Psyllid ID: psy4377


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MCDKADCKKAKPAVQPPQPLSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV
ccccccccccccccccccccccccEEEEEEcccEEEEEEcccccccccccccccEEEEEcccEEEEEcccHHHHHHHHHHc
cccHHHHHHccccccccccccccEEEEEEEcccEEEEEcccccccccccccccHHEEEccccEEEEccccHHHHHHHHHcc
mcdkadckkakpavqppqplscasvfglqfdRGVLLAADSLVSFEGLALFCNAQRIVKVNESillgggnnfadLQYLQDSV
mcdkadckkakpavqppqplSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESillgggnnfadlqylqdsv
McdkadckkakpavqppqpLSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV
********************SCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYL****
*******************LSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV
*****************QPLSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV
*CD**DCKKAKPAVQPPQPLSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDKADCKKAKPAVQPPQPLSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query81 2.2.26 [Sep-21-2011]
Q9VNA5 268 Proteasome subunit beta t yes N/A 0.703 0.212 0.473 1e-10
P34067 263 Proteasome subunit beta t yes N/A 0.851 0.262 0.442 2e-10
P28024 242 Proteasome subunit beta t N/A N/A 0.888 0.297 0.438 2e-10
P99026 264 Proteasome subunit beta t yes N/A 0.962 0.295 0.405 5e-10
Q29384154 Proteasome subunit beta t yes N/A 0.962 0.506 0.379 1e-09
Q3T108 264 Proteasome subunit beta t yes N/A 0.827 0.253 0.441 2e-09
P28070 264 Proteasome subunit beta t yes N/A 0.938 0.287 0.402 4e-09
Q9USQ9 262 Probable proteasome subun yes N/A 0.827 0.255 0.367 6e-07
P30657 266 Proteasome subunit beta t yes N/A 0.851 0.259 0.314 9e-06
>sp|Q9VNA5|PSB4_DROME Proteasome subunit beta type-4 OS=Drosophila melanogaster GN=Prosbeta7 PE=2 SV=1 Back     alignment and function desciption
 Score = 65.1 bits (157), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 45/57 (78%)

Query: 25  VFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
           V G+++D GV+LAAD+LVS+  +A + N +R+ KVN++ILLGG  +FAD+Q ++ ++
Sbjct: 60  VLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSIKRNI 116




The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|P34067|PSB4_RAT Proteasome subunit beta type-4 OS=Rattus norvegicus GN=Psmb4 PE=1 SV=2 Back     alignment and function description
>sp|P28024|PSB4_XENLA Proteasome subunit beta type-4 (Fragment) OS=Xenopus laevis GN=psmb4 PE=2 SV=2 Back     alignment and function description
>sp|P99026|PSB4_MOUSE Proteasome subunit beta type-4 OS=Mus musculus GN=Psmb4 PE=1 SV=1 Back     alignment and function description
>sp|Q29384|PSB4_PIG Proteasome subunit beta type-4 (Fragment) OS=Sus scrofa GN=PSMB4 PE=2 SV=1 Back     alignment and function description
>sp|Q3T108|PSB4_BOVIN Proteasome subunit beta type-4 OS=Bos taurus GN=PSMB4 PE=1 SV=1 Back     alignment and function description
>sp|P28070|PSB4_HUMAN Proteasome subunit beta type-4 OS=Homo sapiens GN=PSMB4 PE=1 SV=4 Back     alignment and function description
>sp|Q9USQ9|PSB7_SCHPO Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC577.10 PE=3 SV=1 Back     alignment and function description
>sp|P30657|PSB7_YEAST Proteasome subunit beta type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
195111662 266 GI10207 [Drosophila mojavensis] gi|19391 0.728 0.221 0.508 4e-10
195497298 268 GE25292 [Drosophila yakuba] gi|194182141 0.728 0.220 0.474 9e-10
194898711 268 GG11060 [Drosophila erecta] gi|190650614 0.728 0.220 0.474 1e-09
156542911 262 PREDICTED: proteasome subunit beta type- 0.679 0.209 0.527 1e-09
194770872 268 GF20703 [Drosophila ananassae] gi|190618 0.728 0.220 0.457 1e-09
383854593 256 PREDICTED: proteasome subunit beta type- 0.716 0.226 0.517 2e-09
195396252 265 GJ10047 [Drosophila virilis] gi|19414345 0.728 0.222 0.491 2e-09
195568398 268 GD19625 [Drosophila simulans] gi|1941981 0.716 0.216 0.465 3e-09
89272522 243 proteasome (prosome macropain) subunit b 0.888 0.296 0.452 4e-09
24644201 268 proteasome beta7 subunit, isoform A [Dro 0.703 0.212 0.473 6e-09
>gi|195111662|ref|XP_002000397.1| GI10207 [Drosophila mojavensis] gi|193916991|gb|EDW15858.1| GI10207 [Drosophila mojavensis] Back     alignment and taxonomy information
 Score = 68.6 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 46/59 (77%)

Query: 23  ASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
           +SV G++FD GVL+AAD+LVS+  LA + N +R+ ++N  ILLGGG +FAD+Q ++ S+
Sbjct: 56  SSVLGIRFDGGVLVAADTLVSYGSLARYQNIERVFQINNKILLGGGGDFADIQSIKRSI 114




Source: Drosophila mojavensis

Species: Drosophila mojavensis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195497298|ref|XP_002096040.1| GE25292 [Drosophila yakuba] gi|194182141|gb|EDW95752.1| GE25292 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194898711|ref|XP_001978911.1| GG11060 [Drosophila erecta] gi|190650614|gb|EDV47869.1| GG11060 [Drosophila erecta] Back     alignment and taxonomy information
>gi|156542911|ref|XP_001601321.1| PREDICTED: proteasome subunit beta type-4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|194770872|ref|XP_001967511.1| GF20703 [Drosophila ananassae] gi|190618521|gb|EDV34045.1| GF20703 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|383854593|ref|XP_003702805.1| PREDICTED: proteasome subunit beta type-4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195396252|ref|XP_002056746.1| GJ10047 [Drosophila virilis] gi|194143455|gb|EDW59858.1| GJ10047 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195568398|ref|XP_002102203.1| GD19625 [Drosophila simulans] gi|194198130|gb|EDX11706.1| GD19625 [Drosophila simulans] Back     alignment and taxonomy information
>gi|89272522|emb|CAJ83434.1| proteasome (prosome macropain) subunit beta type 4 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|24644201|ref|NP_649529.1| proteasome beta7 subunit, isoform A [Drosophila melanogaster] gi|24644203|ref|NP_730922.1| proteasome beta7 subunit, isoform B [Drosophila melanogaster] gi|17380269|sp|Q9VNA5.1|PSB4_DROME RecName: Full=Proteasome subunit beta type-4; AltName: Full=Proteasome subunit beta type-7 gi|7296763|gb|AAF52041.1| proteasome beta7 subunit, isoform A [Drosophila melanogaster] gi|21430236|gb|AAM50796.1| LD24633p [Drosophila melanogaster] gi|23170445|gb|AAN13277.1| proteasome beta7 subunit, isoform B [Drosophila melanogaster] gi|220943926|gb|ACL84506.1| Prosbeta4-PA [synthetic construct] gi|220953802|gb|ACL89444.1| Prosbeta4-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
FB|FBgn0250746 268 Prosbeta7 "Proteasome beta7 su 0.716 0.216 0.482 4.7e-11
UNIPROTKB|P28024 242 psmb4 "Proteasome subunit beta 0.716 0.239 0.5 3.3e-10
UNIPROTKB|D4A640 232 Psmb4 "Proteasome subunit beta 0.679 0.237 0.509 1e-09
MGI|MGI:1098257 264 Psmb4 "proteasome (prosome, ma 0.679 0.208 0.509 1.4e-09
RGD|61877 263 Psmb4 "proteasome (prosome, ma 0.679 0.209 0.509 1.8e-09
UNIPROTKB|P34067 263 Psmb4 "Proteasome subunit beta 0.679 0.209 0.509 1.8e-09
UNIPROTKB|Q29384154 PSMB4 "Proteasome subunit beta 0.679 0.357 0.490 2.9e-09
UNIPROTKB|Q3T108 264 PSMB4 "Proteasome subunit beta 0.679 0.208 0.509 3.1e-09
UNIPROTKB|E2RBR6 264 PSMB4 "Proteasome subunit beta 0.679 0.208 0.490 4e-09
UNIPROTKB|P28070 264 PSMB4 "Proteasome subunit beta 0.679 0.208 0.490 6.8e-09
FB|FBgn0250746 Prosbeta7 "Proteasome beta7 subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 155 (59.6 bits), Expect = 4.7e-11, P = 4.7e-11
 Identities = 28/58 (48%), Positives = 46/58 (79%)

Query:    24 SVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
             SV G+++D GV+LAAD+LVS+  +A + N +R+ KVN++ILLGG  +FAD+Q ++ ++
Sbjct:    59 SVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSIKRNI 116




GO:0005839 "proteasome core complex" evidence=ISS;NAS
GO:0004175 "endopeptidase activity" evidence=ISS;NAS
GO:0006508 "proteolysis" evidence=NAS
GO:0005634 "nucleus" evidence=NAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=NAS
GO:0005737 "cytoplasm" evidence=NAS
GO:0051603 "proteolysis involved in cellular protein catabolic process" evidence=IEA
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0009987 "cellular process" evidence=IMP
GO:0000022 "mitotic spindle elongation" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0051297 "centrosome organization" evidence=IMP
GO:0006974 "response to DNA damage stimulus" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|P28024 psmb4 "Proteasome subunit beta type-4" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|D4A640 Psmb4 "Proteasome subunit beta type" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1098257 Psmb4 "proteasome (prosome, macropain) subunit, beta type 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61877 Psmb4 "proteasome (prosome, macropain) subunit, beta type 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P34067 Psmb4 "Proteasome subunit beta type-4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q29384 PSMB4 "Proteasome subunit beta type-4" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T108 PSMB4 "Proteasome subunit beta type-4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBR6 PSMB4 "Proteasome subunit beta type" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P28070 PSMB4 "Proteasome subunit beta type-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
cd03760 197 cd03760, proteasome_beta_type_4, proteasome beta t 2e-17
cd01912 189 cd01912, proteasome_beta, proteasome beta subunit 2e-10
cd01906 182 cd01906, proteasome_protease_HslV, proteasome_prot 6e-08
cd01901 164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 1e-05
COG0638 236 COG0638, PRE1, 20S proteasome, alpha and beta subu 2e-04
cd03764 188 cd03764, proteasome_beta_archeal, Archeal proteaso 2e-04
TIGR03634 185 TIGR03634, arc_protsome_B, proteasome endopeptidas 5e-04
pfam00227 188 pfam00227, Proteasome, Proteasome subunit 7e-04
>gnl|CDD|239729 cd03760, proteasome_beta_type_4, proteasome beta type-4 subunit Back     alignment and domain information
 Score = 72.2 bits (178), Expect = 2e-17
 Identities = 25/56 (44%), Positives = 38/56 (67%)

Query: 23 ASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQ 78
           SV  +++  GV++AAD+L S+  LA F N +RI KV ++ LLG   ++AD QYL+
Sbjct: 3  TSVIAIKYKDGVIIAADTLGSYGSLARFKNVERIFKVGDNTLLGASGDYADFQYLK 58


The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis.Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 197

>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit Back     alignment and domain information
>gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 81
KOG0185|consensus 256 99.86
PRK05456 172 ATP-dependent protease subunit HslV; Provisional 99.8
cd03757 212 proteasome_beta_type_1 proteasome beta type-1 subu 99.8
KOG0174|consensus 224 99.78
TIGR03692 171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 99.77
cd01913 171 protease_HslV Protease HslV and the ATPase/chapero 99.77
PTZ00488 247 Proteasome subunit beta type-5; Provisional 99.76
cd03760 197 proteasome_beta_type_4 proteasome beta type-4 subu 99.75
cd03759 195 proteasome_beta_type_3 proteasome beta type-3 subu 99.74
COG0638 236 PRE1 20S proteasome, alpha and beta subunits [Post 99.72
TIGR03690 219 20S_bact_beta proteasome, beta subunit, bacterial 99.72
cd03762 188 proteasome_beta_type_6 proteasome beta type-6 subu 99.71
TIGR03634 185 arc_protsome_B proteasome endopeptidase complex, a 99.71
cd03761 188 proteasome_beta_type_5 proteasome beta type-5 subu 99.7
KOG0173|consensus 271 99.7
cd03758 193 proteasome_beta_type_2 proteasome beta type-2 subu 99.7
cd03763 189 proteasome_beta_type_7 proteasome beta type-7 subu 99.69
PF00227 190 Proteasome: Proteasome subunit; InterPro: IPR00135 99.68
cd03750 227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 99.67
KOG0179|consensus 235 99.67
PTZ00246 253 proteasome subunit alpha; Provisional 99.67
cd03764 188 proteasome_beta_archeal Archeal proteasome, beta s 99.67
TIGR03633 224 arc_protsome_A proteasome endopeptidase complex, a 99.66
cd03752 213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 99.65
cd03756 211 proteasome_alpha_archeal proteasome_alpha_archeal. 99.65
cd01911 209 proteasome_alpha proteasome alpha subunit. The 20S 99.65
cd01912 189 proteasome_beta proteasome beta subunit. The 20S p 99.64
cd03753 213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 99.63
cd03751 212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 99.63
cd01906 182 proteasome_protease_HslV proteasome_protease_HslV. 99.63
PRK03996 241 proteasome subunit alpha; Provisional 99.62
cd03755 207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 99.61
cd03754 215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 99.58
cd03749 211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 99.58
KOG0175|consensus 285 99.56
cd03765 236 proteasome_beta_bacterial Bacterial proteasome, be 99.46
TIGR03691 228 20S_bact_alpha proteasome, alpha subunit, bacteria 99.43
KOG0177|consensus 200 99.37
cd01901 164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 99.29
KOG0176|consensus 241 99.26
KOG0180|consensus 204 99.02
KOG0184|consensus 254 99.0
KOG0178|consensus 249 98.71
COG5405 178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 98.62
KOG0183|consensus 249 98.38
KOG0181|consensus 233 98.29
KOG0863|consensus 264 98.25
KOG0182|consensus 246 97.11
COG3484 255 Predicted proteasome-type protease [Posttranslatio 86.94
>KOG0185|consensus Back     alignment and domain information
Probab=99.86  E-value=6.3e-22  Score=143.26  Aligned_cols=69  Identities=35%  Similarity=0.581  Sum_probs=66.0

Q ss_pred             cCCCCCCCCCceEEEEEcCCeEEEEEeCccccCccceeCCccceEEecCeEEEEecccHHHHHHHHHhC
Q psy4377          13 AVQPPQPLSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV   81 (81)
Q Consensus        13 ~~~~~~~~~GtTvigi~~~~GVvlaaDtr~s~g~~v~~~~~~Ki~~i~~~i~~~~sG~~aD~q~l~~~l   81 (81)
                      +...+|++|||||||++|+||||||||++.|||++.++++++|++++++|+++|+||+.||+|+|.+.|
T Consensus        32 qrt~~p~vTGTSVla~ky~~GVviaaD~lgSYGslaR~~nVeRi~kVgdntllG~sGdisD~Q~i~r~L  100 (256)
T KOG0185|consen   32 QRTLNPIVTGTSVLALKYKDGVVIAADTLGSYGSLARYKNVERIFKVGDNTLLGASGDISDFQYIQRVL  100 (256)
T ss_pred             ccccCceeccceEEEEEecCceEEEecccccchhhhhhcCceeeEEecCceEEecCccHHHHHHHHHHH
Confidence            446789999999999999999999999999999999999999999999999999999999999999875



>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>KOG0174|consensus Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>KOG0173|consensus Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
>KOG0179|consensus Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>KOG0175|consensus Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>KOG0177|consensus Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>KOG0176|consensus Back     alignment and domain information
>KOG0180|consensus Back     alignment and domain information
>KOG0184|consensus Back     alignment and domain information
>KOG0178|consensus Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0183|consensus Back     alignment and domain information
>KOG0181|consensus Back     alignment and domain information
>KOG0863|consensus Back     alignment and domain information
>KOG0182|consensus Back     alignment and domain information
>COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
3unb_M 219 Mouse Constitutive 20s Proteasome In Complex With P 2e-10
1iru_N 219 Crystal Structure Of The Mammalian 20s Proteasome A 1e-09
1ryp_N 233 Crystal Structure Of The 20s Proteasome From Yeast 4e-05
1g0u_M 266 A Gated Channel Into The Proteasome Core Particle L 4e-05
>pdb|3UNB|M Chain M, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 219 Back     alignment and structure

Iteration: 1

Score = 60.8 bits (146), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 28/59 (47%), Positives = 42/59 (71%) Query: 20 LSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQ 78 ++ SV G++FD GV++AAD L S+ LA F N RI++VN+S +LG ++AD QYL+ Sbjct: 6 VTGTSVLGVKFDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLK 64
>pdb|1IRU|N Chain N, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 219 Back     alignment and structure
>pdb|1RYP|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 Back     alignment and structure
>pdb|1G0U|M Chain M, A Gated Channel Into The Proteasome Core Particle Length = 266 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
1ryp_N 233 20S proteasome; multicatalytic proteinase, protein 3e-13
1iru_N 219 20S proteasome; cell cycle, immune response, prote 7e-13
1g0u_M 266 Proteasome component PRE4; ubiquitin, degradation, 1e-12
1iru_K 201 20S proteasome; cell cycle, immune response, prote 2e-10
1ryp_K 198 20S proteasome; multicatalytic proteinase, protein 3e-10
1iru_M 213 20S proteasome; cell cycle, immune response, prote 2e-07
1iru_I 234 20S proteasome; cell cycle, immune response, prote 4e-06
1ryp_M 222 20S proteasome; multicatalytic proteinase, protein 1e-05
3nzj_H 261 Proteasome component PUP1; ubiquitin, protein degr 4e-05
3unf_N 199 Proteasome subunit beta type-9; antigen presentati 8e-05
1iru_J 205 20S proteasome; cell cycle, immune response, prote 9e-05
2jay_A 291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 1e-04
1j2q_H 202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 2e-04
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 2e-04
1ryp_H 205 20S proteasome; multicatalytic proteinase, protein 3e-04
1ryp_L 212 20S proteasome; multicatalytic proteinase, protein 3e-04
3unf_H 234 Proteasome subunit beta type-10; antigen presentat 3e-04
1ryp_I 222 20S proteasome; multicatalytic proteinase, protein 4e-04
1q5q_H 235 Proteasome beta-type subunit 1; proteasome assembl 4e-04
3nzj_K 287 Proteasome component PRE2; ubiquitin, protein degr 5e-04
1iru_H 205 20S proteasome; cell cycle, immune response, prote 5e-04
1q5r_H 294 Proteasome beta-type subunit 1; proteasome assembl 5e-04
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
 Score = 61.2 bits (149), Expect = 3e-13
 Identities = 17/58 (29%), Positives = 38/58 (65%)

Query: 24 SVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
          SV  +++D GV++AAD+L S+  L  F   +R++ V ++ ++G   + +D+Q+++  +
Sbjct: 10 SVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLL 67


>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
3nzj_H 261 Proteasome component PUP1; ubiquitin, protein degr 99.82
1iru_M 213 20S proteasome; cell cycle, immune response, prote 99.8
1ryp_M 222 20S proteasome; multicatalytic proteinase, protein 99.79
1iru_J 205 20S proteasome; cell cycle, immune response, prote 99.78
1ryp_H 205 20S proteasome; multicatalytic proteinase, protein 99.77
2z3b_A 180 ATP-dependent protease HSLV; N-terminal nucleophIl 99.77
1yar_H 217 Proteasome beta subunit; proteasome 20S, PA26 prot 99.77
1iru_N 219 20S proteasome; cell cycle, immune response, prote 99.76
1ryp_N 233 20S proteasome; multicatalytic proteinase, protein 99.76
1g0u_M 266 Proteasome component PRE4; ubiquitin, degradation, 99.76
1ryp_J 204 20S proteasome; multicatalytic proteinase, protein 99.75
1m4y_A 171 ATP-dependent protease HSLV; N-terminal catalytic 99.73
3nzj_K 287 Proteasome component PRE2; ubiquitin, protein degr 99.72
1g3k_A 174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 99.72
1q5r_H 294 Proteasome beta-type subunit 1; proteasome assembl 99.72
1ryp_D 241 20S proteasome; multicatalytic proteinase, protein 99.72
1ryp_C 244 20S proteasome; multicatalytic proteinase, protein 99.72
3unf_N 199 Proteasome subunit beta type-9; antigen presentati 99.71
3h4p_a 219 Proteasome subunit beta; core particle, cytoplasm, 99.71
1iru_K 201 20S proteasome; cell cycle, immune response, prote 99.71
2jay_A 291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 99.71
1ryp_K 198 20S proteasome; multicatalytic proteinase, protein 99.71
1iru_E 241 20S proteasome; cell cycle, immune response, prote 99.7
1ryp_A 243 20S proteasome; multicatalytic proteinase, protein 99.7
1iru_C 261 20S proteasome; cell cycle, immune response, prote 99.7
1yar_A 233 Proteasome alpha subunit; proteasome 20S, PA26 pro 99.7
1iru_L 204 20S proteasome; cell cycle, immune response, prote 99.7
1j2q_H 202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 99.69
1ryp_E 242 20S proteasome; multicatalytic proteinase, protein 99.69
1iru_H 205 20S proteasome; cell cycle, immune response, prote 99.69
1ryp_L 212 20S proteasome; multicatalytic proteinase, protein 99.69
1iru_A 246 20S proteasome; cell cycle, immune response, prote 99.68
1iru_B 233 20S proteasome; cell cycle, immune response, prote 99.68
1ryp_B 250 20S proteasome; multicatalytic proteinase, protein 99.68
3unf_H 234 Proteasome subunit beta type-10; antigen presentat 99.68
1ryp_I 222 20S proteasome; multicatalytic proteinase, protein 99.67
1q5q_H 235 Proteasome beta-type subunit 1; proteasome assembl 99.67
1iru_I 234 20S proteasome; cell cycle, immune response, prote 99.67
1iru_G 254 20S proteasome; cell cycle, immune response, prote 99.66
1ryp_G 244 20S proteasome; multicatalytic proteinase, protein 99.66
1iru_D 248 20S proteasome; cell cycle, immune response, prote 99.66
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 99.66
1j2p_A 246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 99.66
1ryp_F 233 20S proteasome; multicatalytic proteinase, protein 99.63
3nzj_F 288 Proteasome component C1; ubiquitin, protein degrad 99.62
1iru_F 263 20S proteasome; cell cycle, immune response, prote 99.61
3mi0_A 248 Proteasome subunit alpha; enzyme inhibitors, lacto 99.57
1q5q_A 259 Proteasome alpha-type subunit 1; proteasome assemb 99.56
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
Probab=99.82  E-value=1e-20  Score=136.19  Aligned_cols=80  Identities=18%  Similarity=0.304  Sum_probs=56.7

Q ss_pred             CCChhhhhhhCCcCCCCCCCCCceEEEEEcCCeEEEEEeCccccCccceeCCccceEEecCeEEEEecccHHHHHHHHHh
Q psy4377           1 MCDKADCKKAKPAVQPPQPLSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDS   80 (81)
Q Consensus         1 ~~~~~~~~~a~~~~~~~~~~~GtTvigi~~~~GVvlaaDtr~s~g~~v~~~~~~Ki~~i~~~i~~~~sG~~aD~q~l~~~   80 (81)
                      .|.||...+++....+..+.+|+|+|||+++||||||+|+|.++|.++.+++.+||++|++|+++++||..+|+|.|.+.
T Consensus         8 ~~~rn~~~~~~~~~~~kav~~GtTivgi~~kdGVVlAaD~r~t~g~li~~~~~~KI~~I~d~i~~~~aG~~aD~~~l~~~   87 (261)
T 3nzj_H            8 NYQRNNFLAENSHTQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQL   87 (261)
T ss_dssp             ----------------------CCEEEEEETTEEEEEEECCEEETTEEEETTCCCEEEEETTEEEEEEESHHHHHHHHHH
T ss_pred             hhhhHHHHHhcCCCCCcccccCceEEEEEECCEEEEEEcCCcccCCeeccCCcceEEEEcCCEEEEeccCHHHHHHHHHH
Confidence            38999999888777777778999999999999999999999999999999999999999999999999999999999875



>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 81
d1rypk_ 198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 4e-09
d1q5qh_ 224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-08
d1ryp2_ 233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 2e-08
d1irul_ 201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 4e-08
d1iru2_ 217 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 4e-08
d1iruk_ 199 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 4e-08
d1m4ya_ 171 d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga ma 7e-08
d1irui_ 220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 1e-07
d1rypl_ 212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 2e-07
d1rypi_ 222 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 3e-07
d1g3ka_ 173 d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus i 5e-07
d1ryp1_ 222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 6e-07
d1iruj_ 204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 9e-07
d1iru1_ 213 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 2e-06
d1yarh1 203 d.153.1.4 (H:1-203) Proteasome beta subunit (catal 3e-06
d1j2qh_ 202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 5e-06
d1ryph_ 205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 7e-06
d1iruh_ 202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 8e-06
d1rypj_ 204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 1e-04
d1rype_ 242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 1e-04
d1rypc_ 244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 2e-04
d1iruc_ 250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 2e-04
d2z3ba1 180 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus 5e-04
d1rypd_ 241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 5e-04
d1q5qa_ 227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 7e-04
d1j2pa_ 243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 0.002
d1irug_ 245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 0.002
d1irue_ 234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 0.002
d1irub_ 233 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 0.002
d1rypg_ 244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 0.002
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 48.2 bits (114), Expect = 4e-09
 Identities = 8/58 (13%), Positives = 22/58 (37%)

Query: 24 SVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
           + G++    V+LA+   V+     L  +  +  +++   L+       D     + +
Sbjct: 3  IILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYI 60


>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Length = 173 Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Length = 180 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
d1iru1_ 213 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.84
d1ryp1_ 222 Proteasome beta subunit (catalytic) {Baker's yeast 99.84
d1iru2_ 217 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.81
d1ryp2_ 233 Proteasome beta subunit (catalytic) {Baker's yeast 99.81
d1iruj_ 204 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.8
d1ryph_ 205 Proteasome beta subunit (catalytic) {Baker's yeast 99.8
d1rypl_ 212 Proteasome beta subunit (catalytic) {Baker's yeast 99.77
d1irul_ 201 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.76
d1rypj_ 204 Proteasome beta subunit (catalytic) {Baker's yeast 99.76
d1iruh_ 202 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.75
d1yarh1 203 Proteasome beta subunit (catalytic) {Archaeon Ther 99.75
d1irui_ 220 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.74
d1rypk_ 198 Proteasome beta subunit (catalytic) {Baker's yeast 99.74
d1q5qh_ 224 Proteasome beta subunit (catalytic) {Rhodococcus e 99.74
d1rypi_ 222 Proteasome beta subunit (catalytic) {Baker's yeast 99.73
d1j2qh_ 202 Proteasome beta subunit (catalytic) {Archaeon Arch 99.73
d1iruk_ 199 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.72
d1m4ya_ 171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 99.71
d1rypc_ 244 Proteasome alpha subunit (non-catalytic) {Baker's 99.7
d1iruc_ 250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.69
d1rypd_ 241 Proteasome alpha subunit (non-catalytic) {Baker's 99.68
d1g3ka_ 173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 99.67
d1irub_ 233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.67
d1yara1 221 Proteasome alpha subunit (non-catalytic) {Archaeon 99.67
d2z3ba1 180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 99.67
d1rype_ 242 Proteasome alpha subunit (non-catalytic) {Baker's 99.65
d1j2pa_ 243 Proteasome alpha subunit (non-catalytic) {Archaeon 99.65
d1rypb_ 250 Proteasome alpha subunit (non-catalytic) {Baker's 99.64
d1irue_ 234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.64
d1rypg_ 244 Proteasome alpha subunit (non-catalytic) {Baker's 99.63
d1irud_ 243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.62
d1rypa_ 243 Proteasome alpha subunit (non-catalytic) {Baker's 99.62
d1irug_ 245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.61
d1irua_ 244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.58
d1q5qa_ 227 Proteasome alpha subunit (non-catalytic) {Rhodococ 99.57
d1iruf_ 238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.55
d1rypf_ 233 Proteasome alpha subunit (non-catalytic) {Baker's 99.49
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.84  E-value=3.1e-21  Score=129.33  Aligned_cols=66  Identities=11%  Similarity=0.082  Sum_probs=63.3

Q ss_pred             CCCCCC-CCceEEEEEcCCeEEEEEeCccccCccceeCCccceEEecCeEEEEecccHHHHHHHHHh
Q psy4377          15 QPPQPL-SCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDS   80 (81)
Q Consensus        15 ~~~~~~-~GtTvigi~~~~GVvlaaDtr~s~g~~v~~~~~~Ki~~i~~~i~~~~sG~~aD~q~l~~~   80 (81)
                      +|+||. ||||+|||+++|||+||||+|.++|.++.+++.+||++|++|++++++|..+|.|.+.+.
T Consensus         1 ~f~p~~~nG~Tivai~~~dgVviaaD~r~t~g~~~~~~~~~KI~~i~~~i~~~~aG~~~D~~~l~~~   67 (213)
T d1iru1_           1 RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKI   67 (213)
T ss_dssp             CCCSCCCCCCEEEEEEETTEEEEEEECCEEETTEEEESCCCCEEEEETTEEEEEEECHHHHHHHHHH
T ss_pred             CCCCccCCCcEEEEEEECCEEEEEECCccccCceeeccccCEEEEcCCCEEEEecCccchHHHHHHH
Confidence            578998 999999999999999999999999999999999999999999999999999999999875



>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure