Psyllid ID: psy4533

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
IVLDEPTGKNDGTVGGFRYFQCDPKHGIFSRLNRLTRSPLLHLSDRPTSRNSSVDEGRYSPFKKSSFDGLYSRKSSDGGLFSRTSPEDISTASPVSECSPLSAKYPSPPCKPQATHSSPLYSMDSTDSFIIGDRVYVGGTIPGKIAYIGETKFGPGDWAGKNRLDEPDRARIRHCPRASAISNAIRSTAIFSRLNALTRSPSPTSLGPPPHPRQFFSRPKAATHLTIQEVPHLMVSTQGNPSHGRLPTLSEDEIRLGDRVIIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSKSPVQASGHASKNCVVHPSKDIPTYFYSF
cEEcccccccccEEccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEEEEcccccccccEEEEEEcccccccccEEccEEEEEcccccEEEEccccEEEcccccccccccccccccccccccccccc
cccccccccEccEEccEEccccccccEEEEcccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccEEEEcccccEEEEEEcccccccccEEEEccccccccccccccccEEEEEEccccccEEcccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccEEEEEcccccEEEEEEEEEccccccccEEEEEEccccccEccEEccEEccccccccEEEccccEEEEccccccccccccccccccccccccEEcc
ivldeptgkndgtvggfryfqcdpkhgifsrlnrltrspllhlsdrptsrnssvdegryspfkkssfdglysrkssdgglfsrtspedistaspvsecsplsakypsppckpqathssplysmdstdsfiigdrvyvggtipgkiayigetkfgpgdwagknrldepdrarirhcprasaiSNAIRSTAIFSRlnaltrspsptslgppphprqffsrpkaathltiqevphlmvstqgnpshgrlptlsedeirlgdrvIIRNEIRLGDRVIirssqgsksgvlkykgdtyfadgewcgvelddplgkndgsvdgvryfyceprfgvfapvskvskspvqasghaskncvvhpskdiptyfysf
ivldeptgkndgtvggFRYFQCDPKHGIFSRLNRltrspllhlsdrptsrnssvdegryspfkkssfdglysrkssdgglfsrtspedistaspVSECSPLSAKYPSPPCKPQATHSSPLYSMDSTDSFIIGDRVYVGGTIPGKIAYigetkfgpgdwaGKNRLDEPDRARIRHcprasaisnairsTAIFSRLNALTRSPSPTSLGPPPHPRQFFSRPKAATHLTIQEVPHLMvstqgnpshgrlptlsedeirlgDRVIirneirlgdrviirssqgsksgvlkYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSKSPVqasghaskncvvhpskdiptyfysf
IVLDEPTGKNDGTVGGFRYFQCDPKHGIFSRLNRLTRSPLLHLSDRPTSRNSSVDEGRYSPFKKSSFDGLYSRKSSDGGLFSRTSPEDISTASPVSECSPLSAKYPSPPCKPQATHSSPLYSMDSTDSFIIGDRVYVGGTIPGKIAYIGETKFGPGDWAGKNRLDEPDRARIRHCPRASAISNAIRSTAIFSRLNALTRspsptslgppphpRQFFSRPKAATHLTIQEVPHLMVSTQGNPSHGRLPTLSEDEIRLGDRVIIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSKSPVQASGHASKNCVVHPSKDIPTYFYSF
************TVGGFRYFQCDPKHGIFSRLNRLT******************************************************************************************DSFIIGDRVYVGGTIPGKIAYIGETKFGPGDWAGK**********IRHCPRASAISNAIRSTAIFSR***********************************************************EIRLGDRVIIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVS****************CVV*******TYF***
IVLDEPTGKNDGTVGGFRYFQCDPKHGIFSRLNRLTRSP********************************************************************************LYSMDSTDSFII****************************************************************************************************HLMVSTQGNPSHGRLPTLSEDEIRLGDRVIIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPV*********************************
IVLDEPTGKNDGTVGGFRYFQCDPKHGIFSRLNRLTRSPLLHLSD************RYSPFKKSSFDGLYSRKSSDGGLFSR*********************************SSPLYSMDSTDSFIIGDRVYVGGTIPGKIAYIGETKFGPGDWAGKNRLDEPDRARIRHCPRASAISNAIRSTAIFSRLNALTRS***********PRQFFSRPKAATHLTIQEVPHLMVSTQGNPSHGRLPTLSEDEIRLGDRVIIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSK*************KNCVVHPSKDIPTYFYSF
IVLDEPTGKNDGTVGGFRYFQCDPKHGIFSRLNRL******************************************************************************************TDSFIIGDRVYVGGTIPGKIAYIGETKFGPGDWAGKNRLDEPDRARIRHCPRASAISNAIRSTAIFSRLNALTRS****************************************************************EIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSKSP**************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IVLDEPTGKNDGTVGGFRYFQCDPKHGIFSRLNRLTRSPLLHLSDRPTSRNSSVDEGRYSPFKKSSFDGLYSRKSSDGGLFSRTSPEDISTASPVSECSPLSAKYPSPPCKPQATHSSPLYSMDSTDSFIIGDRVYVGGTIPGKIAYIGETKFGPGDWAGKNRLDEPDRARIRHCPRASAISNAIRSTAIFSRLNALTRSPSPTSLGPPPHPRQFFSRPKAATHLTIQEVPHLMVSTQGNPSHGRLPTLSEDEIRLGDRVIIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSKSPVQASGHASKNCVVHPSKDIPTYFYSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
Q9VJE5 1690 Restin homolog OS=Drosoph yes N/A 0.550 0.118 0.392 1e-37
P30622 1438 CAP-Gly domain-containing yes N/A 0.709 0.180 0.328 2e-35
Q9UDT6 1046 CAP-Gly domain-containing no N/A 0.528 0.184 0.398 4e-35
Q922J3 1391 CAP-Gly domain-containing yes N/A 0.547 0.143 0.382 2e-34
Q9Z0H8 1047 CAP-Gly domain-containing no N/A 0.528 0.184 0.398 2e-34
O55156 1046 CAP-Gly domain-containing yes N/A 0.528 0.184 0.398 3e-34
O42184 1433 CAP-Gly domain-containing yes N/A 0.542 0.138 0.402 1e-32
Q5R686547 CAP-Gly domain-containing no N/A 0.509 0.340 0.318 4e-21
Q96DZ5547 CAP-Gly domain-containing no N/A 0.509 0.340 0.318 7e-21
Q5U243 534 CAP-Gly domain-containing N/A N/A 0.320 0.219 0.427 7e-20
>sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster GN=CLIP-190 PE=1 SV=1 Back     alignment and function desciption
 Score =  157 bits (397), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 88/224 (39%), Positives = 120/224 (53%), Gaps = 23/224 (10%)

Query: 125 STDSFIIGDRVYVGGTIPGKIAYIGETKFGPGDWAGKNRLDEPDRARIRHCPRASAISNA 184
           +T+ FIIG RV++GGT PG+IA+IG+T F  G+WAG   LDEP+  +   C         
Sbjct: 119 NTEQFIIGQRVWLGGTRPGQIAFIGDTHFAAGEWAGV-VLDEPN-GKNDGCVSGKRYFQC 176

Query: 185 IRSTAIFSRLNALTRSPSPTSLGPPPHPRQFFSRPKAATHLTIQEVPHLMVSTQGNPSHG 244
                IFSRL  LT  P    L     P    ++       T+     +  S   +P  G
Sbjct: 177 EPKRGIFSRLTRLTTYP----LAGAQTPTSPLAKSSPDRSRTVSPTASIRSSMLRSPGIG 232

Query: 245 RLPTLSEDEIRLGDRVIIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELD 304
                             +N + +GDRVI+ S  GS+ G+L+Y G+T FA G WCGVELD
Sbjct: 233 G-----------------KNGMAVGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELD 275

Query: 305 DPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSKSPVQASGHASK 348
           +P GKNDG+VD +RYF C+P++GVF P++KVS SP       S+
Sbjct: 276 EPSGKNDGTVDDIRYFECKPKYGVFVPIAKVSLSPSSKKTRLSR 319
Together CLIP-190 and jar may coordinate the interaction between the actin and microtubule cytoskeleton. May link endocytic vesicles to microtubules. May play a role in formation of furrows during cellularization.
Drosophila melanogaster (taxid: 7227)
>sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 Back     alignment and function description
>sp|Q9UDT6|CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens GN=CLIP2 PE=1 SV=1 Back     alignment and function description
>sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus GN=Clip2 PE=1 SV=2 Back     alignment and function description
>sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus GN=Clip2 PE=1 SV=1 Back     alignment and function description
>sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R686|CLIP3_PONAB CAP-Gly domain-containing linker protein 3 OS=Pongo abelii GN=CLIP3 PE=2 SV=1 Back     alignment and function description
>sp|Q96DZ5|CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens GN=CLIP3 PE=1 SV=3 Back     alignment and function description
>sp|Q5U243|CLIP3_XENLA CAP-Gly domain-containing linker protein 3 OS=Xenopus laevis GN=clip3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
328779692 1608 PREDICTED: restin homolog [Apis mellifer 0.561 0.127 0.476 4e-49
242012652 1640 retiin, putative [Pediculus humanus corp 0.580 0.129 0.476 2e-47
357608006 1816 putative restin [Danaus plexippus] 0.567 0.113 0.438 2e-46
307197537 1595 Restin-like protein [Harpegnathos saltat 0.630 0.144 0.428 8e-46
328794497325 PREDICTED: restin homolog [Apis mellifer 0.561 0.630 0.476 9e-45
328705330 1883 PREDICTED: hypothetical protein LOC10016 0.578 0.112 0.431 1e-44
383860638 1566 PREDICTED: CAP-Gly domain-containing lin 0.542 0.126 0.464 2e-44
322790005 1584 hypothetical protein SINV_05857 [Solenop 0.542 0.125 0.481 2e-43
326509893313 predicted protein [Hordeum vulgare subsp 0.586 0.683 0.428 5e-43
345494045 1659 PREDICTED: CAP-Gly domain-containing lin 0.498 0.109 0.457 7e-43
>gi|328779692|ref|XP_396089.4| PREDICTED: restin homolog [Apis mellifera] Back     alignment and taxonomy information
 Score =  201 bits (511), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 111/233 (47%), Positives = 138/233 (59%), Gaps = 28/233 (12%)

Query: 124 DSTDSFIIGDRVYVGGTIPGKIAYIGETKFGPGDWAGKNRLDEP---DRARIRHCPRASA 180
           + TDSFIIGDRV+VGGT PG IAYIGET+F PGDWAG   LDEP   +   +  C     
Sbjct: 45  EDTDSFIIGDRVWVGGTKPGAIAYIGETQFAPGDWAGV-VLDEPIGKNDGSVAGCRYFQC 103

Query: 181 ISNAIRSTAIFSRLNALTRSPSPTSLGPPPHPRQFFSRPKAATHLTIQEVPHLMVSTQGN 240
                    IFSRL  LTR+P P +    P  +   S P                S++G+
Sbjct: 104 EPK----RGIFSRLTRLTRTPLPDTTDASPTQKTPTSPPD---------------SSKGS 144

Query: 241 PSHGRLPTLSEDEIRLGDRVIIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCG 300
            S    P+L+     L   V  R ++R+GDRVI+ SSQGSK+GVL+Y G T FA GEWCG
Sbjct: 145 LSKSMSPSLNASMTSLSSTVSQR-DLRIGDRVIVSSSQGSKTGVLRYYGTTEFAVGEWCG 203

Query: 301 VELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSKSPVQASGHASKNCVVH 353
           VELDDP+GKNDGSV+  RYF C P++G+FAP  KVS+SP         +C+VH
Sbjct: 204 VELDDPIGKNDGSVNDKRYFECRPKYGLFAPAHKVSRSPTS----KRSSCMVH 252

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242012652|ref|XP_002427043.1| retiin, putative [Pediculus humanus corporis] gi|212511291|gb|EEB14305.1| retiin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357608006|gb|EHJ65776.1| putative restin [Danaus plexippus] Back     alignment and taxonomy information
>gi|307197537|gb|EFN78767.1| Restin-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328794497|ref|XP_001122870.2| PREDICTED: restin homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|328705330|ref|XP_001948099.2| PREDICTED: hypothetical protein LOC100160993 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383860638|ref|XP_003705796.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322790005|gb|EFZ15081.1| hypothetical protein SINV_05857 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|326509893|dbj|BAJ87162.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|345494045|ref|XP_001606131.2| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
FB|FBgn0020503 1690 CLIP-190 "Cytoplasmic linker p 0.210 0.045 0.597 4.1e-37
UNIPROTKB|E1BGH3 1047 CLIP2 "Uncharacterized protein 0.695 0.242 0.355 2.2e-33
UNIPROTKB|Q9UDT6 1046 CLIP2 "CAP-Gly domain-containi 0.706 0.246 0.348 7.5e-33
RGD|67404 1320 Clip1 "CAP-GLY domain containi 0.665 0.184 0.369 1.4e-32
UNIPROTKB|F1MAH8 1320 Clip1 "Protein Clip1" [Rattus 0.665 0.184 0.369 1.4e-32
UNIPROTKB|J9P0I9 702 CLIP2 "Uncharacterized protein 0.712 0.370 0.343 9.1e-32
UNIPROTKB|E1BQI8 1040 CLIP2 "Uncharacterized protein 0.712 0.25 0.336 4.9e-31
MGI|MGI:1928401 1391 Clip1 "CAP-GLY domain containi 0.660 0.173 0.355 1e-30
RGD|62019 1046 Clip2 "CAP-GLY domain containi 0.638 0.222 0.358 1e-30
MGI|MGI:1313136 1047 Clip2 "CAP-GLY domain containi 0.641 0.223 0.352 1e-30
FB|FBgn0020503 CLIP-190 "Cytoplasmic linker protein 190" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 274 (101.5 bits), Expect = 4.1e-37, Sum P(2) = 4.1e-37
 Identities = 46/77 (59%), Positives = 62/77 (80%)

Query:   263 RNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYC 322
             +N + +GDRVI+ S  GS+ G+L+Y G+T FA G WCGVELD+P GKNDG+VD +RYF C
Sbjct:   234 KNGMAVGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFEC 293

Query:   323 EPRFGVFAPVSKVSKSP 339
             +P++GVF P++KVS SP
Sbjct:   294 KPKYGVFVPIAKVSLSP 310
GO:0008017 "microtubule binding" evidence=ISS;IDA
GO:0005875 "microtubule associated complex" evidence=ISS;IDA
GO:0003779 "actin binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005938 "cell cortex" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0007349 "cellularization" evidence=IMP
GO:0007017 "microtubule-based process" evidence=ISS
GO:0045169 "fusome" evidence=IDA
GO:0005876 "spindle microtubule" evidence=IDA
GO:0051010 "microtubule plus-end binding" evidence=IDA
GO:0000776 "kinetochore" evidence=IDA
GO:0035371 "microtubule plus end" evidence=IDA
UNIPROTKB|E1BGH3 CLIP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UDT6 CLIP2 "CAP-Gly domain-containing linker protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|67404 Clip1 "CAP-GLY domain containing linker protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAH8 Clip1 "Protein Clip1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0I9 CLIP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQI8 CLIP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1928401 Clip1 "CAP-GLY domain containing linker protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|62019 Clip2 "CAP-GLY domain containing linker protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1313136 Clip2 "CAP-GLY domain containing linker protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
pfam0130267 pfam01302, CAP_GLY, CAP-Gly domain 1e-26
smart0105268 smart01052, CAP_GLY, Cytoskeleton-associated prote 6e-24
COG5244 669 COG5244, NIP100, Dynactin complex subunit involved 5e-19
pfam0130267 pfam01302, CAP_GLY, CAP-Gly domain 2e-13
smart0105268 smart01052, CAP_GLY, Cytoskeleton-associated prote 5e-11
COG5244 669 COG5244, NIP100, Dynactin complex subunit involved 2e-06
smart0105268 smart01052, CAP_GLY, Cytoskeleton-associated prote 3e-05
pfam0130267 pfam01302, CAP_GLY, CAP-Gly domain 8e-05
>gnl|CDD|216424 pfam01302, CAP_GLY, CAP-Gly domain Back     alignment and domain information 
 Score =  100 bits (251), Expect = 1e-26
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 2/69 (2%)

Query: 268 LGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFG 327
           +GDRV +    G + G ++Y G   FA G W GVELD+P GKNDGSVDGVRYF C P++G
Sbjct: 1   VGDRVEV--LGGGRRGTVRYVGPVPFAPGLWVGVELDEPRGKNDGSVDGVRYFECPPKYG 58

Query: 328 VFAPVSKVS 336
           +F   SKV 
Sbjct: 59  IFVRPSKVE 67

Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved motif, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of Caenorhabditis elegans F53F4.3 protein CAP-Gly domain was recently solved. The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove. Length = 67
>gnl|CDD|214997 smart01052, CAP_GLY, Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network Back     alignment and domain information
>gnl|CDD|227569 COG5244, NIP100, Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|216424 pfam01302, CAP_GLY, CAP-Gly domain Back     alignment and domain information
>gnl|CDD|214997 smart01052, CAP_GLY, Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network Back     alignment and domain information
>gnl|CDD|227569 COG5244, NIP100, Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|214997 smart01052, CAP_GLY, Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network Back     alignment and domain information
>gnl|CDD|216424 pfam01302, CAP_GLY, CAP-Gly domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
KOG4568|consensus 664 99.94
KOG3206|consensus234 99.92
PF0130269 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytos 99.91
KOG4568|consensus 664 99.86
COG5244 669 NIP100 Dynactin complex subunit involved in mitoti 99.76
PF0130269 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytos 99.71
KOG0971|consensus 1243 99.68
KOG3207|consensus 505 99.61
KOG3206|consensus234 99.59
COG5244 669 NIP100 Dynactin complex subunit involved in mitoti 99.39
KOG0971|consensus 1243 99.37
KOG3556|consensus 724 99.09
KOG3207|consensus 505 99.03
KOG0241|consensus1714 98.97
KOG3556|consensus 724 98.07
KOG0241|consensus1714 97.77
PRK1070862 hypothetical protein; Provisional 94.41
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 94.29
PTZ00243 1560 ABC transporter; Provisional 93.29
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 87.96
PRK1070862 hypothetical protein; Provisional 87.43
>KOG4568|consensus Back     alignment and domain information 
Probab=99.94  E-value=6e-28  Score=255.01  Aligned_cols=199  Identities=43%  Similarity=0.709  Sum_probs=146.0

Q ss_pred             cCCCCCCceeCcEEEECCcccEEEEEeeeCCCCCCceEEEeeccCCCC--------eeEEecCCCCcccccccceeEEEe
Q psy4533         122 SMDSTDSFIIGDRVYVGGTIPGKIAYIGETKFGPGDWAGKNRLDEPDR--------ARIRHCPRASAISNAIRSTAIFSR  193 (365)
Q Consensus       122 ~~~~~~~~~vG~rV~v~g~~~G~vryiG~~~~~~G~W~GVeelDep~G--------~rYF~C~~~~~~~~~~p~~G~Fvr  193 (365)
                      ..+....++||++|||++..+|.|||+|+++|++|+|+|| +||+|.|        +|||.|.+         ..|+|.+
T Consensus        11 q~~~~~~~~ig~~v~v~~~~~G~v~y~G~t~f~~G~w~Gv-eL~~p~GKNdGsv~G~rYF~ce~---------~kgif~~   80 (664)
T KOG4568|consen   11 QLDDLGQFIIGRRVWVNNVELGFVRYAGETDFAKGIWAGV-ELLEPKGKNDGSVHGKRYFQCEP---------KKGIFFR   80 (664)
T ss_pred             hhhhhhhhhhcceEEecCCcceeeeeccCcccccceeece-eeccccCCCCcccchhhhhcccc---------ccceeec
Confidence            3466789999999999998899999999999999999999 8999975        99999999         9999999


Q ss_pred             CCceeecCCCCCC-CCCCCC-cccccCCccccc---cccccccccccccCCC---CCCCCCCCCchhhhhccccccccCC
Q psy4533         194 LNALTRSPSPTSL-GPPPHP-RQFFSRPKAATH---LTIQEVPHLMVSTQGN---PSHGRLPTLSEDEIRLGDRVIIRNE  265 (365)
Q Consensus       194 ~skV~k~~~~~~t-~~~dst-rs~~s~~k~~~~---~~~~~~~~~~~s~~~~---~~~~s~p~~s~~~~~~~~~~~~~~~  265 (365)
                      ..+......+... .+++.+ .++.+. ..+..   +...+.. ++.+-...   ++..+.+++++    .+........
T Consensus        81 ~~~~t~~~~~~~q~~~~~~~~~~~~~~-~~~~~~sp~~~~~ip-~~~s~~~~~~kss~~s~s~~~~----~~~s~~~~~~  154 (664)
T KOG4568|consen   81 QGRGTASKNEKGQSSPPPSVPNSRLSS-AAAASTSPNLQSSIP-LLASLSNTIVKSSLESYSTLSS----TGKSPTSMLG  154 (664)
T ss_pred             ccccccccccccccCCCCCCCchhhcc-ccccccCcccccccc-ccccccccccccccCCCCCccc----ccccccCccc
Confidence            9988877665432 233322 222222 11111   0111110 01110000   00001111111    1222355788


Q ss_pred             CccCCEEEEEcCCCCceEEEEEeccccCCCCceEEEEecCCCCCCCceECCEEeeecCCCCeeeEecCCcccCC
Q psy4533         266 IRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSKSP  339 (365)
Q Consensus       266 l~VGdRV~V~~~~g~~~GtVRyiG~~~~~~G~wvGVELDep~GknDGsv~G~rYF~C~p~~GiFV~~~kV~~~~  339 (365)
                      +.|||||.+.   ++..|++||+|.+.|+.|-|+|||||+|.|+|||++.+++||+|++.||+|.+.++|.+..
T Consensus       155 l~v~dr~l~~---gq~~~~~r~~~~t~fa~g~w~~~elde~~~~~d~sv~k~~~~~~k~ky~~f~~v~kv~~~~  225 (664)
T KOG4568|consen  155 LRVGDRVLVG---GQKSGTLRYSGHTKFASGSWLGVELDEPVGKNDGSVGKVRYFQCKPKYGKFAPVQKVFKIE  225 (664)
T ss_pred             cccccceeec---CcccchhhhhccccccCCcccchhcccccccccccccccccccCcchhcchhHHHHHhhcc
Confidence            9999999995   6899999999999999999999999999999999999999999999999999999998873

>KOG3206|consensus Back     alignment and domain information
>PF01302 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytoskeleton-associated proteins (CAP) are made of three distinct parts, an N-terminal section that is most probably globular and contains the CAP-Gly domain, a large central region predicted to be in an alpha-helical coiled-coil conformation and, finally, a short C-terminal globular domain Back     alignment and domain information
>KOG4568|consensus Back     alignment and domain information
>COG5244 NIP100 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>PF01302 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytoskeleton-associated proteins (CAP) are made of three distinct parts, an N-terminal section that is most probably globular and contains the CAP-Gly domain, a large central region predicted to be in an alpha-helical coiled-coil conformation and, finally, a short C-terminal globular domain Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>COG5244 NIP100 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>KOG3556|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>KOG3556|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
2cp6_A172 Solution Structure Of The 2nd Cap-Gly Domain In Hum 2e-24
2e3h_A90 Crystal Structure Of The Clip-170 Cap-Gly Domain 2 6e-23
2e4h_A98 Solution Structure Of Cytoskeletal Protein In Compl 8e-23
2cp3_A84 Solution Structure Of The 2nd Cap-Gly Domain In Hum 1e-21
2cp0_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 4e-20
1whj_A102 Solution Structure Of The 1st Cap-Gly Domain In Mou 8e-19
2cp5_A141 Solution Structure Of The 1st Cap-Gly Domain In Hum 3e-16
2e3i_A86 Crystal Structure Of The Clip-170 Cap-Gly Domain 1 6e-16
2z0w_A96 Crystal Structure Of The 2nd Cap-Gly Domain In Huma 8e-16
1whh_A102 Solution Structure Of The 2nd Cap-Gly Domain In Mou 1e-15
3rdv_A72 Structure Of The Slain2c-Clipcg1 Complex Length = 7 2e-15
2coz_A122 Solution Structure Of The Cap-Gly Domain In Human C 2e-15
2cp7_A84 Solution Structure Of The 1st Cap-Gly Domain In Mou 4e-15
2qk0_A74 Structural Basis Of Microtubule Plus End Tracking B 6e-15
2cp2_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 4e-14
1tov_A98 Structural Genomics Of Caenorhabditis Elegans: Cap- 7e-12
1lpl_A95 Structural Genomics Of Caenorhabditis Elegans: Cap- 9e-12
1whg_A113 Solution Structure Of The Cap-Gly Domain In Mouse T 1e-11
2cow_A100 Solution Structure Of The Cap-Gly Domain In Human K 3e-10
2coy_A112 Solution Structure Of The Cap-Gly Domain In Human D 1e-09
2hkn_A97 Crystal Structure Of The Cap-Gly Domain Of Human Dy 2e-09
2hl3_A97 Crystal Structure Of The A49m Mutant Cap-Gly Domain 3e-09
3tq7_P71 Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Do 3e-09
1txq_A93 Crystal Structure Of The Eb1 C-Terminal Domain Comp 2e-08
1whk_A91 Solution Structure Of The 3rd Cap-Gly Domain In Mou 2e-08
4b6m_A84 Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gl 3e-07
>pdb|2CP6|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 170RESTIN Length = 172 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 81/120 (67%), Gaps = 15/120 (12%)
Query: 246 LPTLSE-DEIRLGDRVIIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELD 304
           +  LSE   I+ G+R     E+++GDRV++    G+K+GV+++ G+T FA GEWCGVELD
Sbjct: 23  ISNLSEAGSIKKGER-----ELKIGDRVLV---GGTKAGVVRFLGETDFAKGEWCGVELD 74
Query: 305 DPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSK------SPVQASGHASKNCVVHPSKDI 358
           +PLGKNDG+V G RYF C+P++G+FAPV KV+K      +P +A  +A +  +   S  +
Sbjct: 75  EPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVMATTSASL 134
>pdb|2E3H|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 2 Length = 90 Back     alignment and structure
>pdb|2E4H|A Chain A, Solution Structure Of Cytoskeletal Protein In Complex With Tubulin Tail Length = 98 Back     alignment and structure
>pdb|2CP3|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 115CYLN2 Length = 84 Back     alignment and structure
>pdb|2CP0|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170-Related Protein Clipr59 Length = 95 Back     alignment and structure
>pdb|1WHJ|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 102 Back     alignment and structure
>pdb|2CP5|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170RESTIN Length = 141 Back     alignment and structure
>pdb|2E3I|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 1 Length = 86 Back     alignment and structure
>pdb|2Z0W|A Chain A, Crystal Structure Of The 2nd Cap-Gly Domain In Human Restin- Like Protein 2 Reveals A Swapped-Dimer Length = 96 Back     alignment and structure
>pdb|1WHH|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Mouse Clip170-Related 59kda Protein Clipr-59 Length = 102 Back     alignment and structure
>pdb|3RDV|A Chain A, Structure Of The Slain2c-Clipcg1 Complex Length = 72 Back     alignment and structure
>pdb|2COZ|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Centrosome-Associated Protein Cap350 Length = 122 Back     alignment and structure
>pdb|2CP7|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse Clip- 170RESTIN Length = 84 Back     alignment and structure
>pdb|2QK0|A Chain A, Structural Basis Of Microtubule Plus End Tracking By Xmap215, Clip-170 And Eb1 Length = 74 Back     alignment and structure
>pdb|2CP2|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 115CYLN2 Length = 95 Back     alignment and structure
>pdb|1TOV|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 98 Back     alignment and structure
>pdb|1LPL|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 95 Back     alignment and structure
>pdb|1WHG|A Chain A, Solution Structure Of The Cap-Gly Domain In Mouse Tubulin Specific Chaperone B Length = 113 Back     alignment and structure
>pdb|2COW|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Kinesin- Like Protein Kif13b Length = 100 Back     alignment and structure
>pdb|2COY|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Dynactin 1 Length = 112 Back     alignment and structure
>pdb|2HKN|A Chain A, Crystal Structure Of The Cap-Gly Domain Of Human Dynactin-1 (P150- Glued) Length = 97 Back     alignment and structure
>pdb|2HL3|A Chain A, Crystal Structure Of The A49m Mutant Cap-Gly Domain Of Human Dynactin-1 (P150-Glued) In Complex With Human Eb1 C- Terminal Hexapeptide Length = 97 Back     alignment and structure
>pdb|3TQ7|P Chain P, Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Domain Of P150glued Length = 71 Back     alignment and structure
>pdb|1TXQ|A Chain A, Crystal Structure Of The Eb1 C-Terminal Domain Complexed With The Cap-Gly Domain Of P150glued Length = 93 Back     alignment and structure
>pdb|1WHK|A Chain A, Solution Structure Of The 3rd Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 91 Back     alignment and structure
>pdb|4B6M|A Chain A, Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gly Domain Length = 84 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 6e-31
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 1e-15
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 2e-09
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 2e-29
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 1e-14
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 5e-09
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 6e-29
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 1e-13
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 9e-07
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 8e-29
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 4e-14
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 8e-08
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 1e-28
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 2e-14
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 1e-08
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 2e-28
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 6e-14
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 5e-07
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 2e-28
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 1e-14
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 2e-09
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 2e-28
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 2e-13
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 3e-09
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 3e-28
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 3e-13
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 3e-09
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 4e-28
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 2e-14
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 9e-08
1txq_A93 Dynactin 1; protein complex, structural protein/pr 5e-28
1txq_A93 Dynactin 1; protein complex, structural protein/pr 2e-13
1txq_A93 Dynactin 1; protein complex, structural protein/pr 1e-06
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 2e-27
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 1e-13
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 2e-08
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 4e-27
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 2e-13
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 1e-07
2coz_A122 CAP350, centrosome-associated protein 350; microtu 9e-27
2coz_A122 CAP350, centrosome-associated protein 350; microtu 8e-13
2coz_A122 CAP350, centrosome-associated protein 350; microtu 1e-07
1whg_A113 Tubulin specific chaperone B; microtubule binding, 2e-26
1whg_A113 Tubulin specific chaperone B; microtubule binding, 8e-13
1whg_A113 Tubulin specific chaperone B; microtubule binding, 6e-04
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 2e-26
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 1e-12
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 4e-07
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 6e-26
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 2e-12
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 6e-09
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 3e-24
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 5e-11
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 1e-05
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 2e-23
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 4e-11
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 3e-22
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 2e-11
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 5e-07
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 1e-14
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Length = 72 Back     alignment and structure
 Score =  111 bits (279), Expect = 6e-31
 Identities = 36/74 (48%), Positives = 54/74 (72%), Gaps = 3/74 (4%)

Query: 264 NEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCE 323
           ++ R+G+RV +    G+K G +++ G+T FA G+W G+ LD+P+GKNDGSV GVRYF CE
Sbjct: 1   DDFRVGERVWV---NGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCE 57

Query: 324 PRFGVFAPVSKVSK 337
           P  G+F   SK+++
Sbjct: 58  PLKGIFTRPSKLTR 71
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Length = 72 Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Length = 72 Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Length = 86 Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Length = 86 Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Length = 86 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Length = 95 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Length = 95 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Length = 95 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Length = 90 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Length = 90 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Length = 90 Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 84 Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 84 Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 84 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 91 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 91 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 91 Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Length = 95 Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Length = 95 Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Length = 95 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 96 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 96 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 96 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Length = 93 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Length = 93 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Length = 93 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 100 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 100 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 100 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 122 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 122 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 122 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Length = 113 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Length = 113 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Length = 113 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 112 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 112 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 112 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 141 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 141 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 141 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 104 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 104 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 104 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 172 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 172 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 172 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 99.94
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.94
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 99.94
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.93
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 99.93
4b6m_A84 Tubulin-specific chaperone, putative; structural p 99.93
1txq_A93 Dynactin 1; protein complex, structural protein/pr 99.93
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.93
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 99.93
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.93
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 99.93
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 99.93
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 99.93
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.93
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 99.93
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 99.93
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 99.92
2coz_A122 CAP350, centrosome-associated protein 350; microtu 99.92
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 99.92
1whg_A113 Tubulin specific chaperone B; microtubule binding, 99.92
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 99.92
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.91
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 99.83
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 99.83
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 99.83
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.83
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 99.83
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 99.83
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.82
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 99.82
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 99.81
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.81
4b6m_A84 Tubulin-specific chaperone, putative; structural p 99.81
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.81
1txq_A93 Dynactin 1; protein complex, structural protein/pr 99.8
2coz_A122 CAP350, centrosome-associated protein 350; microtu 99.8
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 99.8
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 99.79
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 99.79
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 99.79
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 99.79
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.77
1whg_A113 Tubulin specific chaperone B; microtubule binding, 99.77
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.63
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Back     alignment and structure
Probab=99.94  E-value=2.6e-27  Score=185.97  Aligned_cols=70  Identities=51%  Similarity=1.079  Sum_probs=66.5

Q ss_pred             CCccCCEEEEEcCCCCceEEEEEeccccCCCCceEEEEecCCCCCCCceECCEEeeecCCCCeeeEecCCccc
Q psy4533         265 EIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSK  337 (365)
Q Consensus       265 ~l~VGdRV~V~~~~g~~~GtVRyiG~~~~~~G~wvGVELDep~GknDGsv~G~rYF~C~p~~GiFV~~~kV~~  337 (365)
                      +|+||+||+|.   +..+|+|||+|++++++|.|+|||||+|.|||||+++|+|||+|+|+||+||++++|++
T Consensus         2 ~~~vG~rv~v~---g~~~G~VryvG~~~~~~g~w~GVeld~p~GkndGsv~G~rYF~c~p~~G~Fv~~~kvsr   71 (72)
T 3rdv_A            2 DFRVGERVWVN---GNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTR   71 (72)
T ss_dssp             CCCTTCEEEET---TTEEEEEEEEECCSSSSSCEEEEEESSSCSSBSSEETTEESCCCSTTCEEEECGGGEEC
T ss_pred             CcccCCEEEEC---CCCEEEEEEeeeCCCCCceEEEEEECCCCCccCCEECCEEeCccCCCCEEEecHHHccc
Confidence            58999999995   45799999999999999999999999999999999999999999999999999999976
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>4b6m_A Tubulin-specific chaperone, putative; structural protein; 1.59A {Trypanosoma brucei} Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Back     alignment and structure
>4b6m_A Tubulin-specific chaperone, putative; structural protein; 1.59A {Trypanosoma brucei} Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d2e3ha171 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapien 1e-26
d2e3ha171 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapien 4e-14
d2e3ha171 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapien 2e-06
d2cp0a183 b.34.10.1 (A:7-89) CLIP170-related 59kda protein C 2e-26
d2cp0a183 b.34.10.1 (A:7-89) CLIP170-related 59kda protein C 6e-14
d2cp0a183 b.34.10.1 (A:7-89) CLIP170-related 59kda protein C 9e-08
d2coza1109 b.34.10.1 (A:8-116) Centrosome-associated protein 2e-26
d2coza1109 b.34.10.1 (A:8-116) Centrosome-associated protein 5e-13
d2coza1109 b.34.10.1 (A:8-116) Centrosome-associated protein 3e-09
d2e3ia171 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) 4e-26
d2e3ia171 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) 4e-14
d2e3ia171 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) 1e-07
d1tova_98 b.34.10.1 (A:) Cytoskeleton-associated protein F53 9e-26
d1tova_98 b.34.10.1 (A:) Cytoskeleton-associated protein F53 2e-12
d1tova_98 b.34.10.1 (A:) Cytoskeleton-associated protein F53 9e-07
d2cowa188 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Hu 2e-25
d2cowa188 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Hu 1e-13
d2cowa188 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Hu 6e-07
d1whha_102 b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR 6e-25
d1whha_102 b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR 2e-12
d1whha_102 b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR 5e-06
d1whja_102 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 3e-24
d1whja_102 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 2e-12
d1whja_102 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 3e-06
d1whka_91 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 4e-24
d1whka_91 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 1e-12
d1whka_91 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 0.001
d2hqha172 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapien 9e-24
d2hqha172 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapien 2e-12
d2hqha172 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapien 5e-04
d1whga_113 b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1 2e-23
d1whga_113 b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1 2e-11
d1whma_92 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 4e-21
d1whma_92 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 1e-08
d2cp6a1160 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [ 1e-20
d2cp6a1160 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [ 2e-11
d2cp6a1160 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [ 3e-04
d1whla_95 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 9e-20
d1whla_95 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 7e-10
d1ixda_104 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 1e-19
d1ixda_104 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 1e-10
d1ixda_104 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 4e-05
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: CLIP-115
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 99.0 bits (247), Expect = 1e-26
 Identities = 43/72 (59%), Positives = 61/72 (84%), Gaps = 3/72 (4%)

Query: 266 IRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPR 325
           +++GDRV++    G+K+GV+++ G+T FA GEWCGVELD+PLGKNDG+V G RYF C+P+
Sbjct: 1   LKIGDRVLV---GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPK 57

Query: 326 FGVFAPVSKVSK 337
           +G+FAPV KV+K
Sbjct: 58  YGLFAPVHKVTK 69
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 98 Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 98 Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 98 Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 91 Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 91 Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 91 Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d2cp0a183 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.94
d2e3ia171 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2e3ha171 CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2hqha172 Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1whha_102 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.93
d2cowa188 Kinesin-like protein kif13b {Human (Homo sapiens) 99.93
d2cp6a1160 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2coza1109 Centrosome-associated protein 350 {Human (Homo sap 99.93
d1whja_102 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.93
d1whka_91 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.93
d1tova_98 Cytoskeleton-associated protein F53F4.3 {Caenorhab 99.92
d1whga_113 Tubulin-specific chaperone B (SKAP1) {Mouse (Mus m 99.92
d1ixda_104 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.91
d1whla_95 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.9
d1whma_92 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.9
d2cp6a1160 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2cp0a183 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.82
d2coza1109 Centrosome-associated protein 350 {Human (Homo sap 99.81
d2cowa188 Kinesin-like protein kif13b {Human (Homo sapiens) 99.81
d1whja_102 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.81
d2e3ia171 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d2e3ha171 CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1whha_102 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.8
d1whka_91 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.79
d2hqha172 Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1tova_98 Cytoskeleton-associated protein F53F4.3 {Caenorhab 99.75
d1whga_113 Tubulin-specific chaperone B (SKAP1) {Mouse (Mus m 99.73
d1ixda_104 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.73
d1whla_95 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.64
d1whma_92 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.64
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=5.4e-28  Score=192.67  Aligned_cols=77  Identities=57%  Similarity=1.032  Sum_probs=71.4

Q ss_pred             cccCCCccCCEEEEEcCCCCceEEEEEeccccCCCCceEEEEecCCCCCCCceECCEEeeecCCCCeeeEecCCcccCCC
Q psy4533         261 IIRNEIRLGDRVIIRSSQGSKSGVLKYKGDTYFADGEWCGVELDDPLGKNDGSVDGVRYFYCEPRFGVFAPVSKVSKSPV  340 (365)
Q Consensus       261 ~~~~~l~VGdRV~V~~~~g~~~GtVRyiG~~~~~~G~wvGVELDep~GknDGsv~G~rYF~C~p~~GiFV~~~kV~~~~~  340 (365)
                      .....|+|||||+|.   +..+|+|||+|++++++|+|+|||||+|.|||||+++|+|||+|+|+||+||++++|.+..+
T Consensus         6 ~s~~~l~vG~rV~v~---~~~~G~vryvG~~~~~~g~~vGVElD~p~GkndGt~~G~rYF~C~~~~G~Fv~~~~v~~~~d   82 (83)
T d2cp0a1           6 LSALGLRLGDRVLLD---GQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKISKAVD   82 (83)
T ss_dssp             HHHHTCCTTCEEEET---TTEEEEEEEEECCSSSCSCEEEEEESSSCCSBCSEETTEECCCCSSSCEEEECGGGEEECSC
T ss_pred             EEecCCccCCEEEEC---CCceEEEEEeeecCCCCCcEEEEEECCCCCCCCCEECCEEEeecCCCceEEcCHHHccccCC
Confidence            345689999999995   45789999999999999999999999999999999999999999999999999999998765
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure