment and structure |
|---|
| >1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* | Back alignment and structure |
|---|
| >2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* | Back alignment and structure |
|---|
| >1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* | Back alignment and structure |
|---|
| >1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A | Back alignment and structure |
|---|
| >2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} | Back alignment and structure |
|---|
| >1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* | Back alignment and structure |
|---|
| >1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A | Back alignment and structure |
|---|
| >1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A | Back alignment and structure |
|---|
| >2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* | Back alignment and structure |
|---|
| >1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* | Back alignment and structure |
|---|
| >1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >4f9k_A CAMP-dependent protein kinase type I-beta regulat subunit; structural genomics, PSI-biology; 2.80A {Homo sapiens} PDB: 2ezw_A 3im3_A 3im4_A | Back alignment and structure |
|---|
| >3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A | Back alignment and structure |
|---|
| >2izx_A CAMP-dependent protein kinase type II-alpha regulatory subunit; CAMP-binding, phosphorylation, nucleotide-binding, PKA, CAMP, anchor, kinase, acetylation; 1.3A {Homo sapiens} PDB: 2hwn_A | Back alignment and structure |
|---|
| >2kyg_A CAMP-dependent protein kinase type II-alpha regul subunit; protein/protein, homodimer bound to monomer, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2izy_A CAMP-dependent protein kinase regulatory subunit II; D/D, RII, PKA, acetylation, transferase, CAMP- binding, phosphorylation, nucleotide-binding; 2.2A {Mus musculus} SCOP: a.31.1.1 PDB: 1l6e_A 1r2a_A 2drn_A 2h9r_A | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 377 | ||||
| d1zs6a1 | 152 | d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, | 5e-32 | |
| d3bbba1 | 150 | d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, | 2e-31 | |
| d1k44a_ | 135 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 4e-31 | |
| d1ehwa_ | 143 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 1e-30 | |
| d1nhkl_ | 143 | d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { | 2e-30 | |
| d1xqia1 | 182 | d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, | 7e-30 | |
| d1s57a_ | 153 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 1e-29 | |
| d1wkja1 | 137 | d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, | 2e-29 | |
| d1w7wa_ | 151 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 1e-28 | |
| d2az3a1 | 152 | d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, | 2e-28 | |
| d1hlwa_ | 150 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 3e-28 | |
| d1xiqa_ | 149 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 3e-28 | |
| d1u8wa_ | 149 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 1e-27 | |
| d1nb2a_ | 149 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 6e-27 | |
| d2dyaa1 | 153 | d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, | 8e-25 | |
| d2b8qa1 | 128 | d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, | 9e-25 |
| >d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: Nucleoside diphosphate kinase, NDK family: Nucleoside diphosphate kinase, NDK domain: Nucleoside diphosphate kinase, NDK species: Human(Homo sapiens), NDK3 [TaxId: 9606]
Score = 115 bits (290), Expect = 5e-32
Identities = 43/152 (28%), Positives = 70/152 (46%), Gaps = 8/152 (5%)
Query: 162 YEYTLALVKPHAFRH--VEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKV 219
+E T VKP + V +I + + KGF +V K + + E E + E R+
Sbjct: 4 HERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHY--AELRERPFY 61
Query: 220 PRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNAIY 279
RLV YM SGPV MV +R L+G +P A P ++R + + N I+
Sbjct: 62 GRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAP---PGTIRGDFCIEVGKNLIH 118
Query: 280 GSRNEEEAARDIRFFFKDI-IIEPSNAMESDI 310
GS + E A R+I +F+ ++ ++ +
Sbjct: 119 GSDSVESARREIALWFRADELLCWEDSAGHWL 150
|
| >d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 | Back information, alignment and structure |
|---|
| >d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 | Back information, alignment and structure |
|---|
| >d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 | Back information, alignment and structure |
|---|
| >d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 | Back information, alignment and structure |
|---|
| >d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 | Back information, alignment and structure |
|---|
| >d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 | Back information, alignment and structure |
|---|
| >d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 | Back information, alignment and structure |
|---|
| >d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 | Back information, alignment and structure |
|---|
| >d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 | Back information, alignment and structure |
|---|
| >d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 | Back information, alignment and structure |
|---|
| >d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 | Back information, alignment and structure |
|---|
| >d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 | Back information, alignment and structure |
|---|
| >d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 | Back information, alignment and structure |
|---|
| >d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| d1nhkl_ | 143 | Nucleoside diphosphate kinase, NDK {Myxococcus xan | 100.0 | |
| d1ehwa_ | 143 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 100.0 | |
| d1u8wa_ | 149 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 100.0 | |
| d1wkja1 | 137 | Nucleoside diphosphate kinase, NDK {Thermus thermo | 100.0 | |
| d1k44a_ | 135 | Nucleoside diphosphate kinase, NDK {Mycobacterium | 100.0 | |
| d1xiqa_ | 149 | Nucleoside diphosphate kinase, NDK {Plasmodium fal | 100.0 | |
| d3bbba1 | 150 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 100.0 | |
| d1s57a_ | 153 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 100.0 | |
| d1zs6a1 | 152 | Nucleoside diphosphate kinase, NDK {Human(Homo sap | 100.0 | |
| d1nb2a_ | 149 | Nucleoside diphosphate kinase, NDK {Bacillus halod | 100.0 | |
| d1hlwa_ | 150 | Nucleoside diphosphate kinase, NDK {Dictyostelium | 100.0 | |
| d1w7wa_ | 151 | Nucleoside diphosphate kinase, NDK {Pea (Pisum sat | 100.0 | |
| d2dyaa1 | 153 | Nucleoside diphosphate kinase, NDK {Archaeon Pyroc | 100.0 | |
| d2az3a1 | 152 | Nucleoside diphosphate kinase, NDK {Archaeon Halob | 100.0 | |
| d1xqia1 | 182 | Nucleoside diphosphate kinase, NDK {Archaeon Pyrob | 100.0 | |
| d2b8qa1 | 128 | Nucleoside diphosphate kinase, NDK {Mimivirus [Tax | 100.0 | |
| d1s57a_ | 153 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 97.98 | |
| d1nb2a_ | 149 | Nucleoside diphosphate kinase, NDK {Bacillus halod | 97.82 | |
| d1wkja1 | 137 | Nucleoside diphosphate kinase, NDK {Thermus thermo | 97.8 | |
| d2az3a1 | 152 | Nucleoside diphosphate kinase, NDK {Archaeon Halob | 97.73 | |
| d1u8wa_ | 149 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 97.73 | |
| d1w7wa_ | 151 | Nucleoside diphosphate kinase, NDK {Pea (Pisum sat | 97.71 | |
| d3bbba1 | 150 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 97.7 | |
| d1ehwa_ | 143 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 97.69 | |
| d1hlwa_ | 150 | Nucleoside diphosphate kinase, NDK {Dictyostelium | 97.66 | |
| d1nhkl_ | 143 | Nucleoside diphosphate kinase, NDK {Myxococcus xan | 97.65 | |
| d1zs6a1 | 152 | Nucleoside diphosphate kinase, NDK {Human(Homo sap | 97.62 | |
| d1k44a_ | 135 | Nucleoside diphosphate kinase, NDK {Mycobacterium | 97.56 | |
| d1xiqa_ | 149 | Nucleoside diphosphate kinase, NDK {Plasmodium fal | 97.55 | |
| d1xqia1 | 182 | Nucleoside diphosphate kinase, NDK {Archaeon Pyrob | 97.39 | |
| d2b8qa1 | 128 | Nucleoside diphosphate kinase, NDK {Mimivirus [Tax | 97.39 | |
| d2dyaa1 | 153 | Nucleoside diphosphate kinase, NDK {Archaeon Pyroc | 97.22 | |
| d2ezwa1 | 50 | cAMP-dependent protein kinase type I-alpha regulat | 95.19 |
| >d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: Nucleoside diphosphate kinase, NDK family: Nucleoside diphosphate kinase, NDK domain: Nucleoside diphosphate kinase, NDK species: Myxococcus xanthus [TaxId: 34]
Probab=100.00 E-value=2e-45 Score=321.51 Aligned_cols=139 Identities=27% Similarity=0.432 Sum_probs=135.0
Q ss_pred cceEEEEEcCccccc--hHHHHHHHHHcCCeEEEEEEeecCHHHHHHhcccccccCCCCcccccceeecCcEEEEEEeec
Q psy4316 162 YEYTLALVKPHAFRH--VEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQ 239 (377)
Q Consensus 162 ~ErTLaLIKPDAv~~--~G~II~~I~e~GF~Iv~~Kmv~Ls~e~A~efY~~~e~~gk~ff~~LV~~MtSGPvVaL~L~G~ 239 (377)
+|+||+||||||+++ +|+||++|+++||.|+++|+++||+++|++||. +|++++||+.|++||+||||+||+|.|+
T Consensus 2 ~E~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~lt~e~a~~~Y~--~~~~~~ff~~lv~~mtSgpvva~vl~g~ 79 (143)
T d1nhkl_ 2 IERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYA--VHKARPFFKDLVQFMISGPVVLMVLEGE 79 (143)
T ss_dssp EEEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTG--GGTTSTTHHHHHHHHTSSCEEEEEEEEE
T ss_pred chheEEEEChhhhccCCHHHHHHHHHHcCCEEEEEEEecCCHHHHHHHHH--hhcccchHHHHHhccCCCCEEEEEEEec
Confidence 699999999999987 799999999999999999999999999999999 9999999999999999999999999999
Q ss_pred cHHHHHHHHhCCCChhhhhhcCCCcccccccCCCccceEEcCCCHHHHHHHHHhccCCCcccccCC
Q psy4316 240 KAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNAIYGSRNEEEAARDIRFFFKDIIIEPSNA 305 (377)
Q Consensus 240 NAV~~wReLiGPtdP~~Ar~~~P~SLRA~fG~d~~rNaVHgSDs~esA~rEi~fFFp~~~~epi~~ 305 (377)
|||..||++||||||.+| .|+|||++||.+.++|+||||||+++|.+||.||||+..+.++|-
T Consensus 80 ~av~~~R~l~Gptdp~~a---~p~tiR~~fg~~~~~N~vH~Sds~e~A~rEi~~fF~~~ei~~~~~ 142 (143)
T d1nhkl_ 80 NAVLANRDIMGATNPAQA---AEGTIRKDFATSIDKNTVHGSDSLENAKIEIAYFFRETEIHSYPY 142 (143)
T ss_dssp THHHHHHHHHCCSSGGGC---CTTSHHHHHCCSSSSCSEEECSSHHHHHHHHHHHCCGGGCCCCCC
T ss_pred chHHHHHHhhcCCChhhc---cccchHhhhccccCcCCeECCCCHHHHHHHHHHcCCHHHccccCC
Confidence 999999999999999988 699999999999999999999999999999999999998888773
|
| >d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} | Back information, alignment and structure |
|---|
| >d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} | Back information, alignment and structure |
|---|
| >d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} | Back information, alignment and structure |
|---|
| >d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} | Back information, alignment and structure |
|---|
| >d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} | Back information, alignment and structure |
|---|
| >d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} | Back information, alignment and structure |
|---|
| >d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ezwa1 a.31.1.1 (A:12-61) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|