Psyllid ID: psy4515
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| 383858085 | 1084 | PREDICTED: uncharacterized protein LOC10 | 0.342 | 0.047 | 0.862 | 9e-23 | |
| 270013585 | 926 | hypothetical protein TcasGA2_TC012205 [T | 0.348 | 0.056 | 0.833 | 1e-22 | |
| 307180220 | 1088 | MICAL-like protein 2 [Camponotus florida | 0.328 | 0.045 | 0.862 | 2e-22 | |
| 189240639 | 987 | PREDICTED: similar to MICAL-like CG11259 | 0.328 | 0.049 | 0.862 | 2e-22 | |
| 332027292 | 1029 | MICAL-like protein 2 [Acromyrmex echinat | 0.328 | 0.047 | 0.862 | 3e-22 | |
| 340718062 | 1099 | PREDICTED: hypothetical protein LOC10064 | 0.322 | 0.043 | 0.862 | 7e-22 | |
| 345482132 | 850 | PREDICTED: hypothetical protein LOC10011 | 0.328 | 0.057 | 0.862 | 1e-21 | |
| 350420891 | 1096 | PREDICTED: hypothetical protein LOC10074 | 0.322 | 0.043 | 0.843 | 2e-21 | |
| 195457072 | 1103 | GK17790 [Drosophila willistoni] gi|19417 | 0.342 | 0.046 | 0.823 | 4e-21 | |
| 380023178 | 1087 | PREDICTED: uncharacterized protein LOC10 | 0.342 | 0.046 | 0.803 | 1e-20 |
| >gi|383858085|ref|XP_003704533.1| PREDICTED: uncharacterized protein LOC100881207 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 111 bits (278), Expect = 9e-23, Method: Composition-based stats.
Identities = 44/51 (86%), Positives = 49/51 (96%)
Query: 57 MGERRGTKALEMWCRRVTEGYPGVRVDNMTSSWRDGLAFCALIHHFRPDLI 107
MGERRGTKALE+WCRR+TEGYPGV V NMT+SW+DGLAFCA+IHHFRPDLI
Sbjct: 1 MGERRGTKALELWCRRITEGYPGVNVQNMTTSWKDGLAFCAMIHHFRPDLI 51
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270013585|gb|EFA10033.1| hypothetical protein TcasGA2_TC012205 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307180220|gb|EFN68253.1| MICAL-like protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|189240639|ref|XP_001809361.1| PREDICTED: similar to MICAL-like CG11259-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|332027292|gb|EGI67376.1| MICAL-like protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|340718062|ref|XP_003397491.1| PREDICTED: hypothetical protein LOC100649179 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|345482132|ref|XP_001602531.2| PREDICTED: hypothetical protein LOC100118598 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|350420891|ref|XP_003492663.1| PREDICTED: hypothetical protein LOC100744222 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|195457072|ref|XP_002075413.1| GK17790 [Drosophila willistoni] gi|194171498|gb|EDW86399.1| GK17790 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|380023178|ref|XP_003695403.1| PREDICTED: uncharacterized protein LOC100866046 [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| FB|FBgn0036333 | 1010 | MICAL-like "MICAL-like" [Droso | 0.308 | 0.045 | 0.804 | 2.6e-16 | |
| MGI|MGI:2667252 | 1231 | Ehbp1 "EH domain binding prote | 0.355 | 0.043 | 0.537 | 2.4e-12 | |
| UNIPROTKB|E1BY88 | 1139 | EHBP1 "Uncharacterized protein | 0.624 | 0.081 | 0.373 | 2.7e-12 | |
| UNIPROTKB|F1LVX2 | 1192 | Ehbp1 "Protein Ehbp1" [Rattus | 0.355 | 0.044 | 0.518 | 4.7e-12 | |
| UNIPROTKB|Q8NDI1 | 1231 | EHBP1 "EH domain-binding prote | 0.355 | 0.043 | 0.518 | 4.9e-12 | |
| UNIPROTKB|F1MQA8 | 1232 | EHBP1 "Uncharacterized protein | 0.355 | 0.043 | 0.518 | 4.9e-12 | |
| WB|WBGene00004855 | 4166 | sma-1 [Caenorhabditis elegans | 0.348 | 0.012 | 0.603 | 2.5e-11 | |
| FB|FBgn0034180 | 1141 | Ehbp1 "Eps15 homology domain c | 0.302 | 0.039 | 0.608 | 6.6e-11 | |
| UNIPROTKB|J3KSK6 | 496 | MICAL3 "Protein-methionine sul | 0.523 | 0.157 | 0.444 | 8.8e-11 | |
| UNIPROTKB|J9NSY0 | 625 | SPTBN4 "Uncharacterized protei | 0.348 | 0.083 | 0.584 | 1e-10 |
| FB|FBgn0036333 MICAL-like "MICAL-like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 215 (80.7 bits), Expect = 2.6e-16, P = 2.6e-16
Identities = 37/46 (80%), Positives = 43/46 (93%)
Query: 62 GTKALEMWCRRVTEGYPGVRVDNMTSSWRDGLAFCALIHHFRPDLI 107
GTKALE WCR VT+GY GV+V+NMT+SWR+GLAFCA+IHHFRPDLI
Sbjct: 12 GTKALEYWCRVVTQGYNGVKVENMTTSWRNGLAFCAIIHHFRPDLI 57
|
|
| MGI|MGI:2667252 Ehbp1 "EH domain binding protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BY88 EHBP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LVX2 Ehbp1 "Protein Ehbp1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8NDI1 EHBP1 "EH domain-binding protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MQA8 EHBP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00004855 sma-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034180 Ehbp1 "Eps15 homology domain containing protein-binding protein 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KSK6 MICAL3 "Protein-methionine sulfoxide oxidase MICAL3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NSY0 SPTBN4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| pfam00307 | 104 | pfam00307, CH, Calponin homology (CH) domain | 8e-15 | |
| smart00033 | 101 | smart00033, CH, Calponin homology domain | 2e-13 | |
| cd00014 | 107 | cd00014, CH, Calponin homology domain; actin-bindi | 1e-12 | |
| COG5069 | 612 | COG5069, SAC6, Ca2+-binding actin-bundling protein | 1e-11 | |
| pfam00307 | 104 | pfam00307, CH, Calponin homology (CH) domain | 1e-10 | |
| smart00033 | 101 | smart00033, CH, Calponin homology domain | 2e-09 | |
| cd00014 | 107 | cd00014, CH, Calponin homology domain; actin-bindi | 3e-09 | |
| pfam11971 | 85 | pfam11971, CAMSAP_CH, CAMSAP CH domain | 4e-08 | |
| COG5069 | 612 | COG5069, SAC6, Ca2+-binding actin-bundling protein | 6e-08 | |
| pfam11971 | 85 | pfam11971, CAMSAP_CH, CAMSAP CH domain | 2e-07 |
| >gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain | Back alignment and domain information |
|---|
Score = 65.4 bits (160), Expect = 8e-15
Identities = 21/44 (47%), Positives = 24/44 (54%)
Query: 64 KALEMWCRRVTEGYPGVRVDNMTSSWRDGLAFCALIHHFRPDLI 107
KAL W V Y G+ V N RDGLA CAL++ RP LI
Sbjct: 2 KALLRWINEVLGEYGGLPVTNFFEDLRDGLALCALLNKLRPGLI 45
|
The CH domain is found in both cytoskeletal proteins and signal transduction proteins. The CH domain is involved in actin binding in some members of the family. However in calponins there is evidence that the CH domain is not involved in its actin binding activity. Most member proteins have from two to four copies of the CH domain, however some proteins such as calponin have only a single copy. Length = 104 |
| >gnl|CDD|214479 smart00033, CH, Calponin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) | Back alignment and domain information |
|---|
| >gnl|CDD|227401 COG5069, SAC6, Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214479 smart00033, CH, Calponin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) | Back alignment and domain information |
|---|
| >gnl|CDD|221350 pfam11971, CAMSAP_CH, CAMSAP CH domain | Back alignment and domain information |
|---|
| >gnl|CDD|227401 COG5069, SAC6, Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|221350 pfam11971, CAMSAP_CH, CAMSAP CH domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| KOG0517|consensus | 2473 | 99.93 | ||
| KOG0035|consensus | 890 | 99.67 | ||
| COG5069 | 612 | SAC6 Ca2+-binding actin-bundling protein fimbrin/p | 99.28 | |
| KOG0517|consensus | 2473 | 99.25 | ||
| smart00033 | 103 | CH Calponin homology domain. Actin binding domains | 98.77 | |
| cd00014 | 107 | CH Calponin homology domain; actin-binding domain | 98.56 | |
| PF00307 | 108 | CH: Calponin homology (CH) domain; InterPro: IPR00 | 98.52 | |
| PF11971 | 85 | CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T | 98.26 | |
| KOG0035|consensus | 890 | 98.24 | ||
| COG5069 | 612 | SAC6 Ca2+-binding actin-bundling protein fimbrin/p | 97.67 | |
| PF11971 | 85 | CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T | 97.19 | |
| smart00033 | 103 | CH Calponin homology domain. Actin binding domains | 96.05 | |
| cd00014 | 107 | CH Calponin homology domain; actin-binding domain | 95.07 | |
| PF00307 | 108 | CH: Calponin homology (CH) domain; InterPro: IPR00 | 94.7 | |
| KOG0046|consensus | 627 | 94.45 | ||
| PF06294 | 158 | DUF1042: Domain of Unknown Function (DUF1042); Int | 92.05 |
| >KOG0517|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=2.2e-27 Score=225.82 Aligned_cols=135 Identities=30% Similarity=0.454 Sum_probs=112.9
Q ss_pred chhhhhhhccCCCcccccccccccccccccee--eehh----hccCCCccccccccccccchHHHHHHHHHHhhCCCCCe
Q psy4515 7 TKALEMWCRRAPDPCFDTLNFDMGERRGTKAL--EMWC----QCNSDPCFDTLDFDMGERRGTKALEMWCRRVTEGYPGV 80 (149)
Q Consensus 7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~w~----~~~~~~~~~~~~~~~~~~~~k~~LL~W~q~~~~~y~~v 80 (149)
+|||-|+.-..+-.-.+.+ .+|+++|--.+ +||+ +.|++|+++++|.. .++++|++||+|||++|+|||||
T Consensus 110 dKaLqFLkeqkVhLEniGs--hDIVDGN~rL~LGLIWTIILRFQIq~I~ie~edn~-E~rSAKDALLLWCQmKTAGYpnV 186 (2473)
T KOG0517|consen 110 DKALQFLKEQKVHLENIGS--HDIVDGNHRLILGLIWTIILRFQIQDISIETEDNR-ETRSAKDALLLWCQMKTAGYPNV 186 (2473)
T ss_pred HHHHHHHHhcccccccCCc--ccccCCcchhhHHHHHHHHHheeeeeeEeecccch-hhhhHHHHHHHHHHhhccCCCCc
Confidence 6888888776666666655 45999998544 9999 67889999987776 77889999999999999999999
Q ss_pred eecCCCcccccchhhhhhhhccCCCccCccc------------hhcccc---CCC-ccccCCCCCcchhhhHHHHHHhhh
Q psy4515 81 RVDNMTSSWRDGLAFCALIHHFRPDLIFYYA------------TFFVTE---GYP-GVRVDNMTSSWRDGLAFCALIHHF 144 (149)
Q Consensus 81 ~v~nf~~sw~dG~a~~Alih~~rP~lid~~~------------~~~vte---g~p-~V~v~nfs~sw~dgla~~ali~~~ 144 (149)
+|+|||+|||||+||+||||++||||+||++ +|.+++ |++ -++.+|....-+|..++++|+..|
T Consensus 187 NI~nFTtSWRdGLaFNALIHkHRPDLvDf~~L~k~na~~NL~~AFdvAE~~LGia~LLDpEDV~v~~PDEKSIITYV~~Y 266 (2473)
T KOG0517|consen 187 NITNFTTSWRDGLAFNALIHKHRPDLVDFDKLKKSNALYNLQHAFDVAEQELGIAKLLDPEDVNVEQPDEKSIITYVVTY 266 (2473)
T ss_pred ccccCccchhcchhHHHHHHhcCcchhhhcccCCCchhhHHHHHHHHHHHHcCchhcCCHhhcCccCCCcchHHHHHHHH
Confidence 9999999999999999999999999999997 577777 443 347888877778888877777544
|
|
| >KOG0035|consensus | Back alignment and domain information |
|---|
| >COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0517|consensus | Back alignment and domain information |
|---|
| >smart00033 CH Calponin homology domain | Back alignment and domain information |
|---|
| >cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) | Back alignment and domain information |
|---|
| >PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] | Back alignment and domain information |
|---|
| >PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins | Back alignment and domain information |
|---|
| >KOG0035|consensus | Back alignment and domain information |
|---|
| >COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins | Back alignment and domain information |
|---|
| >smart00033 CH Calponin homology domain | Back alignment and domain information |
|---|
| >cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) | Back alignment and domain information |
|---|
| >PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] | Back alignment and domain information |
|---|
| >KOG0046|consensus | Back alignment and domain information |
|---|
| >PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 149 | ||||
| 2d89_A | 119 | Solution Structure Of The Ch Domain From Human Eh D | 8e-14 | ||
| 2d89_A | 119 | Solution Structure Of The Ch Domain From Human Eh D | 9e-10 | ||
| 1bkr_A | 109 | Calponin Homology (Ch) Domain From Human Beta-Spect | 7e-12 | ||
| 1bkr_A | 109 | Calponin Homology (Ch) Domain From Human Beta-Spect | 3e-08 | ||
| 1aa2_A | 108 | Calponin Homology (Ch) Domain From Human Beta-Spect | 1e-11 | ||
| 1aa2_A | 108 | Calponin Homology (Ch) Domain From Human Beta-Spect | 3e-08 | ||
| 1wyq_A | 127 | Solution Structure Of The Second Ch Domain Of Human | 2e-11 | ||
| 1wyq_A | 127 | Solution Structure Of The Second Ch Domain Of Human | 3e-08 | ||
| 1tjt_A | 250 | X-Ray Structure Of The Human Alpha-Actinin Isoform | 3e-11 | ||
| 1tjt_A | 250 | X-Ray Structure Of The Human Alpha-Actinin Isoform | 4e-06 | ||
| 1wku_A | 254 | High Resolution Structure Of The Human Alpha-Actini | 3e-11 | ||
| 1wku_A | 254 | High Resolution Structure Of The Human Alpha-Actini | 4e-06 | ||
| 2d88_A | 121 | Solution Structure Of The Ch Domain From Human Mica | 4e-11 | ||
| 2d88_A | 121 | Solution Structure Of The Ch Domain From Human Mica | 9e-08 | ||
| 2e9k_A | 121 | Solution Structure Of The Ch Domain From Human Mica | 8e-11 | ||
| 2e9k_A | 121 | Solution Structure Of The Ch Domain From Human Mica | 1e-07 | ||
| 2eyi_A | 234 | Crystal Structure Of The Actin-Binding Domain Of Hu | 1e-10 | ||
| 2eyi_A | 234 | Crystal Structure Of The Actin-Binding Domain Of Hu | 2e-05 | ||
| 2r0o_A | 237 | Crystal Structure Of The Actin-Binding Domain Of Hu | 3e-10 | ||
| 2r0o_A | 237 | Crystal Structure Of The Actin-Binding Domain Of Hu | 5e-05 | ||
| 2dk9_A | 118 | Solution Structure Of Calponin Homology Domain Of H | 8e-10 | ||
| 2dk9_A | 118 | Solution Structure Of Calponin Homology Domain Of H | 3e-07 | ||
| 1sjj_A | 863 | Cryo-Em Structure Of Chicken Gizzard Smooth Muscle | 2e-09 | ||
| 1sjj_A | 863 | Cryo-Em Structure Of Chicken Gizzard Smooth Muscle | 1e-05 | ||
| 1wyl_A | 116 | Solution Structure Of The Ch Domain Of Human Nedd9 | 2e-09 | ||
| 1wyl_A | 116 | Solution Structure Of The Ch Domain Of Human Nedd9 | 3e-07 | ||
| 1dxx_A | 246 | N-Terminal Actin-Binding Domain Of Human Dystrophin | 6e-09 | ||
| 1dxx_A | 246 | N-Terminal Actin-Binding Domain Of Human Dystrophin | 2e-06 | ||
| 1mb8_A | 243 | Crystal Structure Of The Actin Binding Domain Of Pl | 9e-09 | ||
| 1mb8_A | 243 | Crystal Structure Of The Actin Binding Domain Of Pl | 6e-06 | ||
| 3f7p_A | 296 | Crystal Structure Of A Complex Between Integrin Bet | 9e-09 | ||
| 3f7p_A | 296 | Crystal Structure Of A Complex Between Integrin Bet | 6e-06 | ||
| 1sh5_A | 245 | Crystal Structure Of Actin-Binding Domain Of Mouse | 2e-08 | ||
| 1sh5_A | 245 | Crystal Structure Of Actin-Binding Domain Of Mouse | 1e-05 | ||
| 2d87_A | 128 | Solution Structure Of The Ch Domain From Human Smoo | 2e-08 | ||
| 2d87_A | 128 | Solution Structure Of The Ch Domain From Human Smoo | 7e-06 | ||
| 2jv9_A | 119 | The Solution Structure Of Calponin Homology Domain | 5e-08 | ||
| 1bhd_A | 118 | Second Calponin Homology Domain From Utrophin Lengt | 5e-08 | ||
| 1bhd_A | 118 | Second Calponin Homology Domain From Utrophin Lengt | 2e-04 | ||
| 1qag_A | 226 | Actin Binding Region Of The Dystrophin Homologue Ut | 9e-08 | ||
| 1qag_A | 226 | Actin Binding Region Of The Dystrophin Homologue Ut | 2e-04 |
| >pdb|2D89|A Chain A, Solution Structure Of The Ch Domain From Human Eh Domain Binding Protein 1 Length = 119 | Back alignment and structure |
|
| >pdb|2D89|A Chain A, Solution Structure Of The Ch Domain From Human Eh Domain Binding Protein 1 Length = 119 | Back alignment and structure |
| >pdb|1BKR|A Chain A, Calponin Homology (Ch) Domain From Human Beta-Spectrin At 1.1 Angstrom Resolution Length = 109 | Back alignment and structure |
| >pdb|1BKR|A Chain A, Calponin Homology (Ch) Domain From Human Beta-Spectrin At 1.1 Angstrom Resolution Length = 109 | Back alignment and structure |
| >pdb|1AA2|A Chain A, Calponin Homology (Ch) Domain From Human Beta-Spectrin Length = 108 | Back alignment and structure |
| >pdb|1AA2|A Chain A, Calponin Homology (Ch) Domain From Human Beta-Spectrin Length = 108 | Back alignment and structure |
| >pdb|1WYQ|A Chain A, Solution Structure Of The Second Ch Domain Of Human Spectrin Beta Chain, Brain 2 Length = 127 | Back alignment and structure |
| >pdb|1WYQ|A Chain A, Solution Structure Of The Second Ch Domain Of Human Spectrin Beta Chain, Brain 2 Length = 127 | Back alignment and structure |
| >pdb|1TJT|A Chain A, X-Ray Structure Of The Human Alpha-Actinin Isoform 3 At 2.2a Resolution Length = 250 | Back alignment and structure |
| >pdb|1TJT|A Chain A, X-Ray Structure Of The Human Alpha-Actinin Isoform 3 At 2.2a Resolution Length = 250 | Back alignment and structure |
| >pdb|1WKU|A Chain A, High Resolution Structure Of The Human Alpha-Actinin Isoform 3 Length = 254 | Back alignment and structure |
| >pdb|1WKU|A Chain A, High Resolution Structure Of The Human Alpha-Actinin Isoform 3 Length = 254 | Back alignment and structure |
| >pdb|2D88|A Chain A, Solution Structure Of The Ch Domain From Human Mical-3 Protein Length = 121 | Back alignment and structure |
| >pdb|2D88|A Chain A, Solution Structure Of The Ch Domain From Human Mical-3 Protein Length = 121 | Back alignment and structure |
| >pdb|2E9K|A Chain A, Solution Structure Of The Ch Domain From Human Mical-2 Length = 121 | Back alignment and structure |
| >pdb|2E9K|A Chain A, Solution Structure Of The Ch Domain From Human Mical-2 Length = 121 | Back alignment and structure |
| >pdb|2EYI|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin 1 At 1.7 Angstrom Resolution Length = 234 | Back alignment and structure |
| >pdb|2EYI|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin 1 At 1.7 Angstrom Resolution Length = 234 | Back alignment and structure |
| >pdb|2R0O|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin-4 Mutant(K255e) Length = 237 | Back alignment and structure |
| >pdb|2R0O|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin-4 Mutant(K255e) Length = 237 | Back alignment and structure |
| >pdb|2DK9|A Chain A, Solution Structure Of Calponin Homology Domain Of Human Mical-1 Length = 118 | Back alignment and structure |
| >pdb|2DK9|A Chain A, Solution Structure Of Calponin Homology Domain Of Human Mical-1 Length = 118 | Back alignment and structure |
| >pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 | Back alignment and structure |
| >pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 | Back alignment and structure |
| >pdb|1WYL|A Chain A, Solution Structure Of The Ch Domain Of Human Nedd9 Interacting Protein With Calponin Homology And Lim Domains Length = 116 | Back alignment and structure |
| >pdb|1WYL|A Chain A, Solution Structure Of The Ch Domain Of Human Nedd9 Interacting Protein With Calponin Homology And Lim Domains Length = 116 | Back alignment and structure |
| >pdb|1DXX|A Chain A, N-Terminal Actin-Binding Domain Of Human Dystrophin Length = 246 | Back alignment and structure |
| >pdb|1DXX|A Chain A, N-Terminal Actin-Binding Domain Of Human Dystrophin Length = 246 | Back alignment and structure |
| >pdb|1MB8|A Chain A, Crystal Structure Of The Actin Binding Domain Of Plectin Length = 243 | Back alignment and structure |
| >pdb|1MB8|A Chain A, Crystal Structure Of The Actin Binding Domain Of Plectin Length = 243 | Back alignment and structure |
| >pdb|3F7P|A Chain A, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 296 | Back alignment and structure |
| >pdb|3F7P|A Chain A, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 296 | Back alignment and structure |
| >pdb|1SH5|A Chain A, Crystal Structure Of Actin-Binding Domain Of Mouse Plectin Length = 245 | Back alignment and structure |
| >pdb|1SH5|A Chain A, Crystal Structure Of Actin-Binding Domain Of Mouse Plectin Length = 245 | Back alignment and structure |
| >pdb|2D87|A Chain A, Solution Structure Of The Ch Domain From Human Smoothelin Splice Isoform L2 Length = 128 | Back alignment and structure |
| >pdb|2D87|A Chain A, Solution Structure Of The Ch Domain From Human Smoothelin Splice Isoform L2 Length = 128 | Back alignment and structure |
| >pdb|2JV9|A Chain A, The Solution Structure Of Calponin Homology Domain From Smoothelin-Like 1 Length = 119 | Back alignment and structure |
| >pdb|1BHD|A Chain A, Second Calponin Homology Domain From Utrophin Length = 118 | Back alignment and structure |
| >pdb|1BHD|A Chain A, Second Calponin Homology Domain From Utrophin Length = 118 | Back alignment and structure |
| >pdb|1QAG|A Chain A, Actin Binding Region Of The Dystrophin Homologue Utrophin Length = 226 | Back alignment and structure |
| >pdb|1QAG|A Chain A, Actin Binding Region Of The Dystrophin Homologue Utrophin Length = 226 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| 1bhd_A | 118 | Utrophin; calponin homology, actin binding, struct | 4e-28 | |
| 1bhd_A | 118 | Utrophin; calponin homology, actin binding, struct | 3e-20 | |
| 1wyq_A | 127 | Spectrin beta chain, brain 2; NPPSFA, structural g | 5e-28 | |
| 1wyq_A | 127 | Spectrin beta chain, brain 2; NPPSFA, structural g | 2e-20 | |
| 1bkr_A | 109 | Spectrin beta chain; filamentous actin-binding dom | 9e-28 | |
| 1bkr_A | 109 | Spectrin beta chain; filamentous actin-binding dom | 4e-20 | |
| 2d89_A | 119 | EHBP1 protein; all alpha, calponin homology domain | 1e-27 | |
| 2d89_A | 119 | EHBP1 protein; all alpha, calponin homology domain | 2e-20 | |
| 2d87_A | 128 | Smoothelin splice isoform L2; all alpha, calponin | 1e-27 | |
| 2d87_A | 128 | Smoothelin splice isoform L2; all alpha, calponin | 1e-20 | |
| 2d88_A | 121 | Protein mical-3; all alpha, calponin homology doma | 1e-27 | |
| 2d88_A | 121 | Protein mical-3; all alpha, calponin homology doma | 1e-20 | |
| 1wyl_A | 116 | NEDD9 interacting protein with calponin homology a | 2e-27 | |
| 1wyl_A | 116 | NEDD9 interacting protein with calponin homology a | 2e-20 | |
| 1wku_A | 254 | Alpha-actinin 3; calponin homology domain, actin b | 3e-19 | |
| 1wku_A | 254 | Alpha-actinin 3; calponin homology domain, actin b | 3e-13 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 6e-18 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 1e-11 | |
| 1sh5_A | 245 | Plectin 1, PLTN, PCN; actin-binding domain, calpon | 2e-17 | |
| 1sh5_A | 245 | Plectin 1, PLTN, PCN; actin-binding domain, calpon | 6e-12 | |
| 1aoa_A | 275 | T-fimbrin; actin-binding protein, calcium-binding, | 3e-17 | |
| 1aoa_A | 275 | T-fimbrin; actin-binding protein, calcium-binding, | 1e-12 | |
| 3f7p_A | 296 | Plectin-1; plakin, hemidesmosome, cell adhesion, e | 4e-17 | |
| 3f7p_A | 296 | Plectin-1; plakin, hemidesmosome, cell adhesion, e | 1e-11 | |
| 1dxx_A | 246 | Dystrophin; structural protein, muscular dystrophy | 1e-15 | |
| 1dxx_A | 246 | Dystrophin; structural protein, muscular dystrophy | 2e-10 | |
| 3hoc_A | 272 | Filamin-A; calponin homology domain, actin binding | 2e-15 | |
| 3hoc_A | 272 | Filamin-A; calponin homology domain, actin binding | 2e-11 | |
| 2wa7_A | 245 | Filamin-B; disease mutation, skeletal dysplasia, s | 9e-15 | |
| 2wa7_A | 245 | Filamin-B; disease mutation, skeletal dysplasia, s | 8e-12 | |
| 1pxy_A | 506 | Fimbrin-like protein; calponin homology, F-actin-b | 2e-13 | |
| 1pxy_A | 506 | Fimbrin-like protein; calponin homology, F-actin-b | 4e-11 | |
| 1pxy_A | 506 | Fimbrin-like protein; calponin homology, F-actin-b | 9e-11 | |
| 1pxy_A | 506 | Fimbrin-like protein; calponin homology, F-actin-b | 4e-07 | |
| 1rt8_A | 513 | Fimbrin; filamentous actin binding domain (ABD), c | 5e-13 | |
| 1rt8_A | 513 | Fimbrin; filamentous actin binding domain (ABD), c | 1e-11 | |
| 1rt8_A | 513 | Fimbrin; filamentous actin binding domain (ABD), c | 1e-09 | |
| 1rt8_A | 513 | Fimbrin; filamentous actin binding domain (ABD), c | 9e-08 |
| >1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Length = 118 | Back alignment and structure |
|---|
Score = 99.3 bits (248), Expect = 4e-28
Identities = 23/52 (44%), Positives = 30/52 (57%)
Query: 56 DMGERRGTKALEMWCRRVTEGYPGVRVDNMTSSWRDGLAFCALIHHFRPDLI 107
D+ + K L W R+ T Y V V N T+SW DGLAF A++H +PDL
Sbjct: 3 DLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWTDGLAFNAVLHRHKPDLF 54
|
| >1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Length = 118 | Back alignment and structure |
|---|
| >1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Length = 109 | Back alignment and structure |
|---|
| >1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Length = 109 | Back alignment and structure |
|---|
| >2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Length = 128 | Back alignment and structure |
|---|
| >2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Length = 128 | Back alignment and structure |
|---|
| >2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Length = 121 | Back alignment and structure |
|---|
| >2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Length = 121 | Back alignment and structure |
|---|
| >1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Length = 116 | Back alignment and structure |
|---|
| >1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Length = 116 | Back alignment and structure |
|---|
| >1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Length = 254 | Back alignment and structure |
|---|
| >1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Length = 254 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Length = 245 | Back alignment and structure |
|---|
| >1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Length = 245 | Back alignment and structure |
|---|
| >1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 | Back alignment and structure |
|---|
| >1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 | Back alignment and structure |
|---|
| >3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Length = 296 | Back alignment and structure |
|---|
| >3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Length = 296 | Back alignment and structure |
|---|
| >1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Length = 246 | Back alignment and structure |
|---|
| >1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Length = 246 | Back alignment and structure |
|---|
| >3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 | Back alignment and structure |
|---|
| >3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 | Back alignment and structure |
|---|
| >2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 | Back alignment and structure |
|---|
| >2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 | Back alignment and structure |
|---|
| >1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 | Back alignment and structure |
|---|
| >1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 | Back alignment and structure |
|---|
| >1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 | Back alignment and structure |
|---|
| >1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 | Back alignment and structure |
|---|
| >1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 | Back alignment and structure |
|---|
| >1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 | Back alignment and structure |
|---|
| >1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 | Back alignment and structure |
|---|
| >1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| 1bkr_A | 109 | Spectrin beta chain; filamentous actin-binding dom | 99.87 | |
| 1wyq_A | 127 | Spectrin beta chain, brain 2; NPPSFA, structural g | 99.87 | |
| 1bhd_A | 118 | Utrophin; calponin homology, actin binding, struct | 99.85 | |
| 1wyl_A | 116 | NEDD9 interacting protein with calponin homology a | 99.84 | |
| 2d87_A | 128 | Smoothelin splice isoform L2; all alpha, calponin | 99.84 | |
| 2d89_A | 119 | EHBP1 protein; all alpha, calponin homology domain | 99.83 | |
| 3f7p_A | 296 | Plectin-1; plakin, hemidesmosome, cell adhesion, e | 99.82 | |
| 2d88_A | 121 | Protein mical-3; all alpha, calponin homology doma | 99.82 | |
| 3hoc_A | 272 | Filamin-A; calponin homology domain, actin binding | 99.8 | |
| 1wku_A | 254 | Alpha-actinin 3; calponin homology domain, actin b | 99.79 | |
| 1sh5_A | 245 | Plectin 1, PLTN, PCN; actin-binding domain, calpon | 99.79 | |
| 4b7l_A | 347 | Filamin-B; structural protein, FR 1 filamin hinge | 99.79 | |
| 1dxx_A | 246 | Dystrophin; structural protein, muscular dystrophy | 99.75 | |
| 2wa7_A | 245 | Filamin-B; disease mutation, skeletal dysplasia, s | 99.74 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.71 | |
| 1rt8_A | 513 | Fimbrin; filamentous actin binding domain (ABD), c | 99.58 | |
| 1pxy_A | 506 | Fimbrin-like protein; calponin homology, F-actin-b | 99.58 | |
| 1rt8_A | 513 | Fimbrin; filamentous actin binding domain (ABD), c | 99.46 | |
| 1aoa_A | 275 | T-fimbrin; actin-binding protein, calcium-binding, | 99.46 | |
| 1pxy_A | 506 | Fimbrin-like protein; calponin homology, F-actin-b | 99.38 | |
| 1wku_A | 254 | Alpha-actinin 3; calponin homology domain, actin b | 99.2 | |
| 4b7l_A | 347 | Filamin-B; structural protein, FR 1 filamin hinge | 99.15 | |
| 3f7p_A | 296 | Plectin-1; plakin, hemidesmosome, cell adhesion, e | 99.14 | |
| 1sh5_A | 245 | Plectin 1, PLTN, PCN; actin-binding domain, calpon | 99.11 | |
| 3hoc_A | 272 | Filamin-A; calponin homology domain, actin binding | 99.08 | |
| 1wjo_A | 124 | T-plastin; CH domain, actin binding, structural ge | 99.03 | |
| 1dxx_A | 246 | Dystrophin; structural protein, muscular dystrophy | 99.02 | |
| 1bkr_A | 109 | Spectrin beta chain; filamentous actin-binding dom | 98.99 | |
| 1bhd_A | 118 | Utrophin; calponin homology, actin binding, struct | 98.96 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 98.94 | |
| 2wa7_A | 245 | Filamin-B; disease mutation, skeletal dysplasia, s | 98.93 | |
| 1wyq_A | 127 | Spectrin beta chain, brain 2; NPPSFA, structural g | 98.93 | |
| 1wyl_A | 116 | NEDD9 interacting protein with calponin homology a | 98.92 | |
| 2d88_A | 121 | Protein mical-3; all alpha, calponin homology doma | 98.9 | |
| 2d87_A | 128 | Smoothelin splice isoform L2; all alpha, calponin | 98.89 | |
| 2d89_A | 119 | EHBP1 protein; all alpha, calponin homology domain | 98.86 | |
| 1aoa_A | 275 | T-fimbrin; actin-binding protein, calcium-binding, | 98.48 | |
| 1wjo_A | 124 | T-plastin; CH domain, actin binding, structural ge | 97.13 | |
| 2vzc_A | 131 | Alpha-parvin; membrane, cytoplasm, cytoskeleton, c | 96.07 | |
| 2qjz_A | 123 | Microtubule-associated protein RP/EB family member | 94.47 | |
| 2yrn_A | 129 | Neuron navigator 2 isoform 4; calponin homolgy dom | 94.02 | |
| 2ee7_A | 127 | Sperm flagellar protein 1; all alpha protein, CH d | 93.7 | |
| 1wyo_A | 159 | Protein EB3, microtubule-associated protein RP/EB | 93.6 | |
| 2r8u_A | 268 | Microtubule-associated protein RP/EB family member | 87.77 | |
| 1wyp_A | 136 | Calponin 1; CH domain, F-actin binding, all-alpha, | 85.74 | |
| 1h67_A | 108 | Calponin alpha; cytoskeleton, calponin homology do | 85.69 | |
| 1ujo_A | 144 | Transgelin; CH domain, actin binding, structural g | 82.39 | |
| 1wyn_A | 146 | Calponin-2; CH domain, F-actin binding, all alpha | 81.14 |
| >1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A | Back alignment and structure |
|---|
Probab=99.87 E-value=2.2e-23 Score=149.65 Aligned_cols=84 Identities=37% Similarity=0.731 Sum_probs=68.0
Q ss_pred cchHHHHHHHHHHhhCCCCCeeecCCCcccccchhhhhhhhccCCCccCccc------------hhcccc---CCCc-cc
Q psy4515 60 RRGTKALEMWCRRVTEGYPGVRVDNMTSSWRDGLAFCALIHHFRPDLIFYYA------------TFFVTE---GYPG-VR 123 (149)
Q Consensus 60 ~~~k~~LL~W~q~~~~~y~~v~v~nf~~sw~dG~a~~Alih~~rP~lid~~~------------~~~vte---g~p~-V~ 123 (149)
.+++++||+|||.++++|++++|+||++||+||+|||||||+++|++|||+. ++++++ |+|. ++
T Consensus 2 ~s~k~~LL~W~q~~~~~y~~v~v~nFs~sw~dG~af~aLih~~~P~lid~~~l~~~~~~~n~~~af~~Ae~~lgi~~ll~ 81 (109)
T 1bkr_A 2 KSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLD 81 (109)
T ss_dssp CHHHHHHHHHHHHHTTTCTTCCCSSSSGGGTTSHHHHHHHHHHCGGGCCGGGCCTTCHHHHHHHHHHHHHHHHCCCCCCC
T ss_pred CCHHHHHHHHHHHHHccCCCCCCCCCcccccccHHHHHHHHHHCcCCCCHHHcCcCCHHHHHHHHHHHHHHHcCCCccCC
Confidence 4689999999999999999999999999999999999999999999999987 455554 6654 46
Q ss_pred cCCCCCcchhhhHHHHHHhh
Q psy4515 124 VDNMTSSWRDGLAFCALIHH 143 (149)
Q Consensus 124 v~nfs~sw~dgla~~ali~~ 143 (149)
++|+....+|..++++|+.+
T Consensus 82 ~eDv~~~~pD~ksi~tYvs~ 101 (109)
T 1bkr_A 82 PEDISVDHPDEKSIITYVVT 101 (109)
T ss_dssp HHHHSSSSCCHHHHHHHHHH
T ss_pred HHHccCCCCcHHHHHHHHHH
Confidence 66665555555555555544
|
| >1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 | Back alignment and structure |
|---|
| >1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A | Back alignment and structure |
|---|
| >2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A | Back alignment and structure |
|---|
| >2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A | Back alignment and structure |
|---|
| >3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A | Back alignment and structure |
|---|
| >1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K | Back alignment and structure |
|---|
| >1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A | Back alignment and structure |
|---|
| >4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A | Back alignment and structure |
|---|
| >1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A | Back alignment and structure |
|---|
| >2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 | Back alignment and structure |
|---|
| >1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B | Back alignment and structure |
|---|
| >1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 | Back alignment and structure |
|---|
| >1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 | Back alignment and structure |
|---|
| >1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B | Back alignment and structure |
|---|
| >1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K | Back alignment and structure |
|---|
| >4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A | Back alignment and structure |
|---|
| >3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A | Back alignment and structure |
|---|
| >3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A | Back alignment and structure |
|---|
| >1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A | Back alignment and structure |
|---|
| >1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A | Back alignment and structure |
|---|
| >1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A | Back alignment and structure |
|---|
| >1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A | Back alignment and structure |
|---|
| >1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A | Back alignment and structure |
|---|
| >2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A | Back alignment and structure |
|---|
| >2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A | Back alignment and structure |
|---|
| >2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 | Back alignment and structure |
|---|
| >1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A | Back alignment and structure |
|---|
| >2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* | Back alignment and structure |
|---|
| >2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A | Back alignment and structure |
|---|
| >2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A | Back alignment and structure |
|---|
| >1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 | Back alignment and structure |
|---|
| >1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 | Back alignment and structure |
|---|
| >1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 149 | ||||
| d1bhda_ | 108 | a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxI | 1e-20 | |
| d1bhda_ | 108 | a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxI | 2e-14 | |
| d1bkra_ | 108 | a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) | 3e-20 | |
| d1bkra_ | 108 | a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) | 1e-13 | |
| d1dxxa2 | 127 | a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapie | 4e-20 | |
| d1dxxa2 | 127 | a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapie | 4e-14 | |
| d1sh5a2 | 110 | a.40.1.1 (A:128-237) Actin binding domain of plect | 5e-18 | |
| d1sh5a2 | 110 | a.40.1.1 (A:128-237) Actin binding domain of plect | 3e-12 | |
| d1rt8a_ | 505 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 1e-16 | |
| d1rt8a_ | 505 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 1e-12 | |
| d1rt8a_ | 505 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 6e-12 | |
| d1rt8a_ | 505 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 1e-07 | |
| d1pxya_ | 500 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 3e-14 | |
| d1pxya_ | 500 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 4e-13 | |
| d1pxya_ | 500 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 5e-10 | |
| d1pxya_ | 500 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 6e-10 | |
| d1aoaa2 | 116 | a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros | 2e-12 | |
| d1aoaa2 | 116 | a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros | 8e-08 | |
| d1wjoa_ | 124 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 3e-07 | |
| d1wjoa_ | 124 | a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin | 1e-05 |
| >d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: CH domain-like superfamily: Calponin-homology domain, CH-domain family: Calponin-homology domain, CH-domain domain: Utrophin species: Human (Homo sapiens) [TaxId: 9606]
Score = 79.1 bits (195), Expect = 1e-20
Identities = 22/46 (47%), Positives = 28/46 (60%)
Query: 64 KALEMWCRRVTEGYPGVRVDNMTSSWRDGLAFCALIHHFRPDLIFY 109
K L W R+ T Y V V N T+SW DGLAF A++H +PDL +
Sbjct: 8 KILLSWVRQTTRPYSQVNVLNFTTSWTDGLAFNAVLHRHKPDLFSW 53
|
| >d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 | Back information, alignment and structure |
|---|
| >d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 | Back information, alignment and structure |
|---|
| >d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 | Back information, alignment and structure |
|---|
| >d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 | Back information, alignment and structure |
|---|
| >d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 | Back information, alignment and structure |
|---|
| >d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 | Back information, alignment and structure |
|---|
| >d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 | Back information, alignment and structure |
|---|
| >d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 | Back information, alignment and structure |
|---|
| >d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| d1sh5a2 | 110 | Actin binding domain of plectin {Human (Homo sapie | 99.87 | |
| d1bkra_ | 108 | beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1bhda_ | 108 | Utrophin {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1dxxa2 | 127 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1rt8a_ | 505 | Fimbrin (Plastin), actin-crosslinking domain {Fiss | 99.71 | |
| d1pxya_ | 500 | Fimbrin (Plastin), actin-crosslinking domain {Thal | 99.7 | |
| d1pxya_ | 500 | Fimbrin (Plastin), actin-crosslinking domain {Thal | 99.5 | |
| d1rt8a_ | 505 | Fimbrin (Plastin), actin-crosslinking domain {Fiss | 99.47 | |
| d1aoaa2 | 116 | Fimbrin (Plastin), actin-crosslinking domain {Huma | 99.1 | |
| d1sh5a2 | 110 | Actin binding domain of plectin {Human (Homo sapie | 99.0 | |
| d1bkra_ | 108 | beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} | 98.91 | |
| d1dxxa2 | 127 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 98.9 | |
| d1bhda_ | 108 | Utrophin {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d1wjoa_ | 124 | Fimbrin (Plastin), actin-crosslinking domain {Huma | 98.75 | |
| d1aoaa2 | 116 | Fimbrin (Plastin), actin-crosslinking domain {Huma | 97.08 | |
| d1dxxa1 | 111 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 96.88 | |
| d1sh5a1 | 120 | Actin binding domain of plectin {Human (Homo sapie | 96.39 | |
| d1wjoa_ | 124 | Fimbrin (Plastin), actin-crosslinking domain {Huma | 96.25 | |
| d1aoaa1 | 131 | Fimbrin (Plastin), actin-crosslinking domain {Huma | 96.0 | |
| d2qjza1 | 120 | Microtubule-associated protein eb1, N-terminal mic | 94.53 | |
| d1ujoa_ | 144 | Transgelin {Mouse (Mus musculus) [TaxId: 10090]} | 92.09 | |
| d1p2xa_ | 159 | Ras GTPase-activating-like protein rng2 {Fission y | 89.83 | |
| d1h67a_ | 108 | Calponin {Chicken (Gallus gallus) [TaxId: 9031]} | 88.52 |
| >d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: CH domain-like superfamily: Calponin-homology domain, CH-domain family: Calponin-homology domain, CH-domain domain: Actin binding domain of plectin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=1.8e-23 Score=148.64 Aligned_cols=87 Identities=32% Similarity=0.603 Sum_probs=73.4
Q ss_pred ccchHHHHHHHHHHhhCCCCCeeecCCCcccccchhhhhhhhccCCCccCccc------------hhcccc---CCCc-c
Q psy4515 59 ERRGTKALEMWCRRVTEGYPGVRVDNMTSSWRDGLAFCALIHHFRPDLIFYYA------------TFFVTE---GYPG-V 122 (149)
Q Consensus 59 ~~~~k~~LL~W~q~~~~~y~~v~v~nf~~sw~dG~a~~Alih~~rP~lid~~~------------~~~vte---g~p~-V 122 (149)
+.+++++||.|||+++.+|++|+|+||++||+||+|||||||+++|+++||+. ++.+++ |+|. +
T Consensus 4 ~~s~k~~LL~W~~~~~~~y~~v~v~nFs~sw~DG~afcaLih~~~P~~id~~~l~~~~~~~~~~~a~~~Ae~~lgip~ll 83 (110)
T d1sh5a2 4 DMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLL 83 (110)
T ss_dssp SCCHHHHHHHHHHHHTTTSTTCCCCCSSGGGTTSHHHHHHHHTTCTTTCCHHHHHHSCHHHHHHHHHHHHHHHHCCCCCC
T ss_pred ccCHHHHHHHHHHHHcCCCCCeeccCCcccccCcHHHHHHHHHHCcccCChhhcCccCHHHHHHHHHHHHHHcCCCCCCC
Confidence 46789999999999999999999999999999999999999999999999876 344453 5654 5
Q ss_pred ccCCCCCcchhhhHHHHHHhhhC
Q psy4515 123 RVDNMTSSWRDGLAFCALIHHFR 145 (149)
Q Consensus 123 ~v~nfs~sw~dgla~~ali~~~r 145 (149)
.++|+....+|.+++++|+..++
T Consensus 84 ~~eD~~~~~pD~~sv~~Yvs~ly 106 (110)
T d1sh5a2 84 DPEDVDVPQPDEKSIITYVSSLY 106 (110)
T ss_dssp CHHHHSSSSCCHHHHHHHHHHHH
T ss_pred CHHHHccCCCcHHHHHHHHHHHH
Confidence 77788777778888877776653
|
| >d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|