Psyllid ID: psy4377
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 81 | ||||||
| 195111662 | 266 | GI10207 [Drosophila mojavensis] gi|19391 | 0.728 | 0.221 | 0.508 | 4e-10 | |
| 195497298 | 268 | GE25292 [Drosophila yakuba] gi|194182141 | 0.728 | 0.220 | 0.474 | 9e-10 | |
| 194898711 | 268 | GG11060 [Drosophila erecta] gi|190650614 | 0.728 | 0.220 | 0.474 | 1e-09 | |
| 156542911 | 262 | PREDICTED: proteasome subunit beta type- | 0.679 | 0.209 | 0.527 | 1e-09 | |
| 194770872 | 268 | GF20703 [Drosophila ananassae] gi|190618 | 0.728 | 0.220 | 0.457 | 1e-09 | |
| 383854593 | 256 | PREDICTED: proteasome subunit beta type- | 0.716 | 0.226 | 0.517 | 2e-09 | |
| 195396252 | 265 | GJ10047 [Drosophila virilis] gi|19414345 | 0.728 | 0.222 | 0.491 | 2e-09 | |
| 195568398 | 268 | GD19625 [Drosophila simulans] gi|1941981 | 0.716 | 0.216 | 0.465 | 3e-09 | |
| 89272522 | 243 | proteasome (prosome macropain) subunit b | 0.888 | 0.296 | 0.452 | 4e-09 | |
| 24644201 | 268 | proteasome beta7 subunit, isoform A [Dro | 0.703 | 0.212 | 0.473 | 6e-09 |
| >gi|195111662|ref|XP_002000397.1| GI10207 [Drosophila mojavensis] gi|193916991|gb|EDW15858.1| GI10207 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Score = 68.6 bits (166), Expect = 4e-10, Method: Composition-based stats.
Identities = 30/59 (50%), Positives = 46/59 (77%)
Query: 23 ASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
+SV G++FD GVL+AAD+LVS+ LA + N +R+ ++N ILLGGG +FAD+Q ++ S+
Sbjct: 56 SSVLGIRFDGGVLVAADTLVSYGSLARYQNIERVFQINNKILLGGGGDFADIQSIKRSI 114
|
Source: Drosophila mojavensis Species: Drosophila mojavensis Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195497298|ref|XP_002096040.1| GE25292 [Drosophila yakuba] gi|194182141|gb|EDW95752.1| GE25292 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194898711|ref|XP_001978911.1| GG11060 [Drosophila erecta] gi|190650614|gb|EDV47869.1| GG11060 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|156542911|ref|XP_001601321.1| PREDICTED: proteasome subunit beta type-4-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|194770872|ref|XP_001967511.1| GF20703 [Drosophila ananassae] gi|190618521|gb|EDV34045.1| GF20703 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|383854593|ref|XP_003702805.1| PREDICTED: proteasome subunit beta type-4-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|195396252|ref|XP_002056746.1| GJ10047 [Drosophila virilis] gi|194143455|gb|EDW59858.1| GJ10047 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195568398|ref|XP_002102203.1| GD19625 [Drosophila simulans] gi|194198130|gb|EDX11706.1| GD19625 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|89272522|emb|CAJ83434.1| proteasome (prosome macropain) subunit beta type 4 [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|24644201|ref|NP_649529.1| proteasome beta7 subunit, isoform A [Drosophila melanogaster] gi|24644203|ref|NP_730922.1| proteasome beta7 subunit, isoform B [Drosophila melanogaster] gi|17380269|sp|Q9VNA5.1|PSB4_DROME RecName: Full=Proteasome subunit beta type-4; AltName: Full=Proteasome subunit beta type-7 gi|7296763|gb|AAF52041.1| proteasome beta7 subunit, isoform A [Drosophila melanogaster] gi|21430236|gb|AAM50796.1| LD24633p [Drosophila melanogaster] gi|23170445|gb|AAN13277.1| proteasome beta7 subunit, isoform B [Drosophila melanogaster] gi|220943926|gb|ACL84506.1| Prosbeta4-PA [synthetic construct] gi|220953802|gb|ACL89444.1| Prosbeta4-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 81 | ||||||
| FB|FBgn0250746 | 268 | Prosbeta7 "Proteasome beta7 su | 0.716 | 0.216 | 0.482 | 4.7e-11 | |
| UNIPROTKB|P28024 | 242 | psmb4 "Proteasome subunit beta | 0.716 | 0.239 | 0.5 | 3.3e-10 | |
| UNIPROTKB|D4A640 | 232 | Psmb4 "Proteasome subunit beta | 0.679 | 0.237 | 0.509 | 1e-09 | |
| MGI|MGI:1098257 | 264 | Psmb4 "proteasome (prosome, ma | 0.679 | 0.208 | 0.509 | 1.4e-09 | |
| RGD|61877 | 263 | Psmb4 "proteasome (prosome, ma | 0.679 | 0.209 | 0.509 | 1.8e-09 | |
| UNIPROTKB|P34067 | 263 | Psmb4 "Proteasome subunit beta | 0.679 | 0.209 | 0.509 | 1.8e-09 | |
| UNIPROTKB|Q29384 | 154 | PSMB4 "Proteasome subunit beta | 0.679 | 0.357 | 0.490 | 2.9e-09 | |
| UNIPROTKB|Q3T108 | 264 | PSMB4 "Proteasome subunit beta | 0.679 | 0.208 | 0.509 | 3.1e-09 | |
| UNIPROTKB|E2RBR6 | 264 | PSMB4 "Proteasome subunit beta | 0.679 | 0.208 | 0.490 | 4e-09 | |
| UNIPROTKB|P28070 | 264 | PSMB4 "Proteasome subunit beta | 0.679 | 0.208 | 0.490 | 6.8e-09 |
| FB|FBgn0250746 Prosbeta7 "Proteasome beta7 subunit" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 155 (59.6 bits), Expect = 4.7e-11, P = 4.7e-11
Identities = 28/58 (48%), Positives = 46/58 (79%)
Query: 24 SVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
SV G+++D GV+LAAD+LVS+ +A + N +R+ KVN++ILLGG +FAD+Q ++ ++
Sbjct: 59 SVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSIKRNI 116
|
|
| UNIPROTKB|P28024 psmb4 "Proteasome subunit beta type-4" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A640 Psmb4 "Proteasome subunit beta type" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098257 Psmb4 "proteasome (prosome, macropain) subunit, beta type 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|61877 Psmb4 "proteasome (prosome, macropain) subunit, beta type 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P34067 Psmb4 "Proteasome subunit beta type-4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29384 PSMB4 "Proteasome subunit beta type-4" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T108 PSMB4 "Proteasome subunit beta type-4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBR6 PSMB4 "Proteasome subunit beta type" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P28070 PSMB4 "Proteasome subunit beta type-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 81 | |||
| cd03760 | 197 | cd03760, proteasome_beta_type_4, proteasome beta t | 2e-17 | |
| cd01912 | 189 | cd01912, proteasome_beta, proteasome beta subunit | 2e-10 | |
| cd01906 | 182 | cd01906, proteasome_protease_HslV, proteasome_prot | 6e-08 | |
| cd01901 | 164 | cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term | 1e-05 | |
| COG0638 | 236 | COG0638, PRE1, 20S proteasome, alpha and beta subu | 2e-04 | |
| cd03764 | 188 | cd03764, proteasome_beta_archeal, Archeal proteaso | 2e-04 | |
| TIGR03634 | 185 | TIGR03634, arc_protsome_B, proteasome endopeptidas | 5e-04 | |
| pfam00227 | 188 | pfam00227, Proteasome, Proteasome subunit | 7e-04 |
| >gnl|CDD|239729 cd03760, proteasome_beta_type_4, proteasome beta type-4 subunit | Back alignment and domain information |
|---|
Score = 72.2 bits (178), Expect = 2e-17
Identities = 25/56 (44%), Positives = 38/56 (67%)
Query: 23 ASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQ 78
SV +++ GV++AAD+L S+ LA F N +RI KV ++ LLG ++AD QYL+
Sbjct: 3 TSVIAIKYKDGVIIAADTLGSYGSLARFKNVERIFKVGDNTLLGASGDYADFQYLK 58
|
The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis.Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 197 |
| >gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV | Back alignment and domain information |
|---|
| >gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 81 | |||
| KOG0185|consensus | 256 | 99.86 | ||
| PRK05456 | 172 | ATP-dependent protease subunit HslV; Provisional | 99.8 | |
| cd03757 | 212 | proteasome_beta_type_1 proteasome beta type-1 subu | 99.8 | |
| KOG0174|consensus | 224 | 99.78 | ||
| TIGR03692 | 171 | ATP_dep_HslV ATP-dependent protease HslVU, peptida | 99.77 | |
| cd01913 | 171 | protease_HslV Protease HslV and the ATPase/chapero | 99.77 | |
| PTZ00488 | 247 | Proteasome subunit beta type-5; Provisional | 99.76 | |
| cd03760 | 197 | proteasome_beta_type_4 proteasome beta type-4 subu | 99.75 | |
| cd03759 | 195 | proteasome_beta_type_3 proteasome beta type-3 subu | 99.74 | |
| COG0638 | 236 | PRE1 20S proteasome, alpha and beta subunits [Post | 99.72 | |
| TIGR03690 | 219 | 20S_bact_beta proteasome, beta subunit, bacterial | 99.72 | |
| cd03762 | 188 | proteasome_beta_type_6 proteasome beta type-6 subu | 99.71 | |
| TIGR03634 | 185 | arc_protsome_B proteasome endopeptidase complex, a | 99.71 | |
| cd03761 | 188 | proteasome_beta_type_5 proteasome beta type-5 subu | 99.7 | |
| KOG0173|consensus | 271 | 99.7 | ||
| cd03758 | 193 | proteasome_beta_type_2 proteasome beta type-2 subu | 99.7 | |
| cd03763 | 189 | proteasome_beta_type_7 proteasome beta type-7 subu | 99.69 | |
| PF00227 | 190 | Proteasome: Proteasome subunit; InterPro: IPR00135 | 99.68 | |
| cd03750 | 227 | proteasome_alpha_type_2 proteasome_alpha_type_2. T | 99.67 | |
| KOG0179|consensus | 235 | 99.67 | ||
| PTZ00246 | 253 | proteasome subunit alpha; Provisional | 99.67 | |
| cd03764 | 188 | proteasome_beta_archeal Archeal proteasome, beta s | 99.67 | |
| TIGR03633 | 224 | arc_protsome_A proteasome endopeptidase complex, a | 99.66 | |
| cd03752 | 213 | proteasome_alpha_type_4 proteasome_alpha_type_4. T | 99.65 | |
| cd03756 | 211 | proteasome_alpha_archeal proteasome_alpha_archeal. | 99.65 | |
| cd01911 | 209 | proteasome_alpha proteasome alpha subunit. The 20S | 99.65 | |
| cd01912 | 189 | proteasome_beta proteasome beta subunit. The 20S p | 99.64 | |
| cd03753 | 213 | proteasome_alpha_type_5 proteasome_alpha_type_5. T | 99.63 | |
| cd03751 | 212 | proteasome_alpha_type_3 proteasome_alpha_type_3. T | 99.63 | |
| cd01906 | 182 | proteasome_protease_HslV proteasome_protease_HslV. | 99.63 | |
| PRK03996 | 241 | proteasome subunit alpha; Provisional | 99.62 | |
| cd03755 | 207 | proteasome_alpha_type_7 proteasome_alpha_type_7. T | 99.61 | |
| cd03754 | 215 | proteasome_alpha_type_6 proteasome_alpha_type_6. T | 99.58 | |
| cd03749 | 211 | proteasome_alpha_type_1 proteasome_alpha_type_1. T | 99.58 | |
| KOG0175|consensus | 285 | 99.56 | ||
| cd03765 | 236 | proteasome_beta_bacterial Bacterial proteasome, be | 99.46 | |
| TIGR03691 | 228 | 20S_bact_alpha proteasome, alpha subunit, bacteria | 99.43 | |
| KOG0177|consensus | 200 | 99.37 | ||
| cd01901 | 164 | Ntn_hydrolase The Ntn hydrolases (N-terminal nucle | 99.29 | |
| KOG0176|consensus | 241 | 99.26 | ||
| KOG0180|consensus | 204 | 99.02 | ||
| KOG0184|consensus | 254 | 99.0 | ||
| KOG0178|consensus | 249 | 98.71 | ||
| COG5405 | 178 | HslV ATP-dependent protease HslVU (ClpYQ), peptida | 98.62 | |
| KOG0183|consensus | 249 | 98.38 | ||
| KOG0181|consensus | 233 | 98.29 | ||
| KOG0863|consensus | 264 | 98.25 | ||
| KOG0182|consensus | 246 | 97.11 | ||
| COG3484 | 255 | Predicted proteasome-type protease [Posttranslatio | 86.94 |
| >KOG0185|consensus | Back alignment and domain information |
|---|
Probab=99.86 E-value=6.3e-22 Score=143.26 Aligned_cols=69 Identities=35% Similarity=0.581 Sum_probs=66.0
Q ss_pred cCCCCCCCCCceEEEEEcCCeEEEEEeCccccCccceeCCccceEEecCeEEEEecccHHHHHHHHHhC
Q psy4377 13 AVQPPQPLSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81 (81)
Q Consensus 13 ~~~~~~~~~GtTvigi~~~~GVvlaaDtr~s~g~~v~~~~~~Ki~~i~~~i~~~~sG~~aD~q~l~~~l 81 (81)
+...+|++|||||||++|+||||||||++.|||++.++++++|++++++|+++|+||+.||+|+|.+.|
T Consensus 32 qrt~~p~vTGTSVla~ky~~GVviaaD~lgSYGslaR~~nVeRi~kVgdntllG~sGdisD~Q~i~r~L 100 (256)
T KOG0185|consen 32 QRTLNPIVTGTSVLALKYKDGVVIAADTLGSYGSLARYKNVERIFKVGDNTLLGASGDISDFQYIQRVL 100 (256)
T ss_pred ccccCceeccceEEEEEecCceEEEecccccchhhhhhcCceeeEEecCceEEecCccHHHHHHHHHHH
Confidence 446789999999999999999999999999999999999999999999999999999999999999875
|
|
| >PRK05456 ATP-dependent protease subunit HslV; Provisional | Back alignment and domain information |
|---|
| >cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit | Back alignment and domain information |
|---|
| >KOG0174|consensus | Back alignment and domain information |
|---|
| >TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit | Back alignment and domain information |
|---|
| >cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome | Back alignment and domain information |
|---|
| >PTZ00488 Proteasome subunit beta type-5; Provisional | Back alignment and domain information |
|---|
| >cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit | Back alignment and domain information |
|---|
| >cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit | Back alignment and domain information |
|---|
| >COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type | Back alignment and domain information |
|---|
| >cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit | Back alignment and domain information |
|---|
| >TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit | Back alignment and domain information |
|---|
| >KOG0173|consensus | Back alignment and domain information |
|---|
| >cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit | Back alignment and domain information |
|---|
| >cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit | Back alignment and domain information |
|---|
| >PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins | Back alignment and domain information |
|---|
| >cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 | Back alignment and domain information |
|---|
| >KOG0179|consensus | Back alignment and domain information |
|---|
| >PTZ00246 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >cd03756 proteasome_alpha_archeal proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >cd01911 proteasome_alpha proteasome alpha subunit | Back alignment and domain information |
|---|
| >cd01912 proteasome_beta proteasome beta subunit | Back alignment and domain information |
|---|
| >cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >cd01906 proteasome_protease_HslV proteasome_protease_HslV | Back alignment and domain information |
|---|
| >PRK03996 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 | Back alignment and domain information |
|---|
| >cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 | Back alignment and domain information |
|---|
| >cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >KOG0175|consensus | Back alignment and domain information |
|---|
| >cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit | Back alignment and domain information |
|---|
| >TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type | Back alignment and domain information |
|---|
| >KOG0177|consensus | Back alignment and domain information |
|---|
| >cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >KOG0176|consensus | Back alignment and domain information |
|---|
| >KOG0180|consensus | Back alignment and domain information |
|---|
| >KOG0184|consensus | Back alignment and domain information |
|---|
| >KOG0178|consensus | Back alignment and domain information |
|---|
| >COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0183|consensus | Back alignment and domain information |
|---|
| >KOG0181|consensus | Back alignment and domain information |
|---|
| >KOG0863|consensus | Back alignment and domain information |
|---|
| >KOG0182|consensus | Back alignment and domain information |
|---|
| >COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 81 | ||||
| 3unb_M | 219 | Mouse Constitutive 20s Proteasome In Complex With P | 2e-10 | ||
| 1iru_N | 219 | Crystal Structure Of The Mammalian 20s Proteasome A | 1e-09 | ||
| 1ryp_N | 233 | Crystal Structure Of The 20s Proteasome From Yeast | 4e-05 | ||
| 1g0u_M | 266 | A Gated Channel Into The Proteasome Core Particle L | 4e-05 |
| >pdb|3UNB|M Chain M, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 219 | Back alignment and structure |
|
| >pdb|1IRU|N Chain N, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 219 | Back alignment and structure |
| >pdb|1RYP|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 | Back alignment and structure |
| >pdb|1G0U|M Chain M, A Gated Channel Into The Proteasome Core Particle Length = 266 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 81 | |||
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 3e-13 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 7e-13 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 1e-12 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 2e-10 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 3e-10 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 2e-07 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 4e-06 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 1e-05 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 4e-05 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 8e-05 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 9e-05 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 1e-04 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 2e-04 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 2e-04 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 3e-04 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 3e-04 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 3e-04 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 4e-04 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 4e-04 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 5e-04 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 5e-04 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 5e-04 |
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 | Back alignment and structure |
|---|
Score = 61.2 bits (149), Expect = 3e-13
Identities = 17/58 (29%), Positives = 38/58 (65%)
Query: 24 SVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
SV +++D GV++AAD+L S+ L F +R++ V ++ ++G + +D+Q+++ +
Sbjct: 10 SVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLL 67
|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 81 | |||
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 99.82 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 99.8 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 99.79 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 99.78 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 99.77 | |
| 2z3b_A | 180 | ATP-dependent protease HSLV; N-terminal nucleophIl | 99.77 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 99.77 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 99.76 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 99.76 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 99.76 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 99.75 | |
| 1m4y_A | 171 | ATP-dependent protease HSLV; N-terminal catalytic | 99.73 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 99.72 | |
| 1g3k_A | 174 | ATP-dependent protease HSLV; hydrolase; 1.90A {Hae | 99.72 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 99.72 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 99.72 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 99.72 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 99.71 | |
| 3h4p_a | 219 | Proteasome subunit beta; core particle, cytoplasm, | 99.71 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 99.71 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 99.71 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 99.71 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 99.7 | |
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 99.7 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 99.7 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 99.7 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 99.7 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 99.69 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 99.69 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 99.69 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 99.69 | |
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 99.68 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 99.68 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 99.68 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 99.68 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 99.67 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 99.67 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 99.67 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 99.66 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 99.66 | |
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 99.66 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 99.66 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 99.66 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 99.63 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 99.62 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 99.61 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 99.57 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 99.56 |
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 | Back alignment and structure |
|---|
Probab=99.82 E-value=1e-20 Score=136.19 Aligned_cols=80 Identities=18% Similarity=0.304 Sum_probs=56.7
Q ss_pred CCChhhhhhhCCcCCCCCCCCCceEEEEEcCCeEEEEEeCccccCccceeCCccceEEecCeEEEEecccHHHHHHHHHh
Q psy4377 1 MCDKADCKKAKPAVQPPQPLSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDS 80 (81)
Q Consensus 1 ~~~~~~~~~a~~~~~~~~~~~GtTvigi~~~~GVvlaaDtr~s~g~~v~~~~~~Ki~~i~~~i~~~~sG~~aD~q~l~~~ 80 (81)
.|.||...+++....+..+.+|+|+|||+++||||||+|+|.++|.++.+++.+||++|++|+++++||..+|+|.|.+.
T Consensus 8 ~~~rn~~~~~~~~~~~kav~~GtTivgi~~kdGVVlAaD~r~t~g~li~~~~~~KI~~I~d~i~~~~aG~~aD~~~l~~~ 87 (261)
T 3nzj_H 8 NYQRNNFLAENSHTQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQL 87 (261)
T ss_dssp ----------------------CCEEEEEETTEEEEEEECCEEETTEEEETTCCCEEEEETTEEEEEEESHHHHHHHHHH
T ss_pred hhhhHHHHHhcCCCCCcccccCceEEEEEECCEEEEEEcCCcccCCeeccCCcceEEEEcCCEEEEeccCHHHHHHHHHH
Confidence 38999999888777777778999999999999999999999999999999999999999999999999999999999875
|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... | Back alignment and structure |
|---|
| >2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H | Back alignment and structure |
|---|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... | Back alignment and structure |
|---|
| >1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 | Back alignment and structure |
|---|
| >1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H | Back alignment and structure |
|---|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N | Back alignment and structure |
|---|
| >3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D | Back alignment and structure |
|---|
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... | Back alignment and structure |
|---|
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G | Back alignment and structure |
|---|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... | Back alignment and structure |
|---|
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 81 | ||||
| d1rypk_ | 198 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 4e-09 | |
| d1q5qh_ | 224 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 1e-08 | |
| d1ryp2_ | 233 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 2e-08 | |
| d1irul_ | 201 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 4e-08 | |
| d1iru2_ | 217 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 4e-08 | |
| d1iruk_ | 199 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 4e-08 | |
| d1m4ya_ | 171 | d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga ma | 7e-08 | |
| d1irui_ | 220 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 1e-07 | |
| d1rypl_ | 212 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 2e-07 | |
| d1rypi_ | 222 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 3e-07 | |
| d1g3ka_ | 173 | d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus i | 5e-07 | |
| d1ryp1_ | 222 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 6e-07 | |
| d1iruj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 9e-07 | |
| d1iru1_ | 213 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 2e-06 | |
| d1yarh1 | 203 | d.153.1.4 (H:1-203) Proteasome beta subunit (catal | 3e-06 | |
| d1j2qh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 5e-06 | |
| d1ryph_ | 205 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 7e-06 | |
| d1iruh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 8e-06 | |
| d1rypj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 1e-04 | |
| d1rype_ | 242 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 1e-04 | |
| d1rypc_ | 244 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 2e-04 | |
| d1iruc_ | 250 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 2e-04 | |
| d2z3ba1 | 180 | d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus | 5e-04 | |
| d1rypd_ | 241 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 5e-04 | |
| d1q5qa_ | 227 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 7e-04 | |
| d1j2pa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 0.002 | |
| d1irug_ | 245 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 0.002 | |
| d1irue_ | 234 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 0.002 | |
| d1irub_ | 233 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 0.002 | |
| d1rypg_ | 244 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 0.002 |
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome beta subunit (catalytic) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 48.2 bits (114), Expect = 4e-09
Identities = 8/58 (13%), Positives = 22/58 (37%)
Query: 24 SVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
+ G++ V+LA+ V+ L + + +++ L+ D + +
Sbjct: 3 IILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYI 60
|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 | Back information, alignment and structure |
|---|
| >d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Length = 171 | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Length = 173 | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 | Back information, alignment and structure |
|---|
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Length = 180 | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 81 | |||
| d1iru1_ | 213 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.84 | |
| d1ryp1_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.84 | |
| d1iru2_ | 217 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.81 | |
| d1ryp2_ | 233 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.81 | |
| d1iruj_ | 204 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.8 | |
| d1ryph_ | 205 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.8 | |
| d1rypl_ | 212 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.77 | |
| d1irul_ | 201 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.76 | |
| d1rypj_ | 204 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.76 | |
| d1iruh_ | 202 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.75 | |
| d1yarh1 | 203 | Proteasome beta subunit (catalytic) {Archaeon Ther | 99.75 | |
| d1irui_ | 220 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.74 | |
| d1rypk_ | 198 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.74 | |
| d1q5qh_ | 224 | Proteasome beta subunit (catalytic) {Rhodococcus e | 99.74 | |
| d1rypi_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 99.73 | |
| d1j2qh_ | 202 | Proteasome beta subunit (catalytic) {Archaeon Arch | 99.73 | |
| d1iruk_ | 199 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 99.72 | |
| d1m4ya_ | 171 | HslV (ClpQ) protease {Thermotoga maritima [TaxId: | 99.71 | |
| d1rypc_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.7 | |
| d1iruc_ | 250 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.69 | |
| d1rypd_ | 241 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.68 | |
| d1g3ka_ | 173 | HslV (ClpQ) protease {Haemophilus influenzae [TaxI | 99.67 | |
| d1irub_ | 233 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.67 | |
| d1yara1 | 221 | Proteasome alpha subunit (non-catalytic) {Archaeon | 99.67 | |
| d2z3ba1 | 180 | HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 | 99.67 | |
| d1rype_ | 242 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.65 | |
| d1j2pa_ | 243 | Proteasome alpha subunit (non-catalytic) {Archaeon | 99.65 | |
| d1rypb_ | 250 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.64 | |
| d1irue_ | 234 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.64 | |
| d1rypg_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.63 | |
| d1irud_ | 243 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.62 | |
| d1rypa_ | 243 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.62 | |
| d1irug_ | 245 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.61 | |
| d1irua_ | 244 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.58 | |
| d1q5qa_ | 227 | Proteasome alpha subunit (non-catalytic) {Rhodococ | 99.57 | |
| d1iruf_ | 238 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 99.55 | |
| d1rypf_ | 233 | Proteasome alpha subunit (non-catalytic) {Baker's | 99.49 |
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome beta subunit (catalytic) species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.84 E-value=3.1e-21 Score=129.33 Aligned_cols=66 Identities=11% Similarity=0.082 Sum_probs=63.3
Q ss_pred CCCCCC-CCceEEEEEcCCeEEEEEeCccccCccceeCCccceEEecCeEEEEecccHHHHHHHHHh
Q psy4377 15 QPPQPL-SCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDS 80 (81)
Q Consensus 15 ~~~~~~-~GtTvigi~~~~GVvlaaDtr~s~g~~v~~~~~~Ki~~i~~~i~~~~sG~~aD~q~l~~~ 80 (81)
+|+||. ||||+|||+++|||+||||+|.++|.++.+++.+||++|++|++++++|..+|.|.+.+.
T Consensus 1 ~f~p~~~nG~Tivai~~~dgVviaaD~r~t~g~~~~~~~~~KI~~i~~~i~~~~aG~~~D~~~l~~~ 67 (213)
T d1iru1_ 1 RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKI 67 (213)
T ss_dssp CCCSCCCCCCEEEEEEETTEEEEEEECCEEETTEEEESCCCCEEEEETTEEEEEEECHHHHHHHHHH
T ss_pred CCCCccCCCcEEEEEEECCEEEEEECCccccCceeeccccCEEEEcCCCEEEEecCccchHHHHHHH
Confidence 578998 999999999999999999999999999999999999999999999999999999999875
|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|