Psyllid ID: psy4517


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MAAPPPRRKMSTSGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFMVTSTWCKN
cccccccccccccccccHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHccccccccccccEEEccccccc
ccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccHHHHHHHHcccc
maappprrkmstsgdSLYVILelpktatpeEIKKQYRKMALKyhpdknpnnpeAAEKFKEINRahstlsdqtkrnIYDTYGSLGLYVAEqfgeenvnTYFMVTSTWCKN
maappprrkmstsgdsLYVILelpktatpeeIKKQYRKMALKYHPDKNPNNPEAAEKFKEINrahstlsdqtkrnIYDTYGSLGLYVAEQFGEENVNTYFMVTSTWCKN
MAAPPPRRKMSTSGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFMVTSTWCKN
****************LYVILEL**************************************************RNIYDTYGSLGLYVAEQFGEENVNTYFMVTSTWC**
*****************YVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFMVTSTWCKN
************SGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFMVTSTWCKN
**************DSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRNIYDTYGSLGLYVAE*FGEENVNTYFMVTSTWCKN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAPPPRRKMSTSGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFMVTSTWCKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
P56101195 Cysteine string protein O N/A N/A 0.935 0.523 0.754 9e-43
Q03751 249 Cysteine string protein O no N/A 0.990 0.433 0.752 3e-42
Q9H3Z4198 DnaJ homolog subfamily C yes N/A 0.935 0.515 0.735 8e-41
P60905198 DnaJ homolog subfamily C yes N/A 0.935 0.515 0.735 8e-41
P60904198 DnaJ homolog subfamily C yes N/A 0.935 0.515 0.735 8e-41
Q29455198 DnaJ homolog subfamily C yes N/A 0.935 0.515 0.735 8e-41
O42196197 Cysteine string protein O N/A N/A 0.935 0.517 0.735 4e-40
F1RTY8199 DnaJ homolog subfamily C yes N/A 0.935 0.512 0.735 5e-39
D3ZD82199 DnaJ homolog subfamily C no N/A 0.935 0.512 0.725 5e-39
Q9CQ94199 DnaJ homolog subfamily C no N/A 0.990 0.542 0.684 1e-38
>sp|P56101|CSP_TORCA Cysteine string protein OS=Torpedo californica PE=1 SV=1 Back     alignment and function desciption
 Score =  171 bits (434), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 91/102 (89%)

Query: 7   RRKMSTSGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHS 66
           +R +STSGDSLY++L L K A+PE+IKK YRK+ALKYHPDKNP+NPEA+EKFKEIN AH+
Sbjct: 6   QRSLSTSGDSLYIVLGLDKNASPEDIKKSYRKLALKYHPDKNPDNPEASEKFKEINNAHA 65

Query: 67  TLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFMVTSTWCK 108
            L+D TKRNIYD YGSLGLYVAEQFGEENVNTYF+++S W K
Sbjct: 66  ILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAK 107




May have an important role in presynaptic function. May be involved in calcium-dependent neurotransmitter release at nerve endings.
Torpedo californica (taxid: 7787)
>sp|Q03751|CSP_DROME Cysteine string protein OS=Drosophila melanogaster GN=Csp PE=1 SV=1 Back     alignment and function description
>sp|Q9H3Z4|DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo sapiens GN=DNAJC5 PE=1 SV=1 Back     alignment and function description
>sp|P60905|DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus norvegicus GN=Dnajc5 PE=1 SV=1 Back     alignment and function description
>sp|P60904|DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus GN=Dnajc5 PE=1 SV=1 Back     alignment and function description
>sp|Q29455|DNJC5_BOVIN DnaJ homolog subfamily C member 5 OS=Bos taurus GN=DNAJC5 PE=2 SV=1 Back     alignment and function description
>sp|O42196|CSP_XENLA Cysteine string protein OS=Xenopus laevis GN=csp PE=2 SV=1 Back     alignment and function description
>sp|F1RTY8|DNJ5B_PIG DnaJ homolog subfamily C member 5B OS=Sus scrofa GN=DNAJC5B PE=3 SV=1 Back     alignment and function description
>sp|D3ZD82|DNJ5B_RAT DnaJ homolog subfamily C member 5B OS=Rattus norvegicus GN=Dnajc5b PE=3 SV=1 Back     alignment and function description
>sp|Q9CQ94|DNJ5B_MOUSE DnaJ homolog subfamily C member 5B OS=Mus musculus GN=Dnajc5b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
307172857 231 Cysteine string protein [Camponotus flor 0.935 0.441 0.852 1e-46
380028782168 PREDICTED: cysteine string protein-like 0.935 0.607 0.852 2e-46
340722080 231 PREDICTED: cysteine string protein-like 0.935 0.441 0.843 2e-46
350423811 231 PREDICTED: cysteine string protein-like 0.935 0.441 0.843 2e-46
340722082 212 PREDICTED: cysteine string protein-like 0.935 0.481 0.843 2e-46
350423814 212 PREDICTED: cysteine string protein-like 0.935 0.481 0.843 3e-46
91084337 237 PREDICTED: similar to AGAP007620-PA [Tri 0.935 0.430 0.833 2e-45
427792489 261 hypothetical protein, partial [Rhipiceph 0.944 0.394 0.815 5e-45
346465445 255 hypothetical protein [Amblyomma maculatu 0.944 0.403 0.805 5e-45
427792491 248 hypothetical protein, partial [Rhipiceph 0.944 0.415 0.815 6e-45
>gi|307172857|gb|EFN64062.1| Cysteine string protein [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%)

Query: 7   RRKMSTSGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHS 66
           RRKMST+GDSLY ILE+PKTAT EEIKK YR++ALKYHPDKNPNNPEAAEKFKEINRAH+
Sbjct: 3   RRKMSTAGDSLYQILEIPKTATSEEIKKTYRRLALKYHPDKNPNNPEAAEKFKEINRAHA 62

Query: 67  TLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFMVTSTWCK 108
            L+D TKRNIYD YGSLGLYVAEQFGEENVN YF+VTS WCK
Sbjct: 63  ILTDLTKRNIYDNYGSLGLYVAEQFGEENVNAYFVVTSGWCK 104




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380028782|ref|XP_003698066.1| PREDICTED: cysteine string protein-like [Apis florea] Back     alignment and taxonomy information
>gi|340722080|ref|XP_003399438.1| PREDICTED: cysteine string protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350423811|ref|XP_003493599.1| PREDICTED: cysteine string protein-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340722082|ref|XP_003399439.1| PREDICTED: cysteine string protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350423814|ref|XP_003493600.1| PREDICTED: cysteine string protein-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|91084337|ref|XP_972793.1| PREDICTED: similar to AGAP007620-PA [Tribolium castaneum] gi|270008724|gb|EFA05172.1| hypothetical protein TcasGA2_TC015301 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|427792489|gb|JAA61696.1| hypothetical protein, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|346465445|gb|AEO32567.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|427792491|gb|JAA61697.1| hypothetical protein, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
FB|FBgn0004179 249 Csp "Cysteine string protein" 0.954 0.417 0.771 6.8e-40
ZFIN|ZDB-GENE-081021-2199 dnajc5ab "DnaJ (Hsp40) homolog 0.990 0.542 0.712 7.8e-39
UNIPROTKB|E1C4G0198 DNAJC5 "Uncharacterized protei 0.935 0.515 0.745 1.3e-38
UNIPROTKB|Q29455198 DNAJC5 "DnaJ homolog subfamily 0.935 0.515 0.735 2.6e-38
UNIPROTKB|E2RJB9198 DNAJC5 "Uncharacterized protei 0.935 0.515 0.735 2.6e-38
UNIPROTKB|Q9H3Z4198 DNAJC5 "DnaJ homolog subfamily 0.935 0.515 0.735 2.6e-38
MGI|MGI:892995198 Dnajc5 "DnaJ (Hsp40) homolog, 0.935 0.515 0.735 2.6e-38
RGD|620516198 Dnajc5 "DnaJ (Hsp40) homolog, 0.935 0.515 0.735 2.6e-38
UNIPROTKB|F1RTY8199 DNAJC5B "DnaJ homolog subfamil 0.935 0.512 0.735 1e-36
RGD|1562486199 Dnajc5b "DnaJ (Hsp40) homolog, 0.935 0.512 0.725 1.7e-36
FB|FBgn0004179 Csp "Cysteine string protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 425 (154.7 bits), Expect = 6.8e-40, P = 6.8e-40
 Identities = 81/105 (77%), Positives = 94/105 (89%)

Query:     1 MAAPP-PRRKMSTSGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFK 59
             M+AP   +RK+STSGDSLY IL LPKTAT ++IKK YRK+ALKYHPDKNP+N +AA+KFK
Sbjct:     1 MSAPGMDKRKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFK 60

Query:    60 EINRAHSTLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFMVTS 104
             E+NRAHS LS+QTKRNIYD YGSLGLY+AEQFGEENVN YF+VTS
Sbjct:    61 EVNRAHSILSNQTKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTS 105




GO:0005886 "plasma membrane" evidence=ISS;IDA
GO:0016191 "synaptic vesicle uncoating" evidence=TAS
GO:0007269 "neurotransmitter secretion" evidence=TAS
GO:0016192 "vesicle-mediated transport" evidence=TAS
GO:0008021 "synaptic vesicle" evidence=IDA;TAS
GO:0006457 "protein folding" evidence=NAS
GO:0006887 "exocytosis" evidence=IMP
GO:0016079 "synaptic vesicle exocytosis" evidence=ISS
GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP
GO:0001964 "startle response" evidence=IMP
GO:0048854 "brain morphogenesis" evidence=IMP
GO:0043195 "terminal bouton" evidence=IDA
ZFIN|ZDB-GENE-081021-2 dnajc5ab "DnaJ (Hsp40) homolog, subfamily C, member 5ab" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4G0 DNAJC5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q29455 DNAJC5 "DnaJ homolog subfamily C member 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJB9 DNAJC5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H3Z4 DNAJC5 "DnaJ homolog subfamily C member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:892995 Dnajc5 "DnaJ (Hsp40) homolog, subfamily C, member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620516 Dnajc5 "DnaJ (Hsp40) homolog, subfamily C, member 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTY8 DNAJC5B "DnaJ homolog subfamily C member 5B" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1562486 Dnajc5b "DnaJ (Hsp40) homolog, subfamily C, member 5 beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A6Q486DNAJ_NITSBNo assigned EC number0.63230.62380.1823yesN/A
B0BBX5DNAJ_CHLTBNo assigned EC number0.60930.58710.1632yesN/A
B9MJZ0DNAJ_CALBDNo assigned EC number0.59370.58710.1649yesN/A
Q5HCG4DNAJ_EHRRWNo assigned EC number0.53010.76140.2172yesN/A
P63968DNAJ_NEIMANo assigned EC number0.57970.63300.1849yesN/A
P63969DNAJ_NEIMBNo assigned EC number0.57970.63300.1849yesN/A
Q2GI75DNAJ_EHRCRNo assigned EC number0.63760.63300.1815yesN/A
Q3KM17DNAJ_CHLTANo assigned EC number0.60930.58710.1632yesN/A
O84345DNAJ_CHLTRNo assigned EC number0.60930.58710.1632yesN/A
B0B7R0DNAJ_CHLT2No assigned EC number0.60930.58710.1632yesN/A
Q5F5M1DNAJ_NEIG1No assigned EC number0.56520.63300.1849yesN/A
Q5P9E0DNAJ_ANAMMNo assigned EC number0.56520.63300.1820yesN/A
Q29455DNJC5_BOVINNo assigned EC number0.73520.93570.5151yesN/A
Q253T6DNAJ_CHLFFNo assigned EC number0.59370.58710.1636yesN/A
Q3AF07DNAJ_CARHZNo assigned EC number0.60290.62380.1784yesN/A
Q9PK53DNAJ_CHLMUNo assigned EC number0.60930.58710.1632yesN/A
Q3YT99DNAJ_EHRCJNo assigned EC number0.54210.76140.2172yesN/A
A1KR91DNAJ_NEIMFNo assigned EC number0.57970.63300.1849yesN/A
A9LZV9DNAJ_NEIM0No assigned EC number0.57970.63300.1849yesN/A
Q6ME07DNAJ_PARUWNo assigned EC number0.57350.62380.1761yesN/A
Q7M9T3DNAJ_WOLSUNo assigned EC number0.57350.62380.1818yesN/A
F1RTY8DNJ5B_PIGNo assigned EC number0.73520.93570.5125yesN/A
Q5FGQ8DNAJ_EHRRGNo assigned EC number0.53010.76140.2172yesN/A
Q8KCD8DNAJ_CHLTENo assigned EC number0.59370.58710.1588yesN/A
Q75WD2DNAJ_ACEP3No assigned EC number0.55550.65130.1868yesN/A
Q182E7DNAJ_CLOD6No assigned EC number0.57890.68800.1953yesN/A
Q9H3Z4DNJC5_HUMANNo assigned EC number0.73520.93570.5151yesN/A
Q823T2DNAJ_CHLCVNo assigned EC number0.58200.61460.1709yesN/A
Q7VG06DNAJ_HELHPNo assigned EC number0.58820.62380.1766yesN/A
P60905DNJC5_RATNo assigned EC number0.73520.93570.5151yesN/A
P60904DNJC5_MOUSENo assigned EC number0.73520.93570.5151yesN/A
Q5L6F7DNAJ_CHLABNo assigned EC number0.59370.58710.1636yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-34
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-31
pfam0022663 pfam00226, DnaJ, DnaJ domain 4e-31
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-30
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 4e-27
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 9e-27
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-26
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 3e-26
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-24
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-24
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 3e-24
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-23
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 5e-23
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 8e-23
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 9e-23
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 2e-22
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 1e-21
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-21
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-21
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 8e-21
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-20
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-20
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 2e-20
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 8e-20
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 5e-19
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 5e-19
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 6e-19
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-18
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-18
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 8e-18
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 8e-18
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 9e-16
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-14
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 9e-14
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 2e-13
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 5e-11
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 6e-10
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 9e-07
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 3e-05
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 4e-05
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 5e-05
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 6e-05
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 1e-04
TIGR00714155 TIGR00714, hscB, Fe-S protein assembly co-chaperon 2e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 8e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 0.001
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  121 bits (305), Expect = 2e-34
 Identities = 40/70 (57%), Positives = 47/70 (67%)

Query: 16 SLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRN 75
            Y IL + K A+ EEIKK YRK+A KYHPD+NP + EA EKFKEIN A+  LSD  KR 
Sbjct: 5  DYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRA 64

Query: 76 IYDTYGSLGL 85
           YD +G  G 
Sbjct: 65 AYDQFGHAGF 74


Length = 371

>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.96
KOG0713|consensus 336 99.94
PRK14288 369 chaperone protein DnaJ; Provisional 99.92
KOG0716|consensus 279 99.91
KOG0712|consensus 337 99.89
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.89
PRK14296 372 chaperone protein DnaJ; Provisional 99.89
KOG0717|consensus 508 99.89
PRK14286 372 chaperone protein DnaJ; Provisional 99.89
PRK14279 392 chaperone protein DnaJ; Provisional 99.89
PRK14294 366 chaperone protein DnaJ; Provisional 99.88
PRK14287 371 chaperone protein DnaJ; Provisional 99.88
PRK14281 397 chaperone protein DnaJ; Provisional 99.88
PRK14285 365 chaperone protein DnaJ; Provisional 99.88
PRK14298 377 chaperone protein DnaJ; Provisional 99.88
PRK14282 369 chaperone protein DnaJ; Provisional 99.87
PRK14277 386 chaperone protein DnaJ; Provisional 99.87
PRK14301 373 chaperone protein DnaJ; Provisional 99.87
PRK14297 380 chaperone protein DnaJ; Provisional 99.87
PRK14276 380 chaperone protein DnaJ; Provisional 99.87
PRK14283 378 chaperone protein DnaJ; Provisional 99.86
PRK14295 389 chaperone protein DnaJ; Provisional 99.86
PRK14284 391 chaperone protein DnaJ; Provisional 99.86
PRK10767 371 chaperone protein DnaJ; Provisional 99.86
PRK14291 382 chaperone protein DnaJ; Provisional 99.86
PRK14299 291 chaperone protein DnaJ; Provisional 99.86
PRK14280 376 chaperone protein DnaJ; Provisional 99.86
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.86
PRK14278 378 chaperone protein DnaJ; Provisional 99.85
KOG0691|consensus 296 99.85
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.85
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.85
PRK14289 386 chaperone protein DnaJ; Provisional 99.84
PRK14290 365 chaperone protein DnaJ; Provisional 99.84
KOG0718|consensus 546 99.84
PRK14300 372 chaperone protein DnaJ; Provisional 99.83
KOG0715|consensus 288 99.83
PRK14292 371 chaperone protein DnaJ; Provisional 99.82
PRK14293 374 chaperone protein DnaJ; Provisional 99.82
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.81
KOG0719|consensus 264 99.8
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.8
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.78
KOG0721|consensus230 99.77
PHA03102153 Small T antigen; Reviewed 99.76
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.75
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.73
PRK05014171 hscB co-chaperone HscB; Provisional 99.69
PRK03578176 hscB co-chaperone HscB; Provisional 99.67
PRK01356166 hscB co-chaperone HscB; Provisional 99.66
PRK00294173 hscB co-chaperone HscB; Provisional 99.66
KOG0624|consensus504 99.62
PHA02624 647 large T antigen; Provisional 99.61
PTZ00100116 DnaJ chaperone protein; Provisional 99.58
KOG0720|consensus 490 99.58
KOG0722|consensus 329 99.58
KOG0550|consensus486 99.52
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.51
KOG0714|consensus 306 99.49
PRK01773173 hscB co-chaperone HscB; Provisional 99.47
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.42
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.37
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.27
KOG1150|consensus 250 99.24
KOG0568|consensus 342 98.86
KOG1789|consensus 2235 98.71
KOG0723|consensus112 98.66
KOG3192|consensus168 98.24
KOG0431|consensus453 97.48
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.36
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 97.25
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.24
KOG0724|consensus 335 93.24
PF1344662 RPT: A repeated domain in UCH-protein 92.63
PF11833 194 DUF3353: Protein of unknown function (DUF3353); In 91.79
PF14687112 DUF4460: Domain of unknown function (DUF4460) 89.77
KOG3442|consensus132 87.42
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.96  E-value=2.5e-29  Score=187.58  Aligned_cols=74  Identities=54%  Similarity=0.836  Sum_probs=71.1

Q ss_pred             CccCcchhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhcCchhHHHhhhhCCCCch
Q psy4517          13 SGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRNIYDTYGSLGLY   86 (109)
Q Consensus        13 ~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~hPDk~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~~   86 (109)
                      ..+|||+||||+++||.+|||+|||+|+++||||+++.+++|.++|++|++||+||+||++|+.||+||+....
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~   75 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFK   75 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccc
Confidence            46899999999999999999999999999999999997899999999999999999999999999999998876



>KOG0713|consensus Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0724|consensus Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>KOG3442|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-39
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-17
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 5e-17
3apq_A 210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 3e-15
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-15
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 4e-15
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 4e-15
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 8e-15
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-14
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-14
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-14
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 6e-14
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 2e-13
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 2e-13
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-12
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 3e-11
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 7e-11
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 2e-10
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 3e-07
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-06
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 5e-06
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 8e-05
1xi5_J114 Clathrin D6 Coat With Auxilin J-Domain Length = 114 1e-04
1nz6_A101 Crystal Structure Of Auxilin J-Domain Length = 101 2e-04
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 2e-04
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 3e-04
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 4e-04
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 4e-04
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure

Iteration: 1

Score = 157 bits (396), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 72/95 (75%), Positives = 84/95 (88%) Query: 7 RRKMSTSGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHS 66 +R +STSG+SLY +L L K AT ++IKK YRK+ALKYHPDKNP+NPEAA+KFKEIN AH+ Sbjct: 9 QRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHA 68 Query: 67 TLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFM 101 L+D TKRNIYD YGSLGLYVAEQFGEENVNTYF+ Sbjct: 69 ILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV 103
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|1XI5|J Chain J, Clathrin D6 Coat With Auxilin J-Domain Length = 114 Back     alignment and structure
>pdb|1NZ6|A Chain A, Crystal Structure Of Auxilin J-Domain Length = 101 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 8e-51
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 5e-33
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-32
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-32
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-32
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 4e-32
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 5e-32
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 7e-32
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-31
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 4e-31
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 5e-31
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 2e-30
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 5e-30
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-29
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 4e-29
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-28
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-28
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 3e-28
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-26
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 4e-26
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-25
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-25
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-24
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-23
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-17
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-16
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 9e-16
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-15
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-15
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 6e-14
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 2e-13
2guz_A71 Mitochondrial import inner membrane translocase su 9e-12
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 2e-11
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 1e-10
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
 Score =  154 bits (392), Expect = 8e-51
 Identities = 72/96 (75%), Positives = 84/96 (87%)

Query: 6   PRRKMSTSGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAH 65
            +R +STSG+SLY +L L K AT ++IKK YRK+ALKYHPDKNP+NPEAA+KFKEIN AH
Sbjct: 8   RQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAH 67

Query: 66  STLSDQTKRNIYDTYGSLGLYVAEQFGEENVNTYFM 101
           + L+D TKRNIYD YGSLGLYVAEQFGEENVNTYF+
Sbjct: 68  AILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV 103


>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.95
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.92
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.91
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.91
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.91
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.91
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.9
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.9
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.9
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.9
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.9
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.89
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.89
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.89
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.88
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.88
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.88
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.85
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.84
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.83
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.83
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.83
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.82
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.81
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.8
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.8
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.8
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.77
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.77
2guz_A71 Mitochondrial import inner membrane translocase su 99.76
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.74
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.74
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.72
2guz_B65 Mitochondrial import inner membrane translocase su 99.27
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.27
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 92.45
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
Probab=99.95  E-value=1.1e-27  Score=152.06  Aligned_cols=99  Identities=73%  Similarity=1.141  Sum_probs=91.4

Q ss_pred             CCCCCCCCccCcchhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhcCchhHHHhhhhCCCCc
Q psy4517           6 PRRKMSTSGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRNIYDTYGSLGL   85 (109)
Q Consensus         6 ~~~~~~~~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~hPDk~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~   85 (109)
                      ..|.++....++|+||||+++++.++||++|+++++++|||++++.+++.+.|++|++||++|+||.+|..||.++..+.
T Consensus         8 ~~r~~~~~~~~~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   87 (109)
T 2ctw_A            8 RQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGL   87 (109)
T ss_dssp             CCCCTTSCSCCHHHHHTCCTTCCHHHHHHHHHHHHHHSCTTTSTTCHHHHHHHHHHHHHHHHHTCHHHHHHHHHTCHHHH
T ss_pred             CCcccCCCCCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHcCHHHHHHHHHhccccc
Confidence            45667888899999999999999999999999999999999998778899999999999999999999999999999998


Q ss_pred             hhhhhhccccchhhhhhcc
Q psy4517          86 YVAEQFGEENVNTYFMVTS  104 (109)
Q Consensus        86 ~~~~~~~~~~~~~~~~~~~  104 (109)
                      .....++.+++..||...+
T Consensus        88 ~~~~~~~~~~~~~~~~~~~  106 (109)
T 2ctw_A           88 YVAEQFGEENVNTYFVSGP  106 (109)
T ss_dssp             HHHHHTCTTHHHHHHHSSS
T ss_pred             ccccccCCcchHHHhhcCC
Confidence            8888899999999986544



>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 3e-18
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 7e-18
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-17
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-16
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-14
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-14
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 9e-12
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-10
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 71.1 bits (174), Expect = 3e-18
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 13 SGDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPE---AAEKFKEINRAHSTLS 69
          +G++ +  + +    TPE++KK YRK  L  HPDK    P    A   F E+N A S   
Sbjct: 31 AGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFE 90

Query: 70 DQTKRNIY 77
          +Q ++ +Y
Sbjct: 91 NQGQKPLY 98


>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.95
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.9
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.88
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.83
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.82
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.75
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]
Probab=99.95  E-value=8.4e-28  Score=142.10  Aligned_cols=72  Identities=46%  Similarity=0.784  Sum_probs=68.2

Q ss_pred             ccCcchhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhcCchhHHHhhhhCCCCc
Q psy4517          14 GDSLYVILELPKTATPEEIKKQYRKMALKYHPDKNPNNPEAAEKFKEINRAHSTLSDQTKRNIYDTYGSLGL   85 (109)
Q Consensus        14 ~~~~y~iLgv~~~as~~eIk~ayr~l~~~~hPDk~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~   85 (109)
                      .+|||+||||++++|.++||+||+++++++|||++++.+.+.+.|..|++||+||+||.+|..||.+|..++
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            479999999999999999999999999999999998778888999999999999999999999999997765



>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure