Psyllid ID: psy4661


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------6
MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDRN
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
cccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
mvkwshctvffragvlgqmeELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDRN
mvkwshctvffragvlgqmeelRDDRLGKIVGWMQSYmrgylsrkeykkiqeqrycdrn
MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDRN
**KWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYK***********
MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDR*
MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKI*********
MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDRN
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query59 2.2.26 [Sep-21-2011]
P05661 1962 Myosin heavy chain, muscl yes N/A 0.915 0.027 0.685 1e-15
P24733 1938 Myosin heavy chain, stria N/A N/A 0.779 0.023 0.630 1e-10
P04461 736 Myosin-7 (Fragment) OS=Or yes N/A 0.881 0.070 0.538 2e-09
P49824 1935 Myosin-7 OS=Canis familia yes N/A 0.881 0.026 0.538 3e-09
P12883 1935 Myosin-7 OS=Homo sapiens yes N/A 0.881 0.026 0.519 6e-09
Q28641 1938 Myosin-4 OS=Oryctolagus c no N/A 0.881 0.026 0.5 6e-09
Q5SX40 1942 Myosin-1 OS=Mus musculus no N/A 0.881 0.026 0.5 7e-09
Q9BE39 1935 Myosin-7 OS=Bos taurus GN yes N/A 0.881 0.026 0.519 7e-09
P02564 1935 Myosin-7 OS=Rattus norveg no N/A 0.881 0.026 0.519 7e-09
P13540 1934 Myosin-7 OS=Mesocricetus N/A N/A 0.881 0.026 0.519 7e-09
>sp|P05661|MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster GN=Mhc PE=1 SV=4 Back     alignment and function desciption
 Score = 82.0 bits (201), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/54 (68%), Positives = 45/54 (83%)

Query: 1   MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQR 54
           + +  H  VFFRAGVLGQMEE RD+RLGKI+ WMQ++ RGYLSRK +KK+QEQR
Sbjct: 754 LYRLGHTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQR 807




Muscle contraction.
Drosophila melanogaster (taxid: 7227)
>sp|P24733|MYS_ARGIR Myosin heavy chain, striated muscle OS=Argopecten irradians PE=1 SV=1 Back     alignment and function description
>sp|P04461|MYH7_RABIT Myosin-7 (Fragment) OS=Oryctolagus cuniculus GN=MYH7 PE=2 SV=1 Back     alignment and function description
>sp|P49824|MYH7_CANFA Myosin-7 OS=Canis familiaris GN=MYH7 PE=1 SV=3 Back     alignment and function description
>sp|P12883|MYH7_HUMAN Myosin-7 OS=Homo sapiens GN=MYH7 PE=1 SV=5 Back     alignment and function description
>sp|Q28641|MYH4_RABIT Myosin-4 OS=Oryctolagus cuniculus GN=MYH4 PE=2 SV=1 Back     alignment and function description
>sp|Q5SX40|MYH1_MOUSE Myosin-1 OS=Mus musculus GN=Myh1 PE=1 SV=1 Back     alignment and function description
>sp|Q9BE39|MYH7_BOVIN Myosin-7 OS=Bos taurus GN=MYH7 PE=2 SV=1 Back     alignment and function description
>sp|P02564|MYH7_RAT Myosin-7 OS=Rattus norvegicus GN=Myh7 PE=2 SV=2 Back     alignment and function description
>sp|P13540|MYH7_MESAU Myosin-7 OS=Mesocricetus auratus GN=MYH7 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query59
307190725 1076 Myosin heavy chain, muscle [Camponotus f 0.881 0.048 0.788 1e-17
183979376 1965 muscle myosin heavy chain [Papilio xuthu 0.881 0.026 0.807 1e-16
307212786 2228 Myosin heavy chain, muscle [Harpegnathos 0.881 0.023 0.788 2e-16
189239933 1960 PREDICTED: similar to Myosin heavy chain 1.0 0.030 0.682 2e-16
189239929 1960 PREDICTED: similar to Myosin heavy chain 1.0 0.030 0.682 2e-16
189239937 1960 PREDICTED: similar to Myosin heavy chain 1.0 0.030 0.682 2e-16
189239927 1960 PREDICTED: similar to Myosin heavy chain 0.915 0.027 0.741 3e-16
340718032 1968 PREDICTED: myosin heavy chain, muscle-li 0.881 0.026 0.769 6e-16
270011842 2287 hypothetical protein TcasGA2_TC005924 [T 0.864 0.022 0.763 9e-16
322786872 2417 hypothetical protein SINV_00390 [Solenop 0.796 0.019 0.829 1e-15
>gi|307190725|gb|EFN74640.1| Myosin heavy chain, muscle [Camponotus floridanus] Back     alignment and taxonomy information
 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/52 (78%), Positives = 47/52 (90%)

Query: 3    KWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQR 54
            +  H  VFFRAGVLGQMEELRD+RLGKIV WMQ+Y+RGYLSRK+YKK+QEQR
Sbjct: 960  RMGHTKVFFRAGVLGQMEELRDERLGKIVSWMQAYIRGYLSRKDYKKLQEQR 1011




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|183979376|dbj|BAG30740.1| muscle myosin heavy chain [Papilio xuthus] Back     alignment and taxonomy information
>gi|307212786|gb|EFN88457.1| Myosin heavy chain, muscle [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|189239933|ref|XP_001813779.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 4 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189239929|ref|XP_001813306.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189239937|ref|XP_001814083.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 6 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340718032|ref|XP_003397476.1| PREDICTED: myosin heavy chain, muscle-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|270011842|gb|EFA08290.1| hypothetical protein TcasGA2_TC005924 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322786872|gb|EFZ13136.1| hypothetical protein SINV_00390 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query59
FB|FBgn0264695 1962 Mhc "Myosin heavy chain" [Dros 0.915 0.027 0.685 1.5e-14
UNIPROTKB|F1PDF4 1659 MYH7 "Myosin-7" [Canis lupus f 0.881 0.031 0.538 5.2e-09
UNIPROTKB|E2RJD1 1791 MYH7 "Myosin-7" [Canis lupus f 0.881 0.029 0.538 5.7e-09
UNIPROTKB|P49824 1935 MYH7 "Myosin-7" [Canis lupus f 0.881 0.026 0.538 6.2e-09
ZFIN|ZDB-GENE-991123-5 1938 vmhc "ventricular myosin heavy 0.881 0.026 0.538 8e-09
UNIPROTKB|P12883 1935 MYH7 "Myosin-7" [Homo sapiens 0.881 0.026 0.519 1.3e-08
UNIPROTKB|F1MM07 1933 F1MM07 "Uncharacterized protei 0.881 0.026 0.519 1.7e-08
UNIPROTKB|F1S9D6 1934 MYH7 "Myosin-7" [Sus scrofa (t 0.881 0.026 0.519 1.7e-08
UNIPROTKB|Q9BE39 1935 MYH7 "Myosin-7" [Bos taurus (t 0.881 0.026 0.519 1.7e-08
UNIPROTKB|P79293 1935 MYH7 "Myosin-7" [Sus scrofa (t 0.881 0.026 0.519 1.7e-08
FB|FBgn0264695 Mhc "Myosin heavy chain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 202 (76.2 bits), Expect = 1.5e-14, P = 1.5e-14
 Identities = 37/54 (68%), Positives = 45/54 (83%)

Query:     1 MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQR 54
             + +  H  VFFRAGVLGQMEE RD+RLGKI+ WMQ++ RGYLSRK +KK+QEQR
Sbjct:   754 LYRLGHTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQR 807




GO:0006941 "striated muscle contraction" evidence=TAS
GO:0005863 "striated muscle myosin thick filament" evidence=IDA
GO:0008307 "structural constituent of muscle" evidence=IMP;TAS
GO:0005859 "muscle myosin complex" evidence=ISS;IDA
GO:0030017 "sarcomere" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0006936 "muscle contraction" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
GO:0000146 "microfilament motor activity" evidence=ISS
GO:0005703 "polytene chromosome puff" evidence=IDA
GO:0007517 "muscle organ development" evidence=IMP
GO:0042623 "ATPase activity, coupled" evidence=ISS
GO:0016459 "myosin complex" evidence=ISS
GO:0030241 "skeletal muscle myosin thick filament assembly" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0030239 "myofibril assembly" evidence=IMP
GO:0007527 "adult somatic muscle development" evidence=IMP
GO:0030898 "actin-dependent ATPase activity" evidence=IDA
GO:0042692 "muscle cell differentiation" evidence=IMP
GO:0007298 "border follicle cell migration" evidence=IMP
GO:0060361 "flight" evidence=IMP
GO:0007427 "epithelial cell migration, open tracheal system" evidence=IMP
GO:0031672 "A band" evidence=IDA
GO:0050821 "protein stabilization" evidence=IMP
GO:0045214 "sarcomere organization" evidence=IMP
GO:0031033 "myosin filament organization" evidence=IMP
UNIPROTKB|F1PDF4 MYH7 "Myosin-7" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJD1 MYH7 "Myosin-7" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P49824 MYH7 "Myosin-7" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-991123-5 vmhc "ventricular myosin heavy chain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P12883 MYH7 "Myosin-7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MM07 F1MM07 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9D6 MYH7 "Myosin-7" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BE39 MYH7 "Myosin-7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P79293 MYH7 "Myosin-7" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P04461MYH7_RABITNo assigned EC number0.53840.88130.0706yesN/A
P79293MYH7_PIGNo assigned EC number0.51920.88130.0268yesN/A
P05661MYSA_DROMENo assigned EC number0.68510.91520.0275yesN/A
P12883MYH7_HUMANNo assigned EC number0.51920.88130.0268yesN/A
P49824MYH7_CANFANo assigned EC number0.53840.88130.0268yesN/A
Q9BE39MYH7_BOVINNo assigned EC number0.51920.88130.0268yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query59
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 5e-07
cd01377693 cd01377, MYSc_type_II, Myosin motor domain, type I 3e-04
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
 Score = 43.9 bits (104), Expect = 5e-07
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 9   VFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEY-KKIQEQRYCDRN 59
           VFF+AGVL  +E++RD +L  I   +Q  +RG   R+ Y + ++  +     
Sbjct: 726 VFFKAGVLAALEDMRDAKLDNIATRIQRAIRGRYLRRRYLQALKRIKKIQVI 777


Length = 1463

>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 59
KOG0164|consensus 1001 99.49
COG5022 1463 Myosin heavy chain [Cytoskeleton] 99.49
KOG0162|consensus 1106 99.42
KOG0161|consensus 1930 99.41
PTZ00014821 myosin-A; Provisional 99.41
KOG0160|consensus 862 99.05
KOG0163|consensus 1259 98.51
PF0061221 IQ: IQ calmodulin-binding motif; InterPro: IPR0000 98.28
cd01384674 MYSc_type_XI Myosin motor domain, plant-specific t 98.26
cd01386767 MYSc_type_XVIII Myosin motor domain, type XVIII my 97.96
cd01378674 MYSc_type_I Myosin motor domain, type I myosins. M 97.95
smart00242677 MYSc Myosin. Large ATPases. ATPase; molecular moto 97.94
cd01383677 MYSc_type_VIII Myosin motor domain, plant-specific 97.93
cd01377693 MYSc_type_II Myosin motor domain, type II myosins. 97.91
cd01382717 MYSc_type_VI Myosin motor domain, type VI myosins. 97.9
cd01380691 MYSc_type_V Myosin motor domain, type V myosins. M 97.87
smart0001526 IQ Short calmodulin-binding motif containing conse 97.86
cd01387677 MYSc_type_XV Myosin motor domain, type XV myosins. 97.86
cd01379653 MYSc_type_III Myosin motor domain, type III myosin 97.8
cd01381671 MYSc_type_VII Myosin motor domain, type VII myosin 97.76
cd00124679 MYSc Myosin motor domain. This catalytic (head) do 97.69
cd01385692 MYSc_type_IX Myosin motor domain, type IX myosins. 97.32
KOG4427|consensus 1096 91.46
KOG0942|consensus 1001 87.33
KOG0160|consensus 862 82.43
>KOG0164|consensus Back     alignment and domain information
Probab=99.49  E-value=8.4e-14  Score=98.62  Aligned_cols=58  Identities=29%  Similarity=0.513  Sum_probs=55.0

Q ss_pred             Ccccccceeecc-cchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Q psy4661           1 MVKWSHCTVFFR-AGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDR   58 (59)
Q Consensus         1 ~~q~G~TKVF~r-~~~~~~LE~~r~~~l~~~~~~iQ~~~rg~~~r~~~~~~~~~~~~~~   58 (59)
                      |+.+|+||||+| +.+++.||+.|..++..+++.||+.||||++|.+|+++++....|+
T Consensus       668 d~a~G~TKIFIRsPrTLF~lEe~r~~~l~~lvtllQK~~RG~~~R~ry~rmka~~~ii~  726 (1001)
T KOG0164|consen  668 DVAFGRTKIFIRSPRTLFALEEQRAERLPSLVTLLQKAWRGWLARQRYRRMKASATIIR  726 (1001)
T ss_pred             hhhcCceeEEEecchhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            578999999999 5899999999999999999999999999999999999999988775



>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>KOG4427|consensus Back     alignment and domain information
>KOG0942|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query59
2os8_A840 Rigor-Like Structures Of Muscle Myosins Reveal Key 5e-13
1qvi_A840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 6e-13
1kk7_A837 Scallop Myosin In The Near Rigor Conformation Lengt 6e-13
1b7t_A835 Myosin Digested By Papain Length = 835 6e-13
1dfl_A831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 6e-13
1dfk_A830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 6e-13
2ec6_A838 Placopecten Striated Muscle Myosin Ii Length = 838 6e-13
3i5g_A839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 9e-13
2w4g_M840 Isometrically Contracting Insect Asynchronous Fligh 7e-10
2mys_A843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 7e-09
1m8q_A840 Molecular Models Of Averaged Rigor Crossbridges Fro 7e-09
3pn7_A69 Visualizing New Hinges And A Potential Major Source 9e-07
1br1_A820 Smooth Muscle Myosin Motor Domain-Essential Light C 4e-06
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 7e-06
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 7e-06
3j04_A909 Em Structure Of The Heavy Meromyosin Subfragment Of 7e-06
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 9e-06
3jtd_A65 Calcium-Free Scallop Myosin Regulatory Domain With 3e-05
1wdc_A64 Scallop Myosin Regulatory Domain Length = 64 4e-05
4db1_A783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 4e-04
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure

Iteration: 1

Score = 69.3 bits (168), Expect = 5e-13, Method: Composition-based stats. Identities = 29/46 (63%), Positives = 39/46 (84%) Query: 9 VFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQR 54 VFF+AGVLG +EE+RD+RL KI+ Q+++RGYL RK YKK+Q+QR Sbjct: 762 VFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQR 807
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|3PN7|A Chain A, Visualizing New Hinges And A Potential Major Source Of Compliance In The Lever Arm Of Myosin Length = 69 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|3JTD|A Chain A, Calcium-Free Scallop Myosin Regulatory Domain With Elc-D19a Point Mutation Length = 65 Back     alignment and structure
>pdb|1WDC|A Chain A, Scallop Myosin Regulatory Domain Length = 64 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query59
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 3e-16
1w7j_A795 Myosin VA; motor protein, unconventional myosin, m 2e-15
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-14
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 2e-12
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-12
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-11
2v26_A784 Myosin VI; calmodulin-binding, nucleotide-binding, 9e-08
1wdc_A64 Scallop myosin; calcium binding protein, muscle pr 1e-07
4db1_A783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 2e-06
2bl0_A63 Major plasmodial myosin heavy chain; muscle protei 2e-06
1w9i_A770 Myosin II heavy chain; molecular motor, ATPase, mo 1e-04
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
 Score = 69.3 bits (170), Expect = 3e-16
 Identities = 29/46 (63%), Positives = 39/46 (84%)

Query: 9   VFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQR 54
           VFF+AGVLG +EE+RD+RL KI+   Q+++RGYL RK YKK+Q+QR
Sbjct: 760 VFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQR 805


>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A Length = 64 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 63 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query59
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 99.65
1w7j_A795 Myosin VA; motor protein, unconventional myosin, m 99.64
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.55
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 99.52
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 99.46
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 98.87
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 98.74
1wdc_A64 Scallop myosin; calcium binding protein, muscle pr 98.64
2v26_A784 Myosin VI; calmodulin-binding, nucleotide-binding, 98.57
1w9i_A770 Myosin II heavy chain; molecular motor, ATPase, mo 98.41
4db1_A783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 98.35
2bl0_A63 Major plasmodial myosin heavy chain; muscle protei 98.32
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 98.23
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 98.19
1lkx_A697 Myosin IE heavy chain; myosin motor domain, lever 98.1
1n2d_C48 IQ2 and IQ3 motifs from MYO2P, A class V myosin; p 97.91
1n2d_C48 IQ2 and IQ3 motifs from MYO2P, A class V myosin; p 97.38
3gn4_A148 Myosin-VI; unconventional myosin, motility, lever 96.87
2l53_B31 CAM, voltage-gated sodium channel type V alpha iso 96.34
2kxw_B27 Sodium channel protein type 2 subunit alpha; actio 96.31
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.25
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 85.06
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 80.34
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
Probab=99.65  E-value=2.7e-16  Score=111.19  Aligned_cols=57  Identities=51%  Similarity=0.842  Sum_probs=53.6

Q ss_pred             CcccccceeecccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCD   57 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r~~~l~~~~~~iQ~~~rg~~~r~~~~~~~~~~~~~   57 (59)
                      +|++|+||||||+++++.||++|+..+..+++.||+.||||++|++|.+++.++.|+
T Consensus       752 ~~~~G~TKVF~r~~~~~~LE~~r~~~l~~~~~~iQa~~Rg~l~R~~~~k~~~~r~a~  808 (837)
T 1kk8_A          752 EYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGL  808 (837)
T ss_dssp             GEEECSSEEEECTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ceeecCEEEEehhhHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            589999999999999999999999999999999999999999999999997776654



>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} Back     alignment and structure
>2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 59
d2mysa2794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 4e-14
d1kk8a2789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 8e-14
d1w7ja2730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 4e-13
d1d0xa2712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 0.001
d1br2a2710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 0.002
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]
 Score = 62.0 bits (150), Expect = 4e-14
 Identities = 23/46 (50%), Positives = 35/46 (76%)

Query: 9   VFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQR 54
           VFF+AG+LG +EE+RDD+L +I+   Q+  RG+L R EY+ + E+R
Sbjct: 716 VFFKAGLLGLLEEMRDDKLAEIITATQARCRGFLMRVEYRAMVERR 761


>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query59
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 99.63
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 99.62
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 99.59
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 98.12
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 97.95
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 97.8
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 88.86
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 83.65
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Bay scallop (Aequipecten irradians) [TaxId: 31199]
Probab=99.63  E-value=2.7e-16  Score=108.73  Aligned_cols=57  Identities=51%  Similarity=0.842  Sum_probs=53.8

Q ss_pred             CcccccceeecccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCD   57 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r~~~l~~~~~~iQ~~~rg~~~r~~~~~~~~~~~~~   57 (59)
                      +|++|+||||||++++..||+.|+..+..+++.||+.||||++|++|++++.++.|+
T Consensus       704 ~~qiGkTkVFlr~~~~~~LE~~r~~~l~~~~~~IQ~~~R~~~~Rk~y~k~r~~~~ai  760 (789)
T d1kk8a2         704 EYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGL  760 (789)
T ss_dssp             GEEECSSEEEECTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hEEecCCEEEEChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            599999999999999999999999999999999999999999999999999876654



>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure