Psyllid ID: psy4773

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MGQTDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGSLKGSSDVEEYNGAYYFGSPISKHLARVPLAK
cccccccccEEEEEEEcccccccEEEEccccccccccEEccccccEEEEEEEccccccHHHHHHHccccHHHHHHHHHHHHHcccccccHHcccccEEEEEEEccccEEEEEEcccccEEEEEEccccccccEEEEEEEccEEEEEcccccEEEEEEccc
cccHHHHHHHHHHEEHcccccccEEEEEcccccccccccccccccEEEEEEEccccccccHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccEEEEEEcccccEEEEEEcccccEEEEEEEEEEccEEEEEccccccEEEEEccc
mgqtdycnfsfwryylkgpkqgksevfidglpglpdnvkrdskgnflvslvcpvdeytpqllhiigpfpNIRKFVARFLHLLekipsedvkhvvGHFESILFLQGTRYTLLVISSQGEIVDALHSvdgslkgssdveeyngayyfgspiskhlarvplak
mgqtdycnfSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGSLKGSSDVEEYNGAYyfgspiskhlarvplak
MGQTDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGSLKGSSDVEEYNGAYYFGSPISKHLARVPLAK
****DYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGSLK***DVEEYNGAYYFGSPIS**********
*GQTDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGSLKGSSDVEEYNGAYYFGSPISKHLARVPLA*
MGQTDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGSLKGSSDVEEYNGAYYFGSPISKHLARVPLAK
**QTDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGSLKGSSDVEEYNGAYYFGSPISKHLARVPLAK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQTDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGSLKGSSDVEEYNGAYYFGSPISKHLARVPLAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query160 2.2.26 [Sep-21-2011]
Q803F5415 Adipocyte plasma membrane no N/A 0.8 0.308 0.274 4e-08
Q3T0E5412 Adipocyte plasma membrane yes N/A 0.806 0.313 0.263 6e-07
Q5ZIF1415 Adipocyte plasma membrane yes N/A 0.8 0.308 0.261 1e-06
B5X3B2416 Adipocyte plasma membrane N/A N/A 0.818 0.314 0.273 1e-06
Q9HDC9416 Adipocyte plasma membrane yes N/A 0.806 0.310 0.270 1e-05
Q7TP48376 Adipocyte plasma membrane yes N/A 0.806 0.343 0.25 3e-05
Q9D7N9415 Adipocyte plasma membrane yes N/A 0.806 0.310 0.25 4e-05
>sp|Q803F5|APMAP_DANRE Adipocyte plasma membrane-associated protein OS=Danio rerio GN=apmap PE=2 SV=1 Back     alignment and function desciption
 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 71/153 (46%), Gaps = 25/153 (16%)

Query: 13  RYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIR 72
           R ++ G  +G  + FI+ LPG PDN++R S G + V++          +L  +   P ++
Sbjct: 282 RVHVSGLNKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAVRPNPGFSMLDFLSQRPWLK 341

Query: 73  KFVARFLH---LLEKIPSEDVKHVVGHFESILFLQGTRYTLLV-ISSQGEIVDALHSVDG 128
           K + +      LL+ +P                    RY+L+V + S G  V + H   G
Sbjct: 342 KLIFKLFSQDTLLKFVP--------------------RYSLVVELQSDGTCVRSFHDPQG 381

Query: 129 SLKG-SSDVEEYNGAYYFGSPISKHLARVPLAK 160
            +   SS+  EY+G  Y GS  S +L ++ L+K
Sbjct: 382 LVSAYSSEAHEYSGHLYLGSFRSPYLCKLDLSK 414

Danio rerio (taxid: 7955)
>sp|Q3T0E5|APMAP_BOVIN Adipocyte plasma membrane-associated protein OS=Bos taurus GN=APMAP PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIF1|APMAP_CHICK Adipocyte plasma membrane-associated protein OS=Gallus gallus GN=APMAP PE=2 SV=1 Back     alignment and function description
>sp|B5X3B2|APMAP_SALSA Adipocyte plasma membrane-associated protein OS=Salmo salar GN=apmap PE=2 SV=1 Back     alignment and function description
>sp|Q9HDC9|APMAP_HUMAN Adipocyte plasma membrane-associated protein OS=Homo sapiens GN=APMAP PE=1 SV=2 Back     alignment and function description
>sp|Q7TP48|APMAP_RAT Adipocyte plasma membrane-associated protein OS=Rattus norvegicus GN=Apmap PE=2 SV=2 Back     alignment and function description
>sp|Q9D7N9|APMAP_MOUSE Adipocyte plasma membrane-associated protein OS=Mus musculus GN=Apmap PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
215541377 423 putative hemomucin [Schistocerca gregari 0.925 0.349 0.433 3e-31
91087333 503 PREDICTED: similar to hemomucin [Triboli 0.925 0.294 0.459 1e-29
270011245 486 hypothetical protein TcasGA2_TC030782, p 0.925 0.304 0.459 1e-29
312372558 1138 hypothetical protein AND_19995 [Anophele 0.918 0.129 0.433 3e-25
158287631 595 AGAP004065-PA [Anopheles gambiae str. PE 0.918 0.247 0.415 9e-25
156551049 544 PREDICTED: adipocyte plasma membrane-ass 0.918 0.270 0.406 1e-24
195054786 562 GH24144 [Drosophila grimshawi] gi|193896 0.912 0.259 0.418 4e-23
157112566 610 hemomucin [Aedes aegypti] gi|108878013|g 0.912 0.239 0.406 4e-23
195144136 555 GL23916 [Drosophila persimilis] gi|19410 0.912 0.263 0.425 6e-23
198451279 553 GA17412 [Drosophila pseudoobscura pseudo 0.912 0.264 0.425 8e-23
>gi|215541377|emb|CAT00690.1| putative hemomucin [Schistocerca gregaria] Back     alignment and taxonomy information
 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 102/159 (64%), Gaps = 11/159 (6%)

Query: 13  RYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIR 72
           RYYLKG K+G +++F+D LPG PDN+  D  G++ V+L  P D+  P   HII  +P +R
Sbjct: 245 RYYLKGAKKGSNDIFVDKLPGFPDNLSHDGNGSYFVALAFPADKDHPAFNHIISEYPVLR 304

Query: 73  KFVARFLHLLEK--------IPSEDVK---HVVGHFESILFLQGTRYTLLVISSQGEIVD 121
           KF+AR L LLE          P+  VK   H +GHFES+ F++  R+TLL +   G++++
Sbjct: 305 KFLARLLGLLEMPFQFIERFYPNYYVKRATHWIGHFESVRFMEPKRFTLLRLGKDGKVLE 364

Query: 122 ALHSVDGSLKGSSDVEEYNGAYYFGSPISKHLARVPLAK 160
           ++H +DG+L G SDV E+  A YFGSP + ++ R+ L K
Sbjct: 365 SMHCLDGTLSGISDVVEFEDALYFGSPYNTYIGRIKLEK 403

Source: Schistocerca gregaria

Species: Schistocerca gregaria

Genus: Schistocerca

Family: Acrididae

Order: Orthoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91087333|ref|XP_975599.1| PREDICTED: similar to hemomucin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270011245|gb|EFA07693.1| hypothetical protein TcasGA2_TC030782, partial [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312372558|gb|EFR20495.1| hypothetical protein AND_19995 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158287631|ref|XP_309617.4| AGAP004065-PA [Anopheles gambiae str. PEST] gi|157019515|gb|EAA05338.5| AGAP004065-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|156551049|ref|XP_001605615.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195054786|ref|XP_001994304.1| GH24144 [Drosophila grimshawi] gi|193896174|gb|EDV95040.1| GH24144 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|157112566|ref|XP_001657568.1| hemomucin [Aedes aegypti] gi|108878013|gb|EAT42238.1| AAEL006196-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195144136|ref|XP_002013052.1| GL23916 [Drosophila persimilis] gi|194101995|gb|EDW24038.1| GL23916 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198451279|ref|XP_001358307.2| GA17412 [Drosophila pseudoobscura pseudoobscura] gi|198131415|gb|EAL27445.2| GA17412 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
FB|FBgn0015737 582 Hmu "Hemomucin" [Drosophila me 0.912 0.250 0.413 3.9e-21
FB|FBgn0041780411 Ssl2 "Strictosidine synthase-l 0.9 0.350 0.371 1.1e-20
WB|WBGene00007438338 C08E8.2 [Caenorhabditis elegan 0.775 0.366 0.323 3.8e-13
WB|WBGene00010197387 F57C2.5.2 [Caenorhabditis eleg 0.775 0.320 0.335 2.6e-12
ZFIN|ZDB-GENE-081022-75432 zgc:194209 "zgc:194209" [Danio 0.743 0.275 0.297 4.1e-11
TAIR|locus:2201841390 SSL3 "strictosidine synthase-l 0.825 0.338 0.300 1.8e-09
TAIR|locus:504956439395 AT5G22020 [Arabidopsis thalian 0.8 0.324 0.315 1.9e-09
ZFIN|ZDB-GENE-020919-1415 apmap "adipocyte plasma membra 0.806 0.310 0.289 5.4e-08
UNIPROTKB|E2RPE9415 APMAP "Uncharacterized protein 0.812 0.313 0.265 1.1e-07
UNIPROTKB|Q3T0E5412 APMAP "Adipocyte plasma membra 0.812 0.315 0.258 2.4e-07
FB|FBgn0015737 Hmu "Hemomucin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 256 (95.2 bits), Expect = 3.9e-21, P = 3.9e-21
 Identities = 67/162 (41%), Positives = 90/162 (55%)

Query:    13 RYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIR 72
             +Y+LKG K G+SEVF+DGLPGLPDN+  D++G + V LV   D   P    +   FP++R
Sbjct:   253 KYHLKGAKAGQSEVFVDGLPGLPDNLTPDAEGIW-VPLVQSADSEHPNGFTLFTRFPSVR 311

Query:    73 KFVARFLHLLEKIP------------SEDVKHVVGHFESILFLQGTRYTLLVISSQGEIV 120
              F+AR L L E +P            S+   H VGH ESI  L   R T++ +   G IV
Sbjct:   312 LFLARMLALFE-LPFRYLNSVYPNKFSQRFIHFVGHMESITVLAPKRTTVVRVDWNGNIV 370

Query:   121 DALHSVDGSLKGSSDVEEYNGAYYFGSPISKHLARV--PLAK 160
              +LH  D S    S V E+    + GSP +++LARV  P AK
Sbjct:   371 GSLHGFDKSAATISHVLEFQDFLFLGSPTNQYLARVKSPKAK 412
GO:0009986 "cell surface" evidence=IDA
GO:0003729 "mRNA binding" evidence=NAS
GO:0004872 "receptor activity" evidence=NAS
GO:0004252 "serine-type endopeptidase activity" evidence=NAS
GO:0016844 "strictosidine synthase activity" evidence=IEA
GO:0009058 "biosynthetic process" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
FB|FBgn0041780 Ssl2 "Strictosidine synthase-like 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00007438 C08E8.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00010197 F57C2.5.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081022-75 zgc:194209 "zgc:194209" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2201841 SSL3 "strictosidine synthase-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956439 AT5G22020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020919-1 apmap "adipocyte plasma membrane associated protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPE9 APMAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0E5 APMAP "Adipocyte plasma membrane-associated protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 160
KOG1520|consensus376 100.0
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.11
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.0
KOG4499|consensus310 98.02
COG4257 353 Vgb Streptogramin lyase [Defense mechanisms] 96.3
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 95.81
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 95.12
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.71
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 91.91
COG3386 307 Gluconolactonase [Carbohydrate transport and metab 89.94
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 87.87
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 85.4
PF0749424 Reg_prop: Two component regulator propeller; Inter 84.19
PF05787524 DUF839: Bacterial protein of unknown function (DUF 82.84
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 82.62
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 82.17
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 80.09
>KOG1520|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.3e-40  Score=277.38  Aligned_cols=141  Identities=33%  Similarity=0.603  Sum_probs=123.5

Q ss_pred             cccCCCcEEEEEEecCCCCCcceEecccCCCCCCceeecCCCCeEEEeecCCCCcChhhhhhcCCChHHHHHHHHhhhhh
Q psy4773           3 QTDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLL   82 (160)
Q Consensus         3 ~~Et~~~Ri~Ry~l~G~k~G~~evfid~LPG~PDNI~~~~~G~fWval~~~r~~~~~~~~~~l~~~P~lRk~i~~l~~~~   82 (160)
                      +|||+++||+||||+|+|+|++|+|++|||||||||+++++|+||||+.+.|+    .+.+++.+|||+||++.++|..+
T Consensus       235 ~~Et~~~ri~rywi~g~k~gt~EvFa~~LPG~PDNIR~~~~G~fWVal~~~~~----~~~~~~~~~p~vr~~~~~~~~~~  310 (376)
T KOG1520|consen  235 VAETTTARIKRYWIKGPKAGTSEVFAEGLPGYPDNIRRDSTGHFWVALHSKRS----TLWRLLMKYPWVRKFIAKLPKYM  310 (376)
T ss_pred             EEeeccceeeeeEecCCccCchhhHhhcCCCCCcceeECCCCCEEEEEecccc----hHHHhhhcChHHHHHHHhhccch
Confidence            79999999999999999999999999999999999999999999999999854    48999999999999999998765


Q ss_pred             ccCCccccceeccceeeeeeecCCeEEEEEEeCCCeEEEEEEcCCCC-CcCceEEEEECCEEEEecCCCCeEEEEeCC
Q psy4773          83 EKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGS-LKGSSDVEEYNGAYYFGSPISKHLARVPLA  159 (160)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~vv~vd~~G~il~~l~d~~g~-~~~iS~v~e~~g~LylGS~~~~~i~~~~l~  159 (160)
                      ...      .++.      .....++.|.++|++|+|+++|||++++ +..+|+|.|++|+||+||+.++||+|++|+
T Consensus       311 ~~~------~~~~------~~~~p~~~V~~~d~~G~il~~lhD~~g~~~~~~sev~E~dg~LyiGS~~~p~i~~lkl~  376 (376)
T KOG1520|consen  311 ELL------YFLN------NGGKPHSAVKLSDETGKILESLHDKEGKVITLVSEVGEHDGHLYIGSLFNPYIARLKLP  376 (376)
T ss_pred             hhh------hhhh------ccCCCceEEEEecCCCcEEEEEecCCCCceEEEEEEeecCCeEEEcccCcceeEEEecC
Confidence            431      1110      0112237788888999999999999974 799999999999999999999999999985

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF07494 Reg_prop: Two component regulator propeller; InterPro: IPR011110 A large group of two component regulator proteins appear to have the same N-terminal structure of 14 tandem repeats Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
2fp8_A322 Strictosidine synthase; six bladed beta propeller 4e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Length = 322 Back     alignment and structure
 Score = 64.3 bits (156), Expect = 4e-13
 Identities = 26/150 (17%), Positives = 52/150 (34%), Gaps = 47/150 (31%)

Query: 12  WRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNI 71
            +Y+L+GPK+G +EV +  +P  P N+KR++ G+F VS    +D      +   G     
Sbjct: 210 VKYWLEGPKKGTAEVLVK-IPN-PGNIKRNADGHFWVSSSEELDGNMHGRVDPKG----- 262

Query: 72  RKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDG-SL 130
                                                  +     G I++ +      + 
Sbjct: 263 ---------------------------------------IKFDEFGNILEVIPLPPPFAG 283

Query: 131 KGSSDVEEYNGAYYFGSPISKHLARVPLAK 160
           +    ++E++G  Y G+     +  +   K
Sbjct: 284 EHFEQIQEHDGLLYIGTLFHGSVGILVYDK 313
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.55
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.51
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.52
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.37
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.36
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.21
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.97
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.96
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.28
2qe8_A343 Uncharacterized protein; structural genomics, join 97.26
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.77
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.56
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.48
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 96.41
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.3
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 96.14
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.11
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.1
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.04
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.97
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 95.94
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.87
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 95.74
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 95.7
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.67
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.63
3v65_B386 Low-density lipoprotein receptor-related protein; 95.42
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 95.4
3v65_B386 Low-density lipoprotein receptor-related protein; 95.4
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.37
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.35
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.3
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 95.29
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 95.26
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 95.04
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.98
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 94.94
3p5b_L400 Low density lipoprotein receptor variant; B-propel 94.84
2p4o_A 306 Hypothetical protein; putative lactonase, structur 94.75
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 94.58
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 94.52
3kya_A496 Putative phosphatase; structural genomics, joint c 94.48
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 94.47
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 94.26
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.05
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 93.7
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 93.52
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 93.48
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 93.46
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.2
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 93.1
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 92.72
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 92.62
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 92.61
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 92.61
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 91.92
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 91.88
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 91.67
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 91.63
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 91.13
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.1
4a2l_A795 BT_4663, two-component system sensor histidine kin 91.04
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 90.99
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 90.72
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 90.49
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 90.47
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 90.15
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 89.96
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 89.14
3v9f_A 781 Two-component system sensor histidine kinase/RESP 89.07
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 88.86
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 88.83
4a2l_A 795 BT_4663, two-component system sensor histidine kin 88.82
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 88.47
3ott_A 758 Two-component system sensor histidine kinase; beta 86.63
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 86.28
3v9f_A 781 Two-component system sensor histidine kinase/RESP 86.28
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 86.2
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 84.01
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 82.85
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 81.35
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 80.6
2qe8_A 343 Uncharacterized protein; structural genomics, join 80.01
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
Probab=99.55  E-value=4.5e-14  Score=114.15  Aligned_cols=111  Identities=23%  Similarity=0.422  Sum_probs=94.5

Q ss_pred             cccCCCcEEEEEEecCCCCCcceEecccCCCCCCceeecCCCCeEEEeecCCCCcChhhhhhcCCChHHHHHHHHhhhhh
Q psy4773           3 QTDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHLL   82 (160)
Q Consensus         3 ~~Et~~~Ri~Ry~l~G~k~G~~evfid~LPG~PDNI~~~~~G~fWval~~~r~~~~~~~~~~l~~~P~lRk~i~~l~~~~   82 (160)
                      ++|+..+||.+|+++|.+.|+.++|.+ +|| ||||..|++|++|||....+.   . +       |          .  
T Consensus       201 v~d~~~~~I~~~~~~~~~~~~~~~~~~-~~g-P~gi~~d~~G~l~va~~~~~~---~-~-------~----------~--  255 (322)
T 2fp8_A          201 VAEFLSHQIVKYWLEGPKKGTAEVLVK-IPN-PGNIKRNADGHFWVSSSEELD---G-N-------M----------H--  255 (322)
T ss_dssp             EEEGGGTEEEEEESSSTTTTCEEEEEE-CSS-EEEEEECTTSCEEEEEEEETT---S-S-------T----------T--
T ss_pred             EEeCCCCeEEEEECCCCcCCccceEEe-CCC-CCCeEECCCCCEEEEecCccc---c-c-------c----------c--
Confidence            478889999999999988899999997 999 999999999999999987532   1 1       1          0  


Q ss_pred             ccCCccccceeccceeeeeeecCCeEEEEEEeCCCeEEEEEEcCCCC-CcCceEEEEECCEEEEecCCCCeEEEEeCC
Q psy4773          83 EKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDALHSVDGS-LKGSSDVEEYNGAYYFGSPISKHLARVPLA  159 (160)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~vv~vd~~G~il~~l~d~~g~-~~~iS~v~e~~g~LylGS~~~~~i~~~~l~  159 (160)
                                           .+..+.|.++|++|++++.++++++. +..++.+.+.+|+||+++..++.|.+++++
T Consensus       256 ---------------------~~~~~~v~~~d~~G~~~~~~~~~~g~~~~~~~~~~~~~g~L~v~~~~~~~i~~~~~~  312 (322)
T 2fp8_A          256 ---------------------GRVDPKGIKFDEFGNILEVIPLPPPFAGEHFEQIQEHDGLLYIGTLFHGSVGILVYD  312 (322)
T ss_dssp             ---------------------SCEEEEEEEECTTSCEEEEEECCTTTTTSCCCEEEEETTEEEEECSSCSEEEEEEC-
T ss_pred             ---------------------CCCccEEEEECCCCCEEEEEECCCCCccccceEEEEeCCEEEEeecCCCceEEEecc
Confidence                                 12247899999999999999998864 788999999999999999999999999975
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 160
d1v04a_340 b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PO 2e-05
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: Serum paraoxonase/arylesterase 1, PON1
domain: Serum paraoxonase/arylesterase 1, PON1
species: Rabit (Oryctolagus cuniculus) [TaxId: 9986]

 Score = 41.2 bits (96), Expect = 2e-05
 Identities = 22/150 (14%), Positives = 38/150 (25%), Gaps = 36/150 (24%)

Query: 4   TDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVDEYTPQLLH 63
            +        Y             +     L DN+  D     L                
Sbjct: 223 AELLAHKIHVYEKHANWTLTPLRVLS-FDTLVDNISVDPVTGDL---------------- 265

Query: 64  IIGPFPNIRKFVARFLHLLEKIPSEDVKHVVGHFESILFLQGTRYTLLVISSQGEIVDAL 123
            +G  PN  +    F +  E  P  +V  +                  ++S + ++    
Sbjct: 266 WVGCHPNGMRI---FFYDAENPPGSEVLRIQ----------------DILSEEPKVTVVY 306

Query: 124 HSVDGSLKGSSDVEEYNGAYYFGSPISKHL 153
                 L+GS+    Y G    G+   K L
Sbjct: 307 AENGTVLQGSTVAAVYKGKLLIGTVFHKAL 336

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 99.69
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.11
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.75
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.46
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.19
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.87
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.71
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.52
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.39
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 95.35
d1pjxa_ 314 Diisopropylfluorophosphatase (phosphotriesterase, 95.13
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 94.59
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 94.4
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 92.81
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 90.44
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 88.3
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 86.49
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: Serum paraoxonase/arylesterase 1, PON1
domain: Serum paraoxonase/arylesterase 1, PON1
species: Rabit (Oryctolagus cuniculus) [TaxId: 9986]

Probab=99.69  E-value=1e-16  Score=132.05  Aligned_cols=114  Identities=18%  Similarity=0.147  Sum_probs=90.0

Q ss_pred             cccCCCcEEEEEEecCCCCCcceEecccCCCCCCceeecC-CCCeEEEeecCCCCcChhhhhhcCCChHHHHHHHHhhhh
Q psy4773           3 QTDYCNFSFWRYYLKGPKQGKSEVFIDGLPGLPDNVKRDS-KGNFLVSLVCPVDEYTPQLLHIIGPFPNIRKFVARFLHL   81 (160)
Q Consensus         3 ~~Et~~~Ri~Ry~l~G~k~G~~evfid~LPG~PDNI~~~~-~G~fWval~~~r~~~~~~~~~~l~~~P~lRk~i~~l~~~   81 (160)
                      .+||.++||++||++++++++.+.+++ |||+||||+.|+ +|.+|+|+...       ..+++...+            
T Consensus       222 Va~t~~~~i~~y~~~~~~~l~~~~~~~-l~~~pDNi~~d~~~g~lwva~~p~-------~~~~~~~~~------------  281 (340)
T d1v04a_         222 IAELLAHKIHVYEKHANWTLTPLRVLS-FDTLVDNISVDPVTGDLWVGCHPN-------GMRIFFYDA------------  281 (340)
T ss_dssp             EEEGGGTEEEEEEECTTSCEEEEEEEE-CSSEEEEEEECTTTCCEEEEEESC-------HHHHHSCCT------------
T ss_pred             EEeCCCCeEEEEEeCCCcccceEEEec-CCCCCCccEEecCCCEEEEEECCc-------ccchhhhcc------------
Confidence            479999999999999998888888886 999999999985 78899998753       111111111            


Q ss_pred             hccCCccccceeccceeeeeeecCCeEEEEEE----eCCCeEEEEEEcCCCCCcCceEEEEECCEEEEecCCCCeEEEEe
Q psy4773          82 LEKIPSEDVKHVVGHFESILFLQGTRYTLLVI----SSQGEIVDALHSVDGSLKGSSDVEEYNGAYYFGSPISKHLARVP  157 (160)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~vv~v----d~~G~il~~l~d~~g~~~~iS~v~e~~g~LylGS~~~~~i~~~~  157 (160)
                                           ..+..+.++++    .+++++.+.++++...++.+|.|.+++|+||+||++.++| .|+
T Consensus       282 ---------------------~~~~~s~v~ri~~~~~~~~~v~~~~~~~G~~~~~~T~a~~~~g~L~iGs~~~~~l-~C~  339 (340)
T d1v04a_         282 ---------------------ENPPGSEVLRIQDILSEEPKVTVVYAENGTVLQGSTVAAVYKGKLLIGTVFHKAL-YCD  339 (340)
T ss_dssp             ---------------------TSCCCEEEEEEECTTSSSCEEEEEEEECSSSSCSEEEEEEETTEEEEEESSSCEE-EEE
T ss_pred             ---------------------cCCCCceeEEEEeccCCCCeEEEEEeCCCcEeeceEEEEEECCEEEEEeeeCCce-Eec
Confidence                                 01223556666    3579999999996567899999999999999999999998 787


Q ss_pred             C
Q psy4773         158 L  158 (160)
Q Consensus       158 l  158 (160)
                      |
T Consensus       340 ~  340 (340)
T d1v04a_         340 L  340 (340)
T ss_dssp             C
T ss_pred             C
Confidence            5
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure