Psyllid ID: psy4351

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--
MHKISDGEINNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWETDDELCLADEV
cccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccccc
ccEEEccccHHccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccc
mhkisdgeinnVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIhtdwetddelcladev
mhkisdgeinnVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWETDDELCLADEV
MHKISDGEINNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWETDDELCLADEV
*********NNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWETDDELCL****
************SVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWET***LC*****
MHKISDGEINNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWETDDELCLADEV
MHKISDGEINNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWETDDELCL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKISDGEINNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWETDDELCLADEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query62 2.2.26 [Sep-21-2011]
P35233 416 Tyrosine-protein phosphat no N/A 0.564 0.084 0.8 1e-09
Q06180 406 Tyrosine-protein phosphat yes N/A 0.564 0.086 0.771 2e-09
P17706 415 Tyrosine-protein phosphat no N/A 0.580 0.086 0.694 3e-09
O13016 434 Tyrosine-protein phosphat no N/A 0.580 0.082 0.722 1e-08
P35821 432 Tyrosine-protein phosphat no N/A 0.580 0.083 0.666 5e-08
P20417 432 Tyrosine-protein phosphat no N/A 0.580 0.083 0.666 5e-08
P18031 435 Tyrosine-protein phosphat no N/A 0.580 0.082 0.666 8e-08
Q9W0G1 548 Tyrosine-protein phosphat no N/A 0.596 0.067 0.7 1e-07
>sp|P35233|PTN2_RAT Tyrosine-protein phosphatase non-receptor type 2 OS=Rattus norvegicus GN=Ptpn2 PE=1 SV=2 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%)

Query: 11  NVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEG 45
           +V+V++ILL MR YRMGLIQTPDQLRFSY AIIEG
Sbjct: 241 DVNVKQILLSMRKYRMGLIQTPDQLRFSYMAIIEG 275
Binds single-stranded and double-stranded DNA with high nonspecific affinity through its C-terminal region.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q06180|PTN2_MOUSE Tyrosine-protein phosphatase non-receptor type 2 OS=Mus musculus GN=Ptpn2 PE=2 SV=2 Back     alignment and function description
>sp|P17706|PTN2_HUMAN Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens GN=PTPN2 PE=1 SV=2 Back     alignment and function description
>sp|O13016|PTN1_CHICK Tyrosine-protein phosphatase non-receptor type 1 OS=Gallus gallus GN=PTPN1 PE=2 SV=1 Back     alignment and function description
>sp|P35821|PTN1_MOUSE Tyrosine-protein phosphatase non-receptor type 1 OS=Mus musculus GN=Ptpn1 PE=1 SV=2 Back     alignment and function description
>sp|P20417|PTN1_RAT Tyrosine-protein phosphatase non-receptor type 1 OS=Rattus norvegicus GN=Ptpn1 PE=2 SV=1 Back     alignment and function description
>sp|P18031|PTN1_HUMAN Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens GN=PTPN1 PE=1 SV=1 Back     alignment and function description
>sp|Q9W0G1|PTP61_DROME Tyrosine-protein phosphatase non-receptor type 61F OS=Drosophila melanogaster GN=Ptp61F PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
427779579 508 hypothetical protein [Rhipicephalus pulc 0.629 0.076 0.769 4e-10
307205614 785 Tyrosine-protein phosphatase non-recepto 0.677 0.053 0.738 5e-10
427782149 464 hypothetical protein [Rhipicephalus pulc 0.629 0.084 0.769 6e-10
427779505 465 hypothetical protein [Rhipicephalus pulc 0.629 0.083 0.769 6e-10
340716019 787 PREDICTED: tyrosine-protein phosphatase 0.677 0.053 0.690 1e-09
380018280 793 PREDICTED: tyrosine-protein phosphatase 0.677 0.052 0.690 2e-09
91078502 450 PREDICTED: similar to tyrosine phosphata 0.596 0.082 0.810 3e-09
158294038 433 AGAP005352-PB [Anopheles gambiae str. PE 0.645 0.092 0.756 4e-09
118786311 515 AGAP005352-PA [Anopheles gambiae str. PE 0.645 0.077 0.756 4e-09
242023867 462 tyrosine-protein phosphatase non-recepto 0.693 0.093 0.651 6e-09
>gi|427779579|gb|JAA55241.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score = 68.6 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/39 (76%), Positives = 34/39 (87%)

Query: 7   GEINNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEG 45
           G ++ V VQE+LLEMR YRMGLIQTPDQLRFSY AI+EG
Sbjct: 284 GRLDRVDVQEVLLEMRKYRMGLIQTPDQLRFSYLAILEG 322

Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307205614|gb|EFN83906.1| Tyrosine-protein phosphatase non-receptor type 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|427782149|gb|JAA56526.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427779505|gb|JAA55204.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|340716019|ref|XP_003396502.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 61F-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380018280|ref|XP_003693060.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 61F-like [Apis florea] Back     alignment and taxonomy information
>gi|91078502|ref|XP_969316.1| PREDICTED: similar to tyrosine phosphatase, non-receptor type nt1 [Tribolium castaneum] gi|270004022|gb|EFA00470.1| hypothetical protein TcasGA2_TC003328 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158294038|ref|XP_001688644.1| AGAP005352-PB [Anopheles gambiae str. PEST] gi|157015379|gb|EDO63650.1| AGAP005352-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|118786311|ref|XP_315365.3| AGAP005352-PA [Anopheles gambiae str. PEST] gi|116126259|gb|EAA11394.4| AGAP005352-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|242023867|ref|XP_002432352.1| tyrosine-protein phosphatase non-receptor type, putative [Pediculus humanus corporis] gi|212517775|gb|EEB19614.1| tyrosine-protein phosphatase non-receptor type, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
UNIPROTKB|F1LSP6382 Ptpn2 "Tyrosine-protein phosph 0.564 0.091 0.8 3.7e-09
RGD|620710 416 Ptpn2 "protein tyrosine phosph 0.564 0.084 0.8 4.4e-09
UNIPROTKB|K7EQG9 386 PTPN2 "Tyrosine-protein phosph 0.580 0.093 0.694 6.3e-09
UNIPROTKB|A5D982388 PTPN2 "Tyrosine-protein phosph 0.580 0.092 0.694 6.4e-09
ZFIN|ZDB-GENE-040426-1196392 ptpn2a "protein tyrosine phosp 0.548 0.086 0.735 6.5e-09
MGI|MGI:97806 406 Ptpn2 "protein tyrosine phosph 0.564 0.086 0.771 7e-09
UNIPROTKB|K7ENG3410 PTPN2 "Tyrosine-protein phosph 0.580 0.087 0.694 7.1e-09
UNIPROTKB|P17706 415 PTPN2 "Tyrosine-protein phosph 0.580 0.086 0.694 7.3e-09
UNIPROTKB|F1NYW0393 PTPN2 "Tyrosine-protein phosph 0.564 0.089 0.714 8.4e-09
ZFIN|ZDB-GENE-030909-8 393 ptpn2b "protein tyrosine phosp 0.548 0.086 0.735 1.4e-08
UNIPROTKB|F1LSP6 Ptpn2 "Tyrosine-protein phosphatase non-receptor type" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 142 (55.0 bits), Expect = 3.7e-09, P = 3.7e-09
 Identities = 28/35 (80%), Positives = 32/35 (91%)

Query:    11 NVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEG 45
             +V+V++ILL MR YRMGLIQTPDQLRFSY AIIEG
Sbjct:   241 DVNVKQILLSMRKYRMGLIQTPDQLRFSYMAIIEG 275
GO:0004725 "protein tyrosine phosphatase activity" evidence=IEA
RGD|620710 Ptpn2 "protein tyrosine phosphatase, non-receptor type 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|K7EQG9 PTPN2 "Tyrosine-protein phosphatase non-receptor type" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5D982 PTPN2 "Tyrosine-protein phosphatase non-receptor type" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1196 ptpn2a "protein tyrosine phosphatase, non-receptor type 2, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:97806 Ptpn2 "protein tyrosine phosphatase, non-receptor type 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|K7ENG3 PTPN2 "Tyrosine-protein phosphatase non-receptor type" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P17706 PTPN2 "Tyrosine-protein phosphatase non-receptor type 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYW0 PTPN2 "Tyrosine-protein phosphatase non-receptor type" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030909-8 ptpn2b "protein tyrosine phosphatase, non-receptor type 2, b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q06180PTN2_MOUSE3, ., 1, ., 3, ., 4, 80.77140.56450.0862yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 1e-08
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 4e-08
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 2e-07
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 5e-07
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 5e-07
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information 
 Score = 48.0 bits (115), Expect = 1e-08
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 1   MHKISDGEINNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIE 44
           + ++  G+   V + EI+ E+R  R G++QT +Q  F Y+AI+E
Sbjct: 218 LQQLEAGK--EVDIFEIVKELRSQRPGMVQTEEQYIFLYRAILE 259

Length = 259
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 62
PHA02740298 protein tyrosine phosphatase; Provisional 99.36
PHA02742303 protein tyrosine phosphatase; Provisional 99.32
PHA02738320 hypothetical protein; Provisional 99.24
PHA02746323 protein tyrosine phosphatase; Provisional 99.22
PHA02747312 protein tyrosine phosphatase; Provisional 99.13
KOG0792|consensus1144 99.09
KOG4228|consensus1087 99.09
KOG4228|consensus 1087 98.97
KOG0790|consensus600 98.91
KOG0791|consensus374 98.86
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 98.75
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 98.73
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 98.66
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 98.61
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 98.54
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 98.54
KOG0789|consensus415 98.36
KOG0793|consensus1004 98.24
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 98.02
KOG1720|consensus225 94.86
PTZ00242166 protein tyrosine phosphatase; Provisional 94.66
PTZ00393241 protein tyrosine phosphatase; Provisional 90.11
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information 
Probab=99.36  E-value=4.3e-13  Score=91.42  Aligned_cols=43  Identities=19%  Similarity=0.380  Sum_probs=39.8

Q ss_pred             CCcCCHHHHHHHHHhcCccccCChHHHHHHHHHHHHHHHhccc
Q psy4351           9 INNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWE   51 (62)
Q Consensus         9 ~~~vdi~~~V~~lR~qR~~mVqt~~QY~Fiy~~i~~~~~~~~~   51 (62)
                      ++.+||+++|++||+||++||||.+||.|||.++++|+...+.
T Consensus       251 ~~~vdi~~~V~~lR~qR~~~Vqt~~QY~F~y~~l~~yl~~~~~  293 (298)
T PHA02740        251 TGMLSIANALKKVRQKKYGCMNCLDDYVFCYHLIAAYLKEKFD  293 (298)
T ss_pred             cCcccHHHHHHHHHhhCccccCCHHHHHHHHHHHHHHHHHhhc
Confidence            4789999999999999999999999999999999999887643

>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 3e-10
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 4e-09
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 4e-09
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 4e-09
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 4e-09
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 4e-09
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 4e-09
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 4e-09
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 4e-09
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 4e-09
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 4e-09
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 4e-09
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 4e-09
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 4e-09
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 4e-09
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 4e-09
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 4e-09
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 4e-09
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 4e-09
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 4e-09
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 4e-09
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 4e-09
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 5e-09
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 5e-09
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 5e-09
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 5e-09
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-08
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-08
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 1e-08
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 1e-08
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-08
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 1e-08
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 4e-08
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 4e-08
1a5y_A330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 2e-07
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 6e-07
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure 
Iteration: 1

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 33/36 (91%)
Query: 10  NNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEG 45
           ++++++++LL MR YRMGLIQTPDQLRFSY AIIEG
Sbjct: 240 DDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEG 275
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 2e-12
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 3e-12
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 4e-12
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 5e-12
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 9e-12
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 1e-11
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 1e-11
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 1e-11
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-11
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-11
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 2e-11
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 2e-11
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 2e-11
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 3e-11
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 4e-11
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 5e-11
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 7e-11
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 9e-11
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 9e-11
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-10
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 3e-09
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 1e-10
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 2e-10
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 2e-09
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 2e-10
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 2e-10
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 2e-10
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 3e-10
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 1e-09
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 2e-09
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 3e-09
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-08
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 5e-09
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 9e-09
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 2e-08
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 8e-08
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 2e-07
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
 Score = 58.5 bits (142), Expect = 2e-12
 Identities = 11/49 (22%), Positives = 23/49 (46%)

Query: 1   MHKISDGEINNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTD 49
           +  I  G + + +V  I+  M+  R G++Q  +Q    Y  ++  +  D
Sbjct: 246 LLHIERGILTDSTVYSIVAAMKQKRFGMVQRLEQYAVIYMTVLGRLGVD 294
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.38
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.29
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.29
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.28
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.26
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.26
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.25
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.23
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.23
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.22
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.18
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.18
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.17
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.17
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.17
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.16
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.15
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.14
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.14
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.13
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.13
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.13
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.13
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.12
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.11
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.11
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.1
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.1
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.09
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 99.09
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.09
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.07
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 99.02
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.02
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 98.93
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 98.93
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 98.93
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.91
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 98.9
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 98.77
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 97.43
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 97.42
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 96.99
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 96.96
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 96.67
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 96.53
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 95.5
2q05_A195 Late protein H1, dual specificity protein phosphat 94.0
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 93.65
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 93.52
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 93.4
1xri_A151 AT1G05000; structural genomics, protein structure 89.56
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 88.24
3cm3_A176 Late protein H1, dual specificity protein phosphat 85.01
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
Probab=99.38  E-value=1.2e-13  Score=93.13  Aligned_cols=42  Identities=33%  Similarity=0.437  Sum_probs=38.9

Q ss_pred             CCcCCHHHHHHHHHhcCccccCChHHHHHHHHHHHHHHHhcc
Q psy4351           9 INNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDW   50 (62)
Q Consensus         9 ~~~vdi~~~V~~lR~qR~~mVqt~~QY~Fiy~~i~~~~~~~~   50 (62)
                      ++.+||+++|+.||+||++||||.+||.|||+++++|+....
T Consensus       263 ~~~vdv~~~V~~lR~qR~~mVqt~~QY~Fiy~~ll~y~~~~g  304 (314)
T 4ge6_A          263 LGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEG  304 (314)
T ss_dssp             HSCBCHHHHHHHHTTTSTTCSCSHHHHHHHHHHHHHHHHHTT
T ss_pred             cCCCCHHHHHHHHHhhcccccCCHHHHHHHHHHHHHHHHHcC
Confidence            368999999999999999999999999999999999987544
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 62
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 6e-10
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 2e-09
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-09
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 4e-09
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 7e-09
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 8e-09
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 1e-08
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 1e-08
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-08
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 1e-08
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 3e-08
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 2e-07
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 8e-07
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 0.003
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Human (Homo sapiens), T-cell [TaxId: 9606]

 Score = 50.2 bits (119), Expect = 6e-10
 Identities = 25/37 (67%), Positives = 33/37 (89%)

Query: 10  NNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGI 46
           ++++++++LL MR YRMGLIQTPDQLRFSY AIIEG 
Sbjct: 236 DDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGA 272
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 99.39
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.36
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 99.34
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.34
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 99.32
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.3
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 99.27
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.27
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.23
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 99.23
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 99.17
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 96.81
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 96.44
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 95.56
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 93.74
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Human (Homo sapiens), 1B [TaxId: 9606]

Probab=99.39  E-value=5.7e-14  Score=91.73  Aligned_cols=49  Identities=49%  Similarity=0.763  Sum_probs=43.2

Q ss_pred             ccccCC-CCcCCHHHHHHHHHhcCccccCChHHHHHHHHHHHHHHHhccc
Q psy4351           3 KISDGE-INNVSVQEILLEMRHYRMGLIQTPDQLRFSYQAIIEGIHTDWE   51 (62)
Q Consensus         3 ~ie~~~-~~~vdi~~~V~~lR~qR~~mVqt~~QY~Fiy~~i~~~~~~~~~   51 (62)
                      +|++++ ++.+||+++|+.||+||++||||.+||.|||+++++++...+.
T Consensus       233 ~l~~~~~~~~vdV~~~v~~lR~qR~~~Vqt~~QY~f~y~~l~~~~~~~~~  282 (297)
T d2f71a1         233 LMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMG  282 (297)
T ss_dssp             HHHHHTCGGGCCHHHHHHHHTTTSTTCSCSHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHhhcCCCccCHHHHHHHHHhhcccccCCHHHHHHHHHHHHHHHHHhhC
Confidence            356666 5789999999999999999999999999999999999876554
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure