Psyllid ID: psy4858

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------98

MKLQTESFTAEKTSHTNMKAVAAQQQRHTVTSAGVFNKEKHSAQSAQSNIKFTTKGMTKSLMTSASQMSHMVNGTTTSTKMITSSASSSGISAAQIDEILNLDFDDLEKLSKNSLVSQQNIDAIIAKYTGCLENIVQDSVKLFAIKVFSMKEVFILRSFILYLQVMQNFSSDQEKRAPAVLDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSSARLLEQCLTTENRDHVVENGLDKVVRVACVCTKNINSVEHSRVGTGILEHLFKHSEGTCSDVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFHNDDNIKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSNLAHAHGQNRNWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVASCPNAVASKYAAQTLRLIGETVPHKLSQQVPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEYEDNPDKNLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPKALDRCMEDNESECKDWVHREIVAALQSGCNIIPILDNFAWPDPEQLPADMRAICKFNGVRWIHDYQDACVDKLERFMRGELNSYRSALSVKSDPPSTPNILNKVNAPTYQRMHSNDSSKGSNGDTMEYTFYSMLIRYLLILCPRRRKSSSPSPYLPSHTSWRPPTSPKSQQLRRKGPGNMPVRAHSLEGLIEPAPPRNSTLESGQVNKSVSLENELDTISDVTQTSDTDSTRSKTKNFMDKCVNKMKSLINKKPASHET

cccccccccccccccccHHHHHHHHHHcEEccccccccccccccccccccEEccccccccHHHcccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHcccHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHccccHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHccccHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccccHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHcccEEEEEEccHHHHHHccccccccccHHHHHHHHHHHcccEEEEEEccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHcccccccc

ccEccccccHHHHHHHHHHHHHHHHHHccccccccEcccHHHHHHHcccEEEEccccccccHHHHHHHcccccccccccccccccccccccccccHHHHcccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHcHHcHHHHHHccccHEEEHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHccHHccHHHHHcccHHHHHHHHcHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccHHHHHHHHHHccccccHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHccccccHcccccccccEEEEEEcccHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHccEEEEEcHHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccccccHHHccHHHHHHHHHcccEEEccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccccccccHccccccccccccccEcccccccccHHHcccccccEEEcccccccccccccHHHHHHHHHHHHHHcccccccc

mklqtesftaektshTNMKAVAAQQQRHTvtsagvfnkekhsaQSAQSNIKFTTKGMTKSLMTSASQmshmvngtttSTKMITssasssgisaaQIDEILNLDFDDLEKLSKNSLVSQQNIDAIIAKYTGCLENIVQDSVKLFAIKVFSMKEVFILRSFILYLQVMQNFssdqekrapaVLDKVNDLMQKAwavpthgheIGYSLCNTLrncggmdllisncvekdldlQFSSARLLEQCLTTENRDHVVENGLDKVVRVACVCtkninsvehsrvGTGILEHLFkhsegtcsdviglggLDTVLFECRKNDIETLRHCAGALAnlslyggaenqeAMIKRKvpvwlfplafhnddnikYYACLAIAVLVANTEIEAAVLKSVQEAAVLksgtldlvepfvmshspsefaksnlahahgqnrnWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIfkeigaieplkkvascpnaVASKYAAQTLRLIGetvphklsqqvplwstEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEhlrddigihngIQRRRFERELQNLKKMadysskdvTNLNNFLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWnkeyednpdknlDVFISYRRSNGSQLASLLKVHLELRQFkvfidverleagkfdnNLLQSIKQARNFLLVLTPKAldrcmedneseckdWVHREIVAALQSgcniipildnfawpdpeqlpaDMRAICKFNGVRWIHDYQDACVDKLERFMRGELNSYRSalsvksdppstpnilnkvnaptyqrmhsndsskgsngdtmeYTFYSMLIRYLLILcprrrkssspspylpshtswrpptspksqqlrrkgpgnmpvrahslegliepapprnstlesgqvnksvsleneldtisdvtqtsdtdstrskTKNFMDKCVNKMKSlinkkpashet

mklqtesftaektshtnmKAVAAQQQRHTVTSAGVFnkekhsaqsaqsnikfTTKGMTKSLMTSASQMSHMVNGTTTSTKMITSSASSSGISAAQIDEILNLDFDDLEKLSKNSLVSQQNIDAIIAKYTGCLENIVQDSVKLFAIKVFSMKEVFILRSFILYLQVMQNFSSDQEKRAPAVLDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSSARLLEQCLTTENRDHVVENGLDKVVRVACVCTkninsvehsrvGTGILEHLFKHSEGTCSDVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFHNDDNIKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSNLAHAHGQNRNWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVASCPNAVASKYAAQTLRLIGEtvphklsqqvplwSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEhlrddigihngiqrRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREwnkeyednpDKNLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPKALDRCMEDNESECKDWVHREIVAALQSGCNIIPILDNFAWPDPEQLPADMRAICKFNGVRWIHDYQDACVDKLERFMRGELNSYRSAlsvksdppstpnilnkvnaptyqrmhsndsskgsngdTMEYTFYSMLIRYLLILCPRRRKSsspspylpshtswrpptspksqqlrrkgPGNMPVRAHSLEGLIEPAPPRNSTLESGQVNKSvsleneldtisdvtqtsdtdstrsktknfmdkcvnkmkslinkkpashet

MKLQTESFTAEKTSHTNMKAVAAQQQRHTVTSAGVFNKEKHSAQSAQSNIKFTTKGMTKSLMTSASQMSHMVNGtttstkmitssasssgisaaqiDEILNLDFDDLEKLSKNSLVSQQNIDAIIAKYTGCLENIVQDSVKLFAIKVFSMKEVFILRSFILYLQVMQNFSSDQEKRAPAVLDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSSARLLEQCLTTENRDHVVENGLDKVVRVACVCTKNINSVEHSRVGTGILEHLFKHSEGTCSDVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFHNDDNIKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSNLAHAHGQNRNWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVASCPNAVASKYAAQTLRLIGETVPHKLSQQVPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEYEDNPDKNLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPKALDRCMEDNESECKDWVHREIVAALQSGCNIIPILDNFAWPDPEQLPADMRAICKFNGVRWIHDYQDACVDKLERFMRGELNSYRSALSVKSDPPSTPNILNKVNAPTYQRMHSNDSSKGSNGDTMEYTFYSMLIRYLLILCprrrkssspspylpshtsWRPPTSPKSQQLRRKGPGNMPVRAHSLEGLIEPAPPRNSTLESGQVNKSVSLENELdtisdvtqtsdtdstrsktKNFMDKCVNKMKSLINKKPASHET

**********************************************************************************************QIDEILNLDFDDLEKLSKNSLVSQQNIDAIIAKYTGCLENIVQDSVKLFAIKVFSMKEVFILRSFILYLQVMQNFS*******PAVLDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSSARLLEQCLTTENRDHVVENGLDKVVRVACVCTKNINSVEHSRVGTGILEHLFKHSEGTCSDVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFHNDDNIKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVM***************HGQNRNWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVASCPNAVASKYAAQTLRLIGETVPHKLSQQVPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEYEDNPDKNLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPKALDRCMEDNESECKDWVHREIVAALQSGCNIIPILDNFAWPDPEQLPADMRAICKFNGVRWIHDYQDACVDKLERFMRGEL********************************************MEYTFYSMLIRYLLILCP********************************************************************************************************************

***************************************************************************************************************************IIAKYTG************************************************AVLDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSSARLLEQCLTTENRDHVVENGLDKVVRVACVCTKNI***EHSRVGTGILEHLFKHSEGTCSDVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQ**MIKRKVPVWLFPLAFHNDDNIKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSNLAHAHGQNRNWLQKLVPV****REEARNLAAFHFCM**********************************************************LWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMAD***********FLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEY*DNPDKNLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPKALDRCMEDNESECKDWVHREIVAALQSGCNIIPILDNFAWPDPEQLPADMRAICKFNGVRWIHDYQDACVDKLERFMR*************************************************************************************************************************************************************************************

MKLQTESFTAEKTSHTNMKAVAAQQQRHTVTSAGVFNK*********SNIKFTTKGMTKSLMTSASQMSHMVNGTTTSTK**********ISAAQIDEILNLDFDDLEKLSKNSLVSQQNIDAIIAKYTGCLENIVQDSVKLFAIKVFSMKEVFILRSFILYLQVMQNFSSDQEKRAPAVLDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSSARLLEQCLTTENRDHVVENGLDKVVRVACVCTKNINSVEHSRVGTGILEHLFKHSEGTCSDVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFHNDDNIKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSNLAHAHGQNRNWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVASCPNAVASKYAAQTLRLIGETVPHKLSQQVPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEYEDNPDKNLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPKALDRCMEDNESECKDWVHREIVAALQSGCNIIPILDNFAWPDPEQLPADMRAICKFNGVRWIHDYQDACVDKLERFMRGELNSYRS**********TPNILNKVNAPTYQ***********NGDTMEYTFYSMLIRYLLILCPRRR*********************************MPVRAHSLEGLIEPAPPRNSTLESGQVNKSVSLENELDTISDV************TKNFMDKCVNKMKSLI*********

*****ESFTAEKTS*TNMKAVAAQQ***********************************************************************DEILNLDFDDLEKLSKNSLVSQQNIDAIIAKYTGCLENIVQDSVKLFAIKVFSMKEVFILRSFILYLQVMQNFSSDQEKRAPAVLDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSSARLLEQCLTTENRDHVVENGLDKVVRVACVCTKNINSVEHSRVGTGILEHLFKHSEGTCSDVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFHNDDNIKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSNLAHAHGQNRNWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVASCPNAVASKYAAQTLRLIGETVPHKLSQQVPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREW*KE***NPDKNLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPKALDRCMEDNESECKDWVHREIVAALQSGCNIIPILDNFAWPDPEQLPADMRAICKFNGVRWIHDYQDACVDKLERFMRGE*************************************************FYSMLIRYLLILCPRRRKSSSP*P**PSHTSWRPP*****************************************************TISDVTQ***********KNFMDKCVNKMKSLINK*******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		979	2.2.26 [Sep-21-2011]
Q6IDD9		1360	Sterile alpha and TIR mot	no	N/A	0.777	0.559	0.620	0.0
Q6PDS3		724	Sterile alpha and TIR mot	yes	N/A	0.634	0.857	0.46	1e-157
Q6SZW1		724	Sterile alpha and TIR mot	yes	N/A	0.630	0.852	0.465	1e-156
I3L5V6		725	Sterile alpha and TIR mot	yes	N/A	0.634	0.856	0.451	1e-149
Q86DA5		1000	Sterile alpha and TIR mot	yes	N/A	0.620	0.607	0.435	1e-148
O74653		871	Protein pob1 OS=Schizosac	yes	N/A	0.068	0.076	0.382	2e-05

>sp\|Q6IDD9\|SARM1_DROME Sterile alpha and TIR motif-containing protein 1 OS=Drosophila melanogaster GN=Ect4 PE=2 SV=1	Back alignment and function desciption

 Score = 1046 bits (2706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/845 (62%), Positives = 631/845 (74%), Gaps = 84/845 (9%)

Query: 1    MKLQTESFTAEKTSHTNMKAVAAQQQRHTVTSAGVFNKEKHSAQSAQSNIKFTTKGMTK- 59
            + +Q+E+F+A+K      KA++  QQ  T+TS G+ ++EKH + ++Q+N   + KG++  
Sbjct: 239  ITVQSENFSADK------KAISQSQQSQTMTSNGIISQEKHVSSASQANYSMSHKGVSST 292

Query: 60   --SLMTSASQMSHMVNGTTTSTKMITSSASSSGISAAQIDEILNLDFDDLEKLSKNSLVS 117
              S++TS+SQMS M NG                    Q+ ++ +L  DDL+ L+  S   
Sbjct: 293  GSSMITSSSQMSAM-NG--------------------QMLKLADLKLDDLKSLTAGS--G 329

Query: 118  QQNIDAIIAKYTGCLENIV----QDSVKLFAIKVFSMKEVFILRSFILYLQVMQNFSSDQ 173
            QQ I+  I KY+  L +IV    +D     AI V                        D 
Sbjct: 330  QQEIEQTINKYSNMLTSIVSSLQEDERGGSAITVH-----------------------DV 366

Query: 174  EKRAPAVLDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSS 233
              +    L+K+N+++++AWAVPTHGHE+GYSLCN+LR  GG+DLL+ NCV+ DL  QFSS
Sbjct: 367  GGKKSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDL--QFSS 424

Query: 234  ARLLEQCLTTENRDHVVENGLDKVVRVACVCTKNINSVEHSRVGTGILEHLFKHSEGTCS 293
            A+LLEQCLTTENR HVV+NGLDKVV VACVCTKN N +EHSRVGTGILEHLFKHSEGTCS
Sbjct: 425  AQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSN-MEHSRVGTGILEHLFKHSEGTCS 483

Query: 294  DVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFH 353
            DVI LGGLD VLFECR +D+ETLRHCA ALANLSLYGGAENQE MI RKVP+WLFPLAFH
Sbjct: 484  DVIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFH 543

Query: 354  NDDNIKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSN 413
            NDDNIKYYACLAIAVLVAN EIEA VLKS         G LDLVEPFV SH PS FA+SN
Sbjct: 544  NDDNIKYYACLAIAVLVANKEIEAEVLKS---------GCLDLVEPFVTSHDPSAFARSN 594

Query: 414  LAHAHGQNRNWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLK 473
            LAHAHGQ+++WL++LVPVLSS REEARNLAAFHFCMEAGIK++QG TDIF+EI AIE LK
Sbjct: 595  LAHAHGQSKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALK 654

Query: 474  KVASCPNAVASKYAAQTLRLIGETVPHKLSQQVPLWSTEDVREWVRQIGFAEYANNFVES 533
             VASCPNA+ASK+AAQ LRLIGETVPHKLSQQVPLWS EDV+EWV+QIGF +Y + F ES
Sbjct: 655  NVASCPNAIASKFAAQALRLIGETVPHKLSQQVPLWSVEDVQEWVKQIGFNDYIDKFNES 714

Query: 534  RVDGDLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQ 593
            +VDGDLLL+LN+++LR DIGI NGI  +RFERELQNLK+MADYSSKD   ++ FL  +G 
Sbjct: 715  QVDGDLLLKLNQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAKMHQFLSEIGT 774

Query: 594  EFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEYEDN 653
            ++  YTY+MLNAG+DK ++  ++E+ L+ ECGIHNSIHRLRI+ A+  +E       E+N
Sbjct: 775  DYCTYTYAMLNAGIDKCALPHVNEDMLMTECGIHNSIHRLRILNAVKNLENSLPSSSEEN 834

Query: 654  PDKNLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNF 713
              K LDVF+SYRRSNGSQLASLLKVHL+LR F VFIDVERLEAGKFDN LL SI+QA+NF
Sbjct: 835  MAKTLDVFVSYRRSNGSQLASLLKVHLQLRGFSVFIDVERLEAGKFDNGLLNSIRQAKNF 894

Query: 714  LLVLTPKALDRCMEDNESECKDWVHREIVAALQSGCNIIPILD-NFAWPDPEQLPADMRA 772
            +LVLTP AL RC+  N+ +CKDWVHREIVAAL S CNIIPI+D  F WP+ E+LP DMR+
Sbjct: 895  VLVLTPDALHRCI--NDEDCKDWVHREIVAALNSNCNIIPIIDQQFDWPEVERLPEDMRS 952

Query: 773  ICKFNGVRWIHDYQDACVDKLERFMRGELNSYRSALSVKSDPPSTPNILNKVNAPTYQRM 832
            +  FNGV WIHDYQDAC+DKLERF+RGE N  R A  V    P TP  +      +YQRM
Sbjct: 953  VAHFNGVNWIHDYQDACIDKLERFLRGEKNIDRIAAMV----PGTPGSV------SYQRM 1002

Query: 833  HSNDS 837
            HSNDS
Sbjct: 1003 HSNDS 1007

May be involved in innate immnune response.
Drosophila melanogaster (taxid: 7227)

>sp\|Q6PDS3\|SARM1_MOUSE Sterile alpha and TIR motif-containing protein 1 OS=Mus musculus GN=Sarm1 PE=1 SV=1	Back alignment and function description

>sp\|Q6SZW1\|SARM1_HUMAN Sterile alpha and TIR motif-containing protein 1 OS=Homo sapiens GN=SARM1 PE=1 SV=1	Back alignment and function description

>sp\|I3L5V6\|SARM1_PIG Sterile alpha and TIR motif-containing protein 1 OS=Sus scrofa GN=SARM1 PE=2 SV=1	Back alignment and function description

>sp\|Q86DA5\|SARM1_CAEEL Sterile alpha and TIR motif-containing protein tir-1 OS=Caenorhabditis elegans GN=tir-1 PE=1 SV=1	Back alignment and function description

>sp\|O74653\|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		979
380030235		1418	PREDICTED: LOW QUALITY PROTEIN: sterile	0.833	0.575	0.666	0.0
340711271		1428	PREDICTED: sterile alpha and TIR motif-c	0.817	0.560	0.662	0.0
383852344		1399	PREDICTED: sterile alpha and TIR motif-c	0.819	0.573	0.661	0.0
332027331		1131	Sterile alpha and TIR motif-containing p	0.823	0.712	0.664	0.0
328779741		1164	PREDICTED: LOW QUALITY PROTEIN: sterile	0.834	0.701	0.667	0.0
307212792		1219	Sterile alpha and TIR motif-containing p	0.830	0.666	0.660	0.0
307185565		1173	Sterile alpha and TIR motif-containing p	0.827	0.690	0.661	0.0
242003523		807	Sterile alpha and TIR motif-containing p	0.791	0.960	0.679	0.0
345497227		919	PREDICTED: sterile alpha and TIR motif-c	0.810	0.862	0.670	0.0
270013979		1339	hypothetical protein TcasGA2_TC012668 [T	0.903	0.660	0.595	0.0

>gi\|380030235\|ref\|XP_003698758.1\| PREDICTED: LOW QUALITY PROTEIN: sterile alpha and TIR motif-containing protein 1-like [Apis florea]	Back alignment and taxonomy information

 Score = 1174 bits (3038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/897 (66%), Positives = 699/897 (77%), Gaps = 81/897 (9%)

Query: 1    MKLQTESFTAEKTSHTNMKAVAAQQQRHTVTSAGVFNKEKH-SAQSAQSNIKFTTKGMTK 59
            MKLQ++SF++EK      KA+AAQQQR TVTS G+FN EKH S+ S+QS+I   +KG+T 
Sbjct: 298  MKLQSDSFSSEK------KAMAAQQQRQTVTSTGIFNHEKHISSASSQSSITIASKGVTS 351

Query: 60   --SLMTSASQMSHMVNGTTTSTKMITSSASSSGISAAQIDEILNLDFDDLEKLSKNSLVS 117
              S++++A+ ++ ++NG                +  A+ + +     D     SK++   
Sbjct: 352  KSSMISAANAVNQLMNG----------------MRPAEDELLSLPLDDLDLLCSKSN--- 392

Query: 118  QQNIDAIIAKYTGCLENIVQDSVKLFAIKVFSMKEVFILRSFILYLQVMQNFSSDQEKRA 177
             Q++D  I KY+  L+N V+       +K    K                        +A
Sbjct: 393  SQDVDRAITKYSNFLDNFVE------RLKANDCKN----------------------DKA 424

Query: 178  PAVLDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSSARLL 237
            P +L++VN++++KAWAVPT+GHE+GY+LCNTLR  GG+DLL+SNCV  D +LQFSSARLL
Sbjct: 425  PLLLNRVNEIIRKAWAVPTYGHELGYTLCNTLRTRGGLDLLMSNCVASDQELQFSSARLL 484

Query: 238  EQCLTTENRDHVVENGLDKVVRVACVCTKNINSVEHSRVGTGILEHLFKHSEGTCSDVIG 297
            EQCLTTENR HVVE+GL+KVV VACVCTKN NSV+HSRVGTGILEHLFKHSEGTCSDVI 
Sbjct: 485  EQCLTTENRAHVVEHGLEKVVNVACVCTKNANSVDHSRVGTGILEHLFKHSEGTCSDVIR 544

Query: 298  LGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFHNDDN 357
            LGGLD VLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVP+WLFPLAFHNDDN
Sbjct: 545  LGGLDAVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPMWLFPLAFHNDDN 604

Query: 358  IKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSNLAHA 417
            IKYYACLAIAVLVAN EIEAAVLKS         GTLDLVEPFV SH+P EFAKSNLAHA
Sbjct: 605  IKYYACLAIAVLVANKEIEAAVLKS---------GTLDLVEPFVTSHNPYEFAKSNLAHA 655

Query: 418  HGQNRNWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVAS 477
            HGQ++NWL++LVPVLSSKREEARNLAAFHFCMEAGIKKQQGKT+IF+ IGAIEPLKKVAS
Sbjct: 656  HGQSKNWLERLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTEIFRAIGAIEPLKKVAS 715

Query: 478  CPNAVASKYAAQTLRLIGETVPHKLSQQVPLWSTEDVREWVRQIGFAEYANNFVESRVDG 537
            CPNA+ASKYAAQ LRLIGE +PHKLSQQVPLWSTEDVREWV+QIGFAE A NFVESRVDG
Sbjct: 716  CPNAIASKYAAQALRLIGEEIPHKLSQQVPLWSTEDVREWVKQIGFAECAQNFVESRVDG 775

Query: 538  DLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQEFSI 597
            DLLLQL EE+L++DIG+ NGI+R+RF RELQNLKKMADYSS+D  NLN+FL ++GQEFSI
Sbjct: 776  DLLLQLTEENLKEDIGLANGIRRKRFTRELQNLKKMADYSSRDTGNLNSFLQSIGQEFSI 835

Query: 598  YTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEYED-NPDK 656
            YTYSMLNAGVDKDSI+ LSE+QL+ ECGI NSIHRLRI++AI  ++       ED +PDK
Sbjct: 836  YTYSMLNAGVDKDSIRNLSEDQLLSECGITNSIHRLRILDAIKNMQHNQLGSSEDESPDK 895

Query: 657  NLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLV 716
            +LDVF+SYRRSNGSQLASLLKVHL+LR F VFIDVERLEAGKFDNNLLQSI+QA++FLLV
Sbjct: 896  SLDVFVSYRRSNGSQLASLLKVHLQLRGFSVFIDVERLEAGKFDNNLLQSIRQAKHFLLV 955

Query: 717  LTPKALDRCMEDNESECKDWVHREIVAALQSGCNIIPILDNFAWPDPEQLPADMRAICKF 776
            LTPKAL+RC++DN  ECKDWVHREIVAALQS CNIIPI+DNF WP+PE+LP DMRA+C F
Sbjct: 956  LTPKALERCIQDN--ECKDWVHREIVAALQSQCNIIPIIDNFQWPEPEELPEDMRAVCHF 1013

Query: 777  NGVRWIHDYQDACVDKLERFMRGELNSYRSALSVKSDP-----PSTPNILNKVNAPTYQR 831
            NGVRWIHDYQDACVDKLERFMRGE+   RS +     P     P+TP   N    P YQR
Sbjct: 1014 NGVRWIHDYQDACVDKLERFMRGEI-PVRSDIPRSIAPKDVTQPNTPGNTNIRQPPNYQR 1072

Query: 832  MHSNDSSKGSNGDTMEYTFYSMLIRYLLILCPRRRKSSSPSPYLPSHTSWRPPTSPK 888
            MHSN+ S+GS+ D+        L      +  R RKSSSPS +L       PPTSP+
Sbjct: 1073 MHSNE-SRGSDKDST--GGRDXLEGPPTAISNRLRKSSSPSRWLIG----LPPTSPR 1122

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|340711271\|ref\|XP_003394202.1\| PREDICTED: sterile alpha and TIR motif-containing protein 1-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|383852344\|ref\|XP_003701688.1\| PREDICTED: sterile alpha and TIR motif-containing protein 1-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|332027331\|gb\|EGI67415.1\| Sterile alpha and TIR motif-containing protein 1 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|328779741\|ref\|XP_394430.4\| PREDICTED: LOW QUALITY PROTEIN: sterile alpha and TIR motif-containing protein 1 [Apis mellifera]	Back alignment and taxonomy information

>gi\|307212792\|gb\|EFN88463.1\| Sterile alpha and TIR motif-containing protein 1 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|307185565\|gb\|EFN71525.1\| Sterile alpha and TIR motif-containing protein 1 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|242003523\|ref\|XP_002422762.1\| Sterile alpha and TIR motif-containing protein, putative [Pediculus humanus corporis] gi\|212505605\|gb\|EEB10024.1\| Sterile alpha and TIR motif-containing protein, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|345497227\|ref\|XP_001601657.2\| PREDICTED: sterile alpha and TIR motif-containing protein 1-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|270013979\|gb\|EFA10427.1\| hypothetical protein TcasGA2_TC012668 [Tribolium castaneum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		979
FB\|FBgn0262579		1360	Ect4 "Ectoderm-expressed 4" [D	0.652	0.469	0.715	9.1e-269
UNIPROTKB\|E1C797		715	SARM1 "Uncharacterized protein	0.631	0.864	0.471	6e-151
UNIPROTKB\|Q6SZW1		724	SARM1 "Sterile alpha and TIR m	0.637	0.861	0.468	1.4e-149
MGI\|MGI:2136419		724	Sarm1 "sterile alpha and HEAT/	0.648	0.877	0.455	5.7e-146
UNIPROTKB\|E1BIR9		729	SARM1 "Uncharacterized protein	0.640	0.860	0.458	7.3e-146
UNIPROTKB\|F1PUL9		725	SARM1 "Uncharacterized protein	0.626	0.845	0.463	1.9e-145
RGD\|1310078		724	Sarm1 "sterile alpha and TIR m	0.626	0.846	0.460	1.1e-144
UNIPROTKB\|I3L5V6		725	SARM1 "Sterile alpha and TIR m	0.637	0.860	0.453	1.2e-143
ZFIN\|ZDB-GENE-040219-1		713	sarm1 "sterile alpha and TIR m	0.637	0.875	0.437	5.3e-143
WB\|WBGene00006575		1000	tir-1 [Caenorhabditis elegans	0.660	0.647	0.426	2.7e-141

FB\|FBgn0262579 Ect4 "Ectoderm-expressed 4" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 2461 (871.4 bits), Expect = 9.1e-269, Sum P(3) = 9.1e-269
 Identities = 475/664 (71%), Positives = 549/664 (82%)

Query:   181 LDKVNDLMQKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLDLQFSSARLLEQC 240
             L+K+N+++++AWAVPTHGHE+GYSLCN+LR  GG+DLL+ NCV+ DL  QFSSA+LLEQC
Sbjct:   374 LEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDL--QFSSAQLLEQC 431

Query:   241 LTTENRDHVVENGLDKVVRVACVCTKNINSVEHSRVGTGILEHLFKHSEGTCSDVIGLGG 300
             LTTENR HVV+NGLDKVV VACVCTKN N +EHSRVGTGILEHLFKHSEGTCSDVI LGG
Sbjct:   432 LTTENRKHVVDNGLDKVVNVACVCTKNSN-MEHSRVGTGILEHLFKHSEGTCSDVIRLGG 490

Query:   301 LDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFHNDDNIKY 360
             LD VLFECR +D+ETLRHCA ALANLSLYGGAENQE MI RKVP+WLFPLAFHNDDNIKY
Sbjct:   491 LDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHNDDNIKY 550

Query:   361 YACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSNLAHAHGQ 420
             YACLAIAVLVAN EIEA VLKS         G LDLVEPFV SH PS FA+SNLAHAHGQ
Sbjct:   551 YACLAIAVLVANKEIEAEVLKS---------GCLDLVEPFVTSHDPSAFARSNLAHAHGQ 601

Query:   421 NRNWLQKLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVASCPN 480
             +++WL++LVPVLSS REEARNLAAFHFCMEAGIK++QG TDIF+EI AIE LK VASCPN
Sbjct:   602 SKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCPN 661

Query:   481 AVASKYAAQTLRLIGETVPHKLSQQVPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLL 540
             A+ASK+AAQ LRLIGETVPHKLSQQVPLWS EDV+EWV+QIGF +Y + F ES+VDGDLL
Sbjct:   662 AIASKFAAQALRLIGETVPHKLSQQVPLWSVEDVQEWVKQIGFNDYIDKFNESQVDGDLL 721

Query:   541 LQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQEFSIYTY 600
             L+LN+++LR DIGI NGI  +RFERELQNLK+MADYSSKD   ++ FL  +G ++  YTY
Sbjct:   722 LKLNQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAKMHQFLSEIGTDYCTYTY 781

Query:   601 SMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEYEDNPDKNLDV 660
             +MLNAG+DK ++  ++E+ L+ ECGIHNSIHRLRI+ A+  +E       E+N  K LDV
Sbjct:   782 AMLNAGIDKCALPHVNEDMLMTECGIHNSIHRLRILNAVKNLENSLPSSSEENMAKTLDV 841

Query:   661 FISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPK 720
             F+SYRRSNGSQLASLLKVHL+LR F VFIDVERLEAGKFDN LL SI+QA+NF+LVLTP 
Sbjct:   842 FVSYRRSNGSQLASLLKVHLQLRGFSVFIDVERLEAGKFDNGLLNSIRQAKNFVLVLTPD 901

Query:   721 ALDRCMEDNESECKDWVHREIVAALQSGCNIIPILDN-FAWPDPEQLPADMRAICKFNGV 779
             AL RC+  N+ +CKDWVHREIVAAL S CNIIPI+D  F WP+ E+LP DMR++  FNGV
Sbjct:   902 ALHRCI--NDEDCKDWVHREIVAALNSNCNIIPIIDQQFDWPEVERLPEDMRSVAHFNGV 959

Query:   780 RWIHDYQDACVDKLERFMRGELNSYRSALSVKSDPPSTPNILNKVNAPTYQRMHSNDSSK 839
              WIHDYQDAC+DKLERF+RGE N  R A  V    P TP  ++      YQRMHSNDS  
Sbjct:   960 NWIHDYQDACIDKLERFLRGEKNIDRIAAMV----PGTPGSVS------YQRMHSNDSDY 1009

Query:   840 GSNG 843
              S G
Sbjct:  1010 QSGG 1013

GO:0007165 "signal transduction" evidence=IEA

GO:0043025 "neuronal cell body" evidence=IDA

GO:1901214 "regulation of neuron death" evidence=IMP

GO:0043005 "neuron projection" evidence=IDA

UNIPROTKB\|E1C797 SARM1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6SZW1 SARM1 "Sterile alpha and TIR motif-containing protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:2136419 Sarm1 "sterile alpha and HEAT/Armadillo motif containing 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BIR9 SARM1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PUL9 SARM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|1310078 Sarm1 "sterile alpha and TIR motif containing 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|I3L5V6 SARM1 "Sterile alpha and TIR motif-containing protein 1" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040219-1 sarm1 "sterile alpha and TIR motif containing 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

WB\|WBGene00006575 tir-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6SZW1	SARM1_HUMAN	No assigned EC number	0.4659	0.6302	0.8522	yes	N/A
Q86DA5	SARM1_CAEEL	No assigned EC number	0.4351	0.6200	0.607	yes	N/A
I3L5V6	SARM1_PIG	No assigned EC number	0.4510	0.6343	0.8565	yes	N/A
Q6PDS3	SARM1_MOUSE	No assigned EC number	0.46	0.6343	0.8577	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		979
cd09501		69	cd09501, SAM_SARM1-like_repeat1, SAM domain ot SAR	5e-33
cd09502		70	cd09502, SAM_SARM1-like_repeat2, SAM domain of SAR	1e-29
pfam13676		102	pfam13676, TIR_2, TIR domain	3e-19
smart00255		140	smart00255, TIR, Toll - interleukin 1 - resistance	1e-18
smart00454		68	smart00454, SAM, Sterile alpha motif	2e-14
pfam07647		66	pfam07647, SAM_2, SAM domain (Sterile alpha motif)	1e-12
pfam00536		62	pfam00536, SAM_1, SAM domain (Sterile alpha motif)	5e-12
cd09487		56	cd09487, SAM_superfamily, SAM (Sterile alpha motif	1e-11
cd09505		72	cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins	7e-09
cd09515		70	cd09515, SAM_SGMS1-like, SAM domain of sphingomyel	9e-09
cd09512		70	cd09512, SAM_Neurabin-like, SAM domain of SAM_Neur	5e-08
cd09530		67	cd09530, SAM_Samd14, SAM domain of Samd14 subfamil	1e-07
cd09535		65	cd09535, SAM_BOI-like_fungal, SAM domain of BOI-li	3e-07
cd09509		64	cd09509, SAM_Polycomb, SAM domain of Polycomb grou	4e-07
cd09534		62	cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fun	7e-07
cd09506		66	cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3	2e-06
cd09568		72	cd09568, SAM_liprin-alpha1,2,3,4_repeat3, SAM doma	3e-06
cd09513		71	cd09513, SAM_BAR, SAM domain of BAR subfamily	4e-06
cd09579		68	cd09579, SAM_Samd7,11, SAM domain of Samd7,11 subf	4e-06
cd09533		58	cd09533, SAM_Ste50-like_fungal, SAM domain of Ste5	8e-06
cd09502		70	cd09502, SAM_SARM1-like_repeat2, SAM domain of SAR	2e-05
cd09496		62	cd09496, SAM_liprin-kazrin_repeat3, SAM domain of	3e-05
cd09508		70	cd09508, SAM_HD, SAM domain of HD-phosphohydrolase	1e-04
cd09583		69	cd09583, SAM_Atherin-like, SAM domain of Atherin/A	1e-04
cd09577		69	cd09577, SAM_Ph1,2,3, SAM domain of Ph (polyhomeot	2e-04
cd09570		72	cd09570, SAM_kazrin_repeat3, SAM domain of kazrin	2e-04
cd09529		71	cd09529, SAM_MLTK, SAM domain of MLTK subfamily	2e-04
cd09507		65	cd09507, SAM_DGK-delta-eta, SAM domain of diacylgl	3e-04
cd09528		64	cd09528, SAM_Samd9_Samd9L, SAM domain of Samd9/Sam	3e-04
cd09510		75	cd09510, SAM_aveugle-like, SAM domain of aveugle-l	4e-04
pfam01582		135	pfam01582, TIR, TIR domain	4e-04
cd09511		69	cd09511, SAM_CNK1,2,3-suppressor, SAM domain of CN	7e-04
cd09567		65	cd09567, SAM_kazrin_repeat2, SAM domain of kazrin	0.002
pfam07647		66	pfam07647, SAM_2, SAM domain (Sterile alpha motif)	0.003
cd09569		72	cd09569, SAM_liprin-beta1,2_repeat3, SAM domain of	0.004
cd09498		71	cd09498, SAM_caskin1,2_repeat2, SAM domain of cask	0.004

>gnl\|CDD\|188900 cd09501, SAM_SARM1-like_repeat1, SAM domain ot SARM1-like proteins, repeat 1	Back alignment and domain information

 Score =  121 bits (306), Expect = 5e-33
 Identities = 40/69 (57%), Positives = 52/69 (75%)

Query: 506 VPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFER 565
           VPLWS  DV+ W++QIGF +YA  F ES+VDGDLLLQL E+ L+ D+G+ +G+ R+RF R
Sbjct: 1   VPLWSVADVQTWLKQIGFEDYAEKFSESQVDGDLLLQLTEDELKQDLGMSSGLLRKRFLR 60

Query: 566 ELQNLKKMA 574
           EL  LK  A
Sbjct: 61  ELVELKTSA 69

SAM (sterile alpha motif) domain repeat 1 of SARM1-like adaptor proteins is a protein-protein interaction domain. SARM1-like proteins contain two tandem SAM domains. SARM1-like proteins are involved in TLR (Toll-like receptor) signaling. They are responsible for targeted localization of the whole protein to post-synaptic regions of axons. In humans SARM1 expression is detected in kidney and liver. Length = 69

>gnl\|CDD\|188901 cd09502, SAM_SARM1-like_repeat2, SAM domain of SARM1-like, repeat 2	Back alignment and domain information

>gnl\|CDD\|222311 pfam13676, TIR_2, TIR domain	Back alignment and domain information

>gnl\|CDD\|214587 smart00255, TIR, Toll - interleukin 1 - resistance	Back alignment and domain information

>gnl\|CDD\|197735 smart00454, SAM, Sterile alpha motif	Back alignment and domain information

>gnl\|CDD\|203706 pfam07647, SAM_2, SAM domain (Sterile alpha motif)	Back alignment and domain information

>gnl\|CDD\|215981 pfam00536, SAM_1, SAM domain (Sterile alpha motif)	Back alignment and domain information

>gnl\|CDD\|188886 cd09487, SAM_superfamily, SAM (Sterile alpha motif )	Back alignment and domain information

>gnl\|CDD\|188904 cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins	Back alignment and domain information

>gnl\|CDD\|188914 cd09515, SAM_SGMS1-like, SAM domain of sphingomyelin synthase related subfamily	Back alignment and domain information

>gnl\|CDD\|188911 cd09512, SAM_Neurabin-like, SAM domain of SAM_Neurabin-like subfamily	Back alignment and domain information

>gnl\|CDD\|188929 cd09530, SAM_Samd14, SAM domain of Samd14 subfamily	Back alignment and domain information

>gnl\|CDD\|188934 cd09535, SAM_BOI-like_fungal, SAM domain of BOI-like fungal subfamily	Back alignment and domain information

>gnl\|CDD\|188908 cd09509, SAM_Polycomb, SAM domain of Polycomb group	Back alignment and domain information

>gnl\|CDD\|188933 cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fungal subfamily	Back alignment and domain information

>gnl\|CDD\|188905 cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3 family proteins	Back alignment and domain information

>gnl\|CDD\|188967 cd09568, SAM_liprin-alpha1,2,3,4_repeat3, SAM domain of liprin-alpha1,2,3,4 proteins repeat 3	Back alignment and domain information

>gnl\|CDD\|188912 cd09513, SAM_BAR, SAM domain of BAR subfamily	Back alignment and domain information

>gnl\|CDD\|188978 cd09579, SAM_Samd7,11, SAM domain of Samd7,11 subfamily of Polycomb group	Back alignment and domain information

>gnl\|CDD\|188932 cd09533, SAM_Ste50-like_fungal, SAM domain of Ste50_like (ubc2) subfamily	Back alignment and domain information

>gnl\|CDD\|188901 cd09502, SAM_SARM1-like_repeat2, SAM domain of SARM1-like, repeat 2	Back alignment and domain information

>gnl\|CDD\|188895 cd09496, SAM_liprin-kazrin_repeat3, SAM domain of liprin/kazrin proteins repeat 3	Back alignment and domain information

>gnl\|CDD\|188907 cd09508, SAM_HD, SAM domain of HD-phosphohydrolase	Back alignment and domain information

>gnl\|CDD\|188982 cd09583, SAM_Atherin-like, SAM domain of Atherin/Atherin-like subfamily	Back alignment and domain information

>gnl\|CDD\|188976 cd09577, SAM_Ph1,2,3, SAM domain of Ph (polyhomeotic) proteins of Polycomb group	Back alignment and domain information

>gnl\|CDD\|188969 cd09570, SAM_kazrin_repeat3, SAM domain of kazrin proteins repeat 3	Back alignment and domain information

>gnl\|CDD\|188928 cd09529, SAM_MLTK, SAM domain of MLTK subfamily	Back alignment and domain information

>gnl\|CDD\|188906 cd09507, SAM_DGK-delta-eta, SAM domain of diacylglycerol kinase delta and eta subunits	Back alignment and domain information

>gnl\|CDD\|188927 cd09528, SAM_Samd9_Samd9L, SAM domain of Samd9/Samd9L subfamily	Back alignment and domain information

>gnl\|CDD\|188909 cd09510, SAM_aveugle-like, SAM domain of aveugle-like subfamily	Back alignment and domain information

>gnl\|CDD\|216585 pfam01582, TIR, TIR domain	Back alignment and domain information

>gnl\|CDD\|188910 cd09511, SAM_CNK1,2,3-suppressor, SAM domain of CNK1,2,3-suppressor subfamily	Back alignment and domain information

>gnl\|CDD\|188966 cd09567, SAM_kazrin_repeat2, SAM domain of kazrin proteins repeat 2	Back alignment and domain information

>gnl\|CDD\|203706 pfam07647, SAM_2, SAM domain (Sterile alpha motif)	Back alignment and domain information

>gnl\|CDD\|188968 cd09569, SAM_liprin-beta1,2_repeat3, SAM domain of liprin-beta proteins repeat 3	Back alignment and domain information

>gnl\|CDD\|188897 cd09498, SAM_caskin1,2_repeat2, SAM domain of caskin protein repeat 2	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		979
KOG3678\|consensus		832		100.0
KOG4224\|consensus		550		100.0
KOG1899\|consensus		861		99.92
PLN03194		187	putative disease resistance protein; Provisional	99.89
KOG0249\|consensus		916		99.69
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.69
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.65
smart00255		140	TIR Toll - interleukin 1 - resistance.	99.64
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.61
PF13676		102	TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_	99.56
KOG4224\|consensus		550		99.54
KOG0166\|consensus		514		99.51
PF05804		708	KAP: Kinesin-associated protein (KAP)	99.45
KOG0249\|consensus		916		99.41
PF00536		64	SAM_1: SAM domain (Sterile alpha motif); InterPro:	99.4
PF07647		66	SAM_2: SAM domain (Sterile alpha motif); InterPro:	99.38
cd00166		63	SAM Sterile alpha motif.; Widespread domain in sig	99.28
PF01582		141	TIR: TIR domain; InterPro: IPR000157 In Drosophila	99.27
smart00454		68	SAM Sterile alpha motif. Widespread domain in sign	99.25
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	99.02
PF05804		708	KAP: Kinesin-associated protein (KAP)	98.79
KOG3678\|consensus		832		98.77
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	98.77
KOG0166\|consensus		514		98.72
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	98.68
KOG1048\|consensus		717		98.63
PF07647		66	SAM_2: SAM domain (Sterile alpha motif); InterPro:	98.53
PF08937		130	DUF1863: MTH538 TIR-like domain (DUF1863); InterPr	98.49
KOG4375\|consensus		272		98.48
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	98.48
KOG1899\|consensus		861		98.4
PF00536		64	SAM_1: SAM domain (Sterile alpha motif); InterPro:	98.37
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	98.34
KOG4199\|consensus		461		98.3
cd00166		63	SAM Sterile alpha motif.; Widespread domain in sig	98.18
KOG4384\|consensus		361		98.15
KOG1170\|consensus		1099		98.15
smart00454		68	SAM Sterile alpha motif. Widespread domain in sign	98.09
KOG4384\|consensus		361		97.99
PF08357		150	SEFIR: SEFIR domain; InterPro: IPR013568 This doma	97.93
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	97.85
PF00514		41	Arm: Armadillo/beta-catenin-like repeat; InterPro:	97.76
KOG2160\|consensus		342		97.71
KOG4199\|consensus		461		97.64
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	97.56
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	97.36
KOG1048\|consensus		717		97.34
KOG4374\|consensus		216		97.13
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	97.09
PRK09687		280	putative lyase; Provisional	96.9
PRK09687		280	putative lyase; Provisional	96.86
smart00185		41	ARM Armadillo/beta-catenin-like repeats. Approx. 4	96.85
KOG2122\|consensus		2195		96.77
KOG4500\|consensus		604		96.64
KOG4403\|consensus		575		96.64
PF09235		75	Ste50p-SAM: Ste50p, sterile alpha motif; InterPro:	96.55
KOG4375\|consensus		272		96.04
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	95.99
PF00514		41	Arm: Armadillo/beta-catenin-like repeat; InterPro:	95.98
KOG2122\|consensus		2195		95.96
KOG0196\|consensus		996		95.95
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	95.71
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	95.7
KOG0507\|consensus		854		95.68
KOG2160\|consensus		342		95.49
PF10137		125	TIR-like: Predicted nucleotide-binding protein con	95.43
KOG4646\|consensus		173		95.33
cd08532		76	SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointe	95.09
smart00185		41	ARM Armadillo/beta-catenin-like repeats. Approx. 4	94.91
cd00256		429	VATPase_H VATPase_H, regulatory vacuolar ATP synth	94.88
KOG0196\|consensus		996		94.69
cd08757		68	SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed doma	94.59
PF02198		84	SAM_PNT: Sterile alpha motif (SAM)/Pointed domain;	94.56
KOG4500\|consensus		604		94.46
cd08541		91	SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed do	94.2
cd08203		66	SAM_PNT Sterile alpha motif (SAM)/Pointed domain.	94.18
cd08540		75	SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed doma	94.08
cd08534		89	SAM_PNT-GABP-alpha Sterile alpha motif (SAM)/Point	94.02
smart00251		82	SAM_PNT SAM / Pointed domain. A subfamily of the S	93.93
cd08535		68	SAM_PNT-Tel_Yan Sterile alpha motif (SAM)/Pointed	93.74
KOG1738\|consensus		638		93.73
cd08538		78	SAM_PNT-ESE-2-like Sterile alpha motif (SAM)/Point	93.71
cd08531		75	SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointe	93.69
KOG4374\|consensus		216		93.64
cd08533		71	SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed	93.58
KOG1170\|consensus		1099		93.5
PF11841		160	DUF3361: Domain of unknown function (DUF3361)	93.47
KOG1222\|consensus		791		93.16
PF11701		157	UNC45-central: Myosin-binding striated muscle asse	92.68
cd08542		88	SAM_PNT-ETS-1 Sterile alpha motif (SAM)/Pointed do	92.52
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	92.31
cd08543		89	SAM_PNT-ETS-2 Sterile alpha motif (SAM)/Pointed do	92.24
PF13646		88	HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I	92.18
PF09759		102	Atx10homo_assoc: Spinocerebellar ataxia type 10 pr	91.15
PF13646		88	HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I	90.74
KOG1222\|consensus		791		90.42
cd08539		74	SAM_PNT-ESE-3-like Sterile alpha motif (SAM)/Point	90.23
cd08536		66	SAM_PNT-Mae Sterile alpha motif (SAM)/Pointed doma	89.72
PF13271		83	DUF4062: Domain of unknown function (DUF4062)	89.7
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	89.04
PF05014		113	Nuc_deoxyrib_tr: Nucleoside 2-deoxyribosyltransfer	89.01
PF13764		802	E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4	88.94
PF09597		57	IGR: IGR protein motif; InterPro: IPR019083 This e	88.87
PF05536		543	Neurochondrin: Neurochondrin	88.09
cd00256		429	VATPase_H VATPase_H, regulatory vacuolar ATP synth	87.92
PF13513		55	HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O	87.59
PF09759		102	Atx10homo_assoc: Spinocerebellar ataxia type 10 pr	86.07
KOG4413\|consensus		524		85.86
cd08537		78	SAM_PNT-ESE-1-like Sterile alpha motif (SAM)/Point	84.74
KOG0168\|consensus		1051		83.16
KOG0946\|consensus		970		81.34

>KOG3678\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.1e-151  Score=1245.23  Aligned_cols=600  Identities=50%  Similarity=0.858  Sum_probs=589.1

Q ss_pred             HHhhccCCcchhHHHHHHHHHHhcCChHHHHHhhcCCChh--HHhHHHHHHHHhhccchhhHHHhhchhHHHhhhhhccc
Q psy4858         189 QKAWAVPTHGHEIGYSLCNTLRNCGGMDLLISNCVEKDLD--LQFSSARLLEQCLTTENRDHVVENGLDKVVRVACVCTK  266 (979)
Q Consensus       189 ~~Awa~p~~~~~~~~~lc~~ir~~Ggld~Li~~~~s~~~~--~q~~aa~~Le~~~~~~Nr~~Iv~~Gl~~lv~la~~~tk  266 (979)
                      .+.|+.|.+|++++++|||+||..||+|+||+++++|+.+  |+..||++||||++.+||+|||++|++++++||    |
T Consensus       156 ~~~~aa~aV~~evAq~LCD~iR~~~~lD~Llrmf~aPn~et~vRve~~rlLEq~~~aeN~d~va~~~~~~Il~lA----K  231 (832)
T KOG3678|consen  156 GGGLAAAAVGREVAQGLCDAIRLDGGLDLLLRMFQAPNLETSVRVEAARLLEQILVAENRDRVARIGLGVILNLA----K  231 (832)
T ss_pred             CcccchhhhhHHHHHhhhhHhhccchHHHHHHHHhCCchhHHHHHHHHHHHHHHHhhhhhhHHhhccchhhhhhh----h
Confidence            6789999999999999999999999999999999999977  599999999999999999999999999999999    8


Q ss_pred             cccccchhhhhhhHhhhhhhcChhhHHHHhhcCchHHHHhhhccCChhHHHHHHHhhhhhcccCCchhHHHHHhcCCcch
Q psy4858         267 NINSVEHSRVGTGILEHLFKHSEGTCSDVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVW  346 (979)
Q Consensus       267 ~~~~~~~~r~~~giL~~lfkHSe~t~~~lV~~Ggl~~Ll~l~r~~d~~~lr~ca~ALaNlAl~~~~~~q~~mi~~~~~~w  346 (979)
                      .++.++++|...|||+||||||+++|++||.+||||++++|||+.||++|||||.||+||++|||.+.|++|+++++++|
T Consensus       232 ~~e~~e~aR~~~~il~~mFKHSeet~~~Lvaa~~lD~vl~~~rRt~P~lLRH~ALAL~N~~L~~~~a~qrrmveKr~~EW  311 (832)
T KOG3678|consen  232 EREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALGNCALHGGQAVQRRMVEKRAAEW  311 (832)
T ss_pred             hcCcHHHHHHHHHHHHHHhhhhHHHHHHHHhhcccchheeecccCCHHHHHHHHHHhhhhhhhchhHHHHHHHHhhhhhh
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccccccCCccchhhHHHHHHHHhcchHHHHHHHhhhhHHHHHhhCCccchHhhhhcCChhhhhhhhhhcccCCCchhhh
Q psy4858         347 LFPLAFHNDDNIKYYACLAIAVLVANTEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEFAKSNLAHAHGQNRNWLQ  426 (979)
Q Consensus       347 L~~La~s~dd~vr~~A~lAla~Lasn~ei~~~~~~~~~~~~V~~sG~l~lv~~~~~~~~P~~fAr~~l~~~~g~~~g~L~  426 (979)
                      ||+|||+.|+.+|||||+|+|+||+|||+|.+         |.+||++.||+||+.+|+|..|||+...++||++++||+
T Consensus       312 LF~LA~skDel~R~~AClAV~vlat~KE~E~~---------VrkS~TlaLVEPlva~~DP~~FARD~hd~aQG~~~d~Lq  382 (832)
T KOG3678|consen  312 LFPLAFSKDELLRLHACLAVAVLATNKEVERE---------VRKSGTLALVEPLVASLDPGRFARDAHDYAQGRGPDDLQ  382 (832)
T ss_pred             hhhhhcchHHHHHHHHHHHHhhhhhhhhhhHH---------HhhccchhhhhhhhhccCcchhhhhhhhhhccCChHHHH
Confidence            99999999999999999999999999999999         999999999999999999999999999999999999999


Q ss_pred             hhhhccccchHHHHHHHHHHhhHHhhhhhhcCCchhhhhhCccchhhhhhcCCccchhhhhhhhHhhccCcccCcCCCCC
Q psy4858         427 KLVPVLSSKREEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVASCPNAVASKYAAQTLRLIGETVPHKLSQQV  506 (979)
Q Consensus       427 ~LvplL~s~~eE~q~lAafhl~~ea~iKk~q~n~~~F~eiGaIe~LkrLasSpnd~asklAaqaLe~~gEevp~kl~~~V  506 (979)
                      ||||||+|++.|+||++|||||.||+|||.|+.+++|.+||||+.||+|++||++++++||..||..+|||+|.++.++|
T Consensus       383 RLvPlLdS~R~EAq~i~AF~l~~EAaIKs~Q~K~kVFseIGAIQaLKevaSS~d~vaakfAseALtviGEEVP~~l~~qV  462 (832)
T KOG3678|consen  383 RLVPLLDSNRLEAQCIGAFYLCAEAAIKSLQGKTKVFSEIGAIQALKEVASSPDEVAAKFASEALTVIGEEVPYKLAQQV  462 (832)
T ss_pred             HhhhhhhcchhhhhhhHHHHHHHHHHHHHhccchhHHHHHHHHHHHHHHhcCchHHHHHHHHHHHHHhccccChhhhccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHcCchHHHHHHHhcCCChhHHhcCChhhhccccCCCChHHHHHHHHHHHHHHhhcccCCCCccChHH
Q psy4858         507 PLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMADYSSKDVTNLNN  586 (979)
Q Consensus       507 ~~WS~EDVa~WL~~IGL~eY~~~F~en~IDG~~LL~LTeeDL~~dLGI~n~ghRKrLlreI~~Lk~~~~yss~d~~~l~e  586 (979)
                      +.|++.||+.|+++|||++|++.|.+..|||++||+|||+||+.++||.+..|||||+|+++.||..++|+++|..|++.
T Consensus       463 PgWt~AdVQ~WvkkIGFeeY~EkFakQ~VDGDLLLqLTEndLk~DvGM~SGl~RKRFlRELqtLKv~AdYSs~DeSNLdn  542 (832)
T KOG3678|consen  463 PGWTCADVQYWVKKIGFEEYVEKFAKQMVDGDLLLQLTENDLKHDVGMISGLHRKRFLRELQTLKVAADYSSVDESNLDN  542 (832)
T ss_pred             CCcchHHHHHHHHHhCHHHHHHHHHHHhccchHHHhhhhhhhhhhhhhhhhhhHHHHHHHHHHHHHhhcccccchhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhcCCCcchhHHHHHhcCCCchhhhccCHHHHHHHcCCCcchhHHHHHHHHHhhhhccccccCCCCCCCCCeeEeccc
Q psy4858         587 FLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEYEDNPDKNLDVFISYRR  666 (979)
Q Consensus       587 wL~~IGpel~qYtys~l~~GvD~~~L~~LT~edL~~~cgItn~~Hr~rIl~AIk~l~~~~~~~~~~~~~~~yDVFISYRR  666 (979)
                      ||..+.|+|++|||+|+.||+|+..|.+||+|++++.|||+|.+||++|++|.+...|.+ ........+.+||||||||
T Consensus       543 ~L~gLsPels~YTY~mlt~GvnRSLLssltde~m~naCGI~~~iHR~kl~qA~eta~H~~-~v~~a~~skq~DVFISYRR  621 (832)
T KOG3678|consen  543 FLMGLSPELSVYTYQMLTNGVNRSLLSSLTDEMMQNACGITNPIHRLKLTQAFETAKHPD-DVEVAMLSKQIDVFISYRR  621 (832)
T ss_pred             HHhcCChhHHHHhHHHhhccccHHHHHHhhHHHHHHhcCccchHHHHHHHHHHHhhcCCC-ccccccccCCcceEEEeec
Confidence            999999999999999999999999999999999999999999999999999999999985 4444567889999999999


Q ss_pred             CCccchHHHHHHHHHhcCCceEeecccCCCCcchHHHHHHHHhCCEEEEEECcccchhhcccCCCcCChhHHHHHHHHHh
Q psy4858         667 SNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPKALDRCMEDNESECKDWVHREIVAALQ  746 (979)
Q Consensus       667 ~Dg~~~As~L~e~Le~~G~rVFiD~~~Ie~Gdf~~~L~~aI~~SrvfIvVLSp~~l~~~~~~~i~~~SdWV~rEL~~Al~  746 (979)
                      +.|.++|++|+.+|+.+||+||||++++.+|+|...|.++|..+++||+|++|+++++|++|  ++|.||||+||..|++
T Consensus       622 stGnQLASLiKV~LQL~GyrVFIDVdKL~AGKFdssLlkni~aAkhFiLVLtP~sLDr~lnD--~nCeDWVHKEl~~Afe  699 (832)
T KOG3678|consen  622 STGNQLASLIKVLLQLRGYRVFIDVDKLYAGKFDSSLLKNIQAAKHFILVLTPNSLDRLLND--DNCEDWVHKELKCAFE  699 (832)
T ss_pred             cccHHHHHHHHHHHHhcCceEEEehhhhhcccccHHHHHHHHhhheeEEEeCcchHHHHhcc--ccHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999  9999999999999999


Q ss_pred             cCCeEEEEecC-CCCCCCC-CChHHHHHHhhhcccccccccHHHHHHHHHHHHhhcccCc
Q psy4858         747 SGCNIIPILDN-FAWPDPE-QLPADMRAICKFNGVRWIHDYQDACVDKLERFMRGELNSY  804 (979)
Q Consensus       747 ~~k~IIPVl~~-f~~pd~e-~LPedLr~la~~ngi~w~~~yq~a~IdkIvr~I~g~l~~~  804 (979)
                      ++|||||||+. |+||.++ .+|+||+.+..||||+|.|+||++|++||+|||.|+++++
T Consensus       700 ~~KNIiPI~D~aFE~Pt~ed~iPnDirmi~kyNGvKWvHdYQdA~maKvvRFitGe~nRt  759 (832)
T KOG3678|consen  700 HQKNIIPIFDTAFEFPTKEDQIPNDIRMITKYNGVKWVHDYQDACMAKVVRFITGELNRT  759 (832)
T ss_pred             hcCCeeeeecccccCCCchhcCcHHHHHHHhccCeeeehhhHHHHHHHHHHHHhccccCC
Confidence            99999999997 9999987 8999999999999999999999999999999999999986

>KOG4224\|consensus	Back alignment and domain information

>KOG1899\|consensus	Back alignment and domain information

>PLN03194 putative disease resistance protein; Provisional	Back alignment and domain information

>KOG0249\|consensus	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>smart00255 TIR Toll - interleukin 1 - resistance	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A	Back alignment and domain information

>KOG4224\|consensus	Back alignment and domain information

>KOG0166\|consensus	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>KOG0249\|consensus	Back alignment and domain information

>PF00536 SAM_1: SAM domain (Sterile alpha motif); InterPro: IPR021129 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes	Back alignment and domain information

>PF07647 SAM_2: SAM domain (Sterile alpha motif); InterPro: IPR011510 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes	Back alignment and domain information

>cd00166 SAM Sterile alpha motif	Back alignment and domain information

>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo	Back alignment and domain information

>smart00454 SAM Sterile alpha motif	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>KOG3678\|consensus	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG0166\|consensus	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG1048\|consensus	Back alignment and domain information

>PF07647 SAM_2: SAM domain (Sterile alpha motif); InterPro: IPR011510 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes	Back alignment and domain information

>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments	Back alignment and domain information

>KOG4375\|consensus	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>KOG1899\|consensus	Back alignment and domain information

>PF00536 SAM_1: SAM domain (Sterile alpha motif); InterPro: IPR021129 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>KOG4199\|consensus	Back alignment and domain information

>cd00166 SAM Sterile alpha motif	Back alignment and domain information

>KOG4384\|consensus	Back alignment and domain information

>KOG1170\|consensus	Back alignment and domain information

>smart00454 SAM Sterile alpha motif	Back alignment and domain information

>KOG4384\|consensus	Back alignment and domain information

>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless	Back alignment and domain information

>KOG2160\|consensus	Back alignment and domain information

>KOG4199\|consensus	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>KOG1048\|consensus	Back alignment and domain information

>KOG4374\|consensus	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>smart00185 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG2122\|consensus	Back alignment and domain information

>KOG4500\|consensus	Back alignment and domain information

>KOG4403\|consensus	Back alignment and domain information

>PF09235 Ste50p-SAM: Ste50p, sterile alpha motif; InterPro: IPR015316 The fungal Ste50p SAM domain consists of five helices, which form a compact, globular fold	Back alignment and domain information

>KOG4375\|consensus	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless	Back alignment and domain information

>KOG2122\|consensus	Back alignment and domain information

>KOG0196\|consensus	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>KOG0507\|consensus	Back alignment and domain information

>KOG2160\|consensus	Back alignment and domain information

>PF10137 TIR-like: Predicted nucleotide-binding protein containing TIR-like domain; InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins	Back alignment and domain information

>KOG4646\|consensus	Back alignment and domain information

>cd08532 SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointed domain of prostate-derived ETS factor	Back alignment and domain information

>smart00185 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments	Back alignment and domain information

>KOG0196\|consensus	Back alignment and domain information

>cd08757 SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed domain of ESE-like ETS transcriptional regulators	Back alignment and domain information

>PF02198 SAM_PNT: Sterile alpha motif (SAM)/Pointed domain; InterPro: IPR003118 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription []	Back alignment and domain information

>KOG4500\|consensus	Back alignment and domain information

>cd08541 SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed domain of friend leukemia integration 1 transcription activator	Back alignment and domain information

>cd08203 SAM_PNT Sterile alpha motif (SAM)/Pointed domain	Back alignment and domain information

>cd08540 SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed domain of ERG transcription factor	Back alignment and domain information

>cd08534 SAM_PNT-GABP-alpha Sterile alpha motif (SAM)/Pointed domain of GA-binding protein alpha chain	Back alignment and domain information

>smart00251 SAM_PNT SAM / Pointed domain	Back alignment and domain information

>cd08535 SAM_PNT-Tel_Yan Sterile alpha motif (SAM)/Pointed domain of Tel/Yan protein	Back alignment and domain information

>KOG1738\|consensus	Back alignment and domain information

>cd08538 SAM_PNT-ESE-2-like Sterile alpha motif (SAM)/Pointed domain of ESE-2 like ETS transcriptional regulators	Back alignment and domain information

>cd08531 SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointed domain of ERG (Ets related gene) and FLI-1 (Friend leukemia integration 1) transcription factors	Back alignment and domain information

>KOG4374\|consensus	Back alignment and domain information

>cd08533 SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed domain of ETS-1,2 family	Back alignment and domain information

>KOG1170\|consensus	Back alignment and domain information

>PF11841 DUF3361: Domain of unknown function (DUF3361)	Back alignment and domain information

>KOG1222\|consensus	Back alignment and domain information

>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle	Back alignment and domain information

>cd08542 SAM_PNT-ETS-1 Sterile alpha motif (SAM)/Pointed domain of ETS-1	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>cd08543 SAM_PNT-ETS-2 Sterile alpha motif (SAM)/Pointed domain of ETS-2	Back alignment and domain information

>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A	Back alignment and domain information

>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10	Back alignment and domain information

>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A	Back alignment and domain information

>KOG1222\|consensus	Back alignment and domain information

>cd08539 SAM_PNT-ESE-3-like Sterile alpha motif (SAM)/Pointed domain of ESE-3 like ETS transcriptional regulators	Back alignment and domain information

>cd08536 SAM_PNT-Mae Sterile alpha motif (SAM)/Pointed domain of Mae protein homolog	Back alignment and domain information

>PF13271 DUF4062: Domain of unknown function (DUF4062)	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF05014 Nuc_deoxyrib_tr: Nucleoside 2-deoxyribosyltransferase; InterPro: IPR007710 Nucleoside 2-deoxyribosyltransferase (2	Back alignment and domain information

>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4	Back alignment and domain information

>PF09597 IGR: IGR protein motif; InterPro: IPR019083 This entry is found in fungal and plant proteins and contains a conserved IGR motif	Back alignment and domain information

>PF05536 Neurochondrin: Neurochondrin	Back alignment and domain information

>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments	Back alignment and domain information

>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B	Back alignment and domain information

>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10	Back alignment and domain information

>KOG4413\|consensus	Back alignment and domain information

>cd08537 SAM_PNT-ESE-1-like Sterile alpha motif (SAM)/Pointed domain of ESE-1 like ETS transcriptional regulators	Back alignment and domain information

>KOG0168\|consensus	Back alignment and domain information

>KOG0946\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		979
3tac_B		334	Crystal Structure Of The Liprin-AlphaCASK COMPLEX L		6e-04
3tad_A		297	Crystal Structure Of The Liprin-AlphaLIPRIN-Beta Co		6e-04
1v85_A		91	Sterile Alpha Motif (Sam) Domain Of Mouse Bifunctio		8e-04

>pdb|3TAC|B Chain B, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 334

Back alignment and structure

Iteration: 1
 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 44/89 (49%), Gaps = 5/89 (5%)
Query: 504 QQVPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLL-LQLNEEH----LRDDIGIHNGI 558
           + V +WS + V  W++ IG  EYANN +ES V G L+ L  N ++    L   I   N  
Sbjct: 244 KDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQ 303
Query: 559 QRRRFERELQNLKKMADYSSKDVTNLNNF 587
            R+  ERE  NL  +      D ++  NF
Sbjct: 304 ARQILEREYNNLLALGTERRLDESDDKNF 332

PyMOL of 3tac

>pdb|3TAD|A Chain A, Crystal Structure Of The Liprin-AlphaLIPRIN-Beta Complex Length = 297

Back alignment and structure

>pdb|1V85|A Chain A, Sterile Alpha Motif (Sam) Domain Of Mouse Bifunctional Apoptosis Regulator Length = 91

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		979
3tad_C		265	Liprin-beta-1; protein binding; 2.90A {Mus musculu	7e-51
3tad_C		265	Liprin-beta-1; protein binding; 2.90A {Mus musculu	3e-07
2kiv_A		148	Ankyrin repeat and sterIle alpha motif domain- con	7e-29
2kiv_A		148	Ankyrin repeat and sterIle alpha motif domain- con	5e-06
3sei_A		149	Caskin-1; SAM domain, protein-protein interaction,	1e-25
2gle_A		74	Neurabin-1; SAM domain, scaffold, protein protein	1e-23
1v85_A		91	Similar to ring finger protein 36; apoptosis, neur	2e-22
1v85_A		91	Similar to ring finger protein 36; apoptosis, neur	1e-05
3tac_B		334	Liprin-alpha-2; transferase-protein binding comple	1e-20
3tac_B		334	Liprin-alpha-2; transferase-protein binding comple	3e-09
3tac_B		334	Liprin-alpha-2; transferase-protein binding comple	1e-06
3bq7_A		81	Diacylglycerol kinase delta; SAM domain, polymeriz	1e-19
3bq7_A		81	Diacylglycerol kinase delta; SAM domain, polymeriz	5e-04
1kw4_A		89	Polyhomeotic; SAM domain, polycomb group, polymer,	2e-19
2f3n_A		76	SH3 and multiple ankyrin repeat domains 3; postsyn	7e-19
3bs7_A		78	Protein aveugle; sterIle alpha motif (SAM) domain,	2e-16
3bs5_A		106	Protein aveugle; sterIle alpha motif, SAM domain,	7e-16
2e8o_A		103	SAM domain and HD domain-containing protein 1; cel	4e-15
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-14
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-12
3bs5_B		80	Connector enhancer of kinase suppressor of RAS 2;	2e-14
2ean_A		83	Connector enhancer of kinase suppressor of RAS 2;	4e-14
2ean_A		83	Connector enhancer of kinase suppressor of RAS 2;	7e-04
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	6e-14
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	4e-04
2dkz_A		84	Hypothetical protein LOC64762; cell-free protein s	2e-13
1pk1_B		89	Sex COMB on midleg CG9495-PA; hetero SAM domain, p	3e-12
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	1e-11
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	3e-11
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	1e-07
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	1e-06
3oqs_A		510	Importin subunit alpha-2; importin alpha, karyophe	4e-11
3oqs_A		510	Importin subunit alpha-2; importin alpha, karyophe	8e-04
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	6e-11
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	2e-10
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	5e-07
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	2e-06
2kso_A		82	Ephrin type-A receptor 2; SAM domain, heterodimer,	7e-11
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	2e-10
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	1e-09
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	1e-06
1wwv_A		91	Connector enhancer of kinase suppressor of RAS 1;	4e-10
2k4p_A		86	Phosphatidylinositol-3,4,5-trisphosphate 5- phosph	5e-10
2d8c_A		97	Phosphatidylcholine:ceramide cholinephosphotransfe	5e-10
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	1e-09
2qkq_A		83	Ephrin type-B receptor 4; ATP-binding, glycoprotei	2e-09
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	3e-09
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	2e-05
2ke7_A		103	Ankyrin repeat and sterIle alpha motif domain- con	4e-09
3ub2_A		146	TOLL/interleukin-1 receptor domain-containing ADA	4e-09
1b4f_A		82	EPHB2; SAM domain, EPH receptor, signal transducti	6e-09
2eao_A		99	Ephrin type-B receptor 1; cell-free protein synthe	6e-09
1ucv_A		81	Ephrin type-A receptor 8; receptor oligomerization	1e-08
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	2e-08
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	5e-07
3nmz_A		458	APC variant protein; protein-protein complex, arma	2e-08
2kg5_A		100	ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-	3e-08
3kka_C		86	Ephrin type-A receptor 2; ATP-binding, kinase, nuc	4e-08
1b0x_A		94	Protein (EPHA4 receptor tyrosine kinase); protein	5e-08
2eam_A		80	Putative 47 kDa protein; cell-free protein synthes	6e-08
3k1r_B		74	Usher syndrome type-1G protein; protein-protein co	7e-08
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	9e-08
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	6e-06
2e8n_A		88	Ephrin type-A receptor 2; cell-free protein synthe	1e-07
3h8m_A		90	Ephrin type-A receptor 7; SAM domain, kinase,struc	1e-07
2k60_A		150	Protein (stromal interaction molecule 1); EF-hand,	2e-07
3hil_A		82	Ephrin type-A receptor 1; ATP-binding, kinase, nuc	4e-07
1x40_A		91	ARAP2; ASAP-related protein2, GTPase activity, sig	4e-07
2lmr_A		101	ODIN, ankyrin repeat and SAM domain-containing pro	7e-07
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	1e-06
1v38_A		78	SAM-domain protein samsn-1; structural genomics, h	2e-06
2l5y_A		150	Stromal interaction molecule 2; EF-hand, SAM domai	2e-06
1ow5_A		85	Serine/threonine-protein kinase STE11; MAP kinase,	3e-06
2j67_A		178	TOLL like receptor 10; TIR, IL-1, TLR10, membrane,	8e-06
2dl0_A		97	SAM and SH3 domain-containing protein 1; cell-free	7e-05
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	2e-04
1fyx_A		149	TOLL-like receptor 2; beta-alpha-beta fold, signal	2e-04
3h16_A		154	TIR protein; bacteria TIR domain, signaling protei	7e-04
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	7e-04

>3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Length = 265	Back alignment and structure

 Score =  179 bits (454), Expect = 7e-51
 Identities = 42/259 (16%), Positives = 89/259 (34%), Gaps = 25/259 (9%)

Query: 500 HKLSQQVPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQ 559
             L      W+ E V  W+ + G   Y ++     + G  LLQ +++ L  ++GI + + 
Sbjct: 9   SDLDMPFAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLH 68

Query: 560 RRRFERELQNLKKMADYSSKDVTNLNNFLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQ 619
           R++ +  LQ L    + +   +                Y        VD   +  ++ + 
Sbjct: 69  RKKLQLALQALGSEEETNYGKLDFNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDD 128

Query: 620 LICECGIHNSIHRLRIMEAIHEIER-EWNKEY--------EDNPDKNLDVFISYRRSNGS 670
           L+    + + +H L I  AI  +    +                   +  + ++R     
Sbjct: 129 LL-SLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENSITPSEVQQWTNHRVMEWL 187

Query: 671 QLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQ------------ARNFLLVLT 718
           +   L +    LR   V   +  LE  +F+   +  +              A +F L++ 
Sbjct: 188 RSVDLAEYAPNLRGSGVHGGLMVLEP-RFNVETMAQLLNIPPNKTLLRRHLATHFNLLIG 246

Query: 719 PKALDRCMEDNESECKDWV 737
            +A  +  +    E  D+V
Sbjct: 247 AEAQHQKRDAM--ELPDYV 263

PyMOL of 3tad

>3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Length = 265	Back alignment and structure

>2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} Length = 148	Back alignment and structure

>2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} Length = 148	Back alignment and structure

>3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Length = 149	Back alignment and structure

>2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} Length = 74	Back alignment and structure

>1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 91	Back alignment and structure

>1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 91	Back alignment and structure

>3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A Length = 334	Back alignment and structure

>3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A Length = 334	Back alignment and structure

>3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A Length = 334	Back alignment and structure

>3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} Length = 81	Back alignment and structure

>3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} Length = 81	Back alignment and structure

>1kw4_A Polyhomeotic; SAM domain, polycomb group, polymer, DNA binding protein; 1.75A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk1_A Length = 89	Back alignment and structure

>2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A Length = 76	Back alignment and structure

>3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster} Length = 78	Back alignment and structure

>3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster} Length = 106	Back alignment and structure

>2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens} Length = 80	Back alignment and structure

>2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450	Back alignment and structure

>2dkz_A Hypothetical protein LOC64762; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 84	Back alignment and structure

>1pk1_B Sex COMB on midleg CG9495-PA; hetero SAM domain, polymers, transcriptional repression, transcription repression; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk3_A Length = 89	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510	Back alignment and structure

>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} Length = 82	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91	Back alignment and structure

>2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B Length = 86	Back alignment and structure

>2d8c_A Phosphatidylcholine:ceramide cholinephosphotransferase 1; cell-free protein synthesis, protein regulation, lipid metabolism, structural genomics; NMR {Mus musculus} SCOP: a.60.1.2 Length = 97	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210	Back alignment and structure

>2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} Length = 83	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810	Back alignment and structure

>2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} Length = 103	Back alignment and structure

>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146	Back alignment and structure

>1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A Length = 82	Back alignment and structure

>2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99	Back alignment and structure

>1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 81	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458	Back alignment and structure

>2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} Length = 100	Back alignment and structure

>3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} Length = 86	Back alignment and structure

>1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 Length = 94	Back alignment and structure

>2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80	Back alignment and structure

>3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} Length = 74	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530	Back alignment and structure

>2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} Length = 90	Back alignment and structure

>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Length = 150	Back alignment and structure

>3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A Length = 82	Back alignment and structure

>1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91	Back alignment and structure

>2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens} Length = 101	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584	Back alignment and structure

>1v38_A SAM-domain protein samsn-1; structural genomics, hypothetical protein, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.60.1.2 Length = 78	Back alignment and structure

>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Length = 150	Back alignment and structure

>1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A Length = 85	Back alignment and structure

>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178	Back alignment and structure

>2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457	Back alignment and structure

>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Length = 149	Back alignment and structure

>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		979
3tad_C		265	Liprin-beta-1; protein binding; 2.90A {Mus musculu	99.96
3tac_B		334	Liprin-alpha-2; transferase-protein binding comple	99.91
3sei_A		149	Caskin-1; SAM domain, protein-protein interaction,	99.9
3jrn_A		176	AT1G72930 protein; TIR domain arabidopsis thaliana	99.88
3ozi_A		204	L6TR; plant TIR domain, plant protein; 2.30A {Linu	99.87
2kiv_A		148	Ankyrin repeat and sterIle alpha motif domain- con	99.86
3tpo_A		529	Importin subunit alpha-2; nuclear import, protein	99.82
3ul1_B		510	Importin subunit alpha-2; arm repeat, armadillo re	99.81
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	99.8
3nmz_A		458	APC variant protein; protein-protein complex, arma	99.8
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	99.8
3h16_A		154	TIR protein; bacteria TIR domain, signaling protei	99.78
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	99.77
4hxt_A		252	De novo protein OR329; structural genomics, PSI-bi	99.75
3ul1_B		510	Importin subunit alpha-2; arm repeat, armadillo re	99.75
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	99.74
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	99.73
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	99.72
3nmz_A		458	APC variant protein; protein-protein complex, arma	99.71
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	99.71
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	99.71
3tpo_A		529	Importin subunit alpha-2; nuclear import, protein	99.7
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	99.7
3ub2_A		146	TOLL/interleukin-1 receptor domain-containing ADA	99.7
4hxt_A		252	De novo protein OR329; structural genomics, PSI-bi	99.69
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	99.69
4b8j_A		528	Importin subunit alpha-1A; transport protein, nucl	99.68
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	99.67
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	99.65
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	99.64
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	99.64
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	99.64
1fyx_A		149	TOLL-like receptor 2; beta-alpha-beta fold, signal	99.64
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	99.63
4b8j_A		528	Importin subunit alpha-1A; transport protein, nucl	99.63
2j67_A		178	TOLL like receptor 10; TIR, IL-1, TLR10, membrane,	99.62
2js7_A		160	Myeloid differentiation primary response protein M	99.61
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	99.6
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	99.6
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	99.6
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	99.57
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	99.57
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	99.56
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	99.55
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	99.54
1v85_A		91	Similar to ring finger protein 36; apoptosis, neur	99.53
1t3g_A		159	X-linked interleukin-1 receptor accessory protein-	99.52
2gle_A		74	Neurabin-1; SAM domain, scaffold, protein protein	99.52
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	99.51
3bs7_A		78	Protein aveugle; sterIle alpha motif (SAM) domain,	99.51
2d8c_A		97	Phosphatidylcholine:ceramide cholinephosphotransfe	99.5
3bq7_A		81	Diacylglycerol kinase delta; SAM domain, polymeriz	99.5
2e8o_A		103	SAM domain and HD domain-containing protein 1; cel	99.5
3bs5_B		80	Connector enhancer of kinase suppressor of RAS 2;	99.49
2f3n_A		76	SH3 and multiple ankyrin repeat domains 3; postsyn	99.49
3bs5_A		106	Protein aveugle; sterIle alpha motif, SAM domain,	99.46
2ean_A		83	Connector enhancer of kinase suppressor of RAS 2;	99.45
1kw4_A		89	Polyhomeotic; SAM domain, polycomb group, polymer,	99.44
3opb_A		778	SWI5-dependent HO expression protein 4; heat and a	99.4
1pk1_B		89	Sex COMB on midleg CG9495-PA; hetero SAM domain, p	99.35
2ke7_A		103	Ankyrin repeat and sterIle alpha motif domain- con	99.34
1wwv_A		91	Connector enhancer of kinase suppressor of RAS 1;	99.33
3tad_C		265	Liprin-beta-1; protein binding; 2.90A {Mus musculu	99.32
3opb_A		778	SWI5-dependent HO expression protein 4; heat and a	99.31
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.26
3tac_B		334	Liprin-alpha-2; transferase-protein binding comple	99.24
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	99.22
2kso_A		82	Ephrin type-A receptor 2; SAM domain, heterodimer,	99.19
2qkq_A		83	Ephrin type-B receptor 4; ATP-binding, glycoprotei	99.14
1b4f_A		82	EPHB2; SAM domain, EPH receptor, signal transducti	99.13
2e8n_A		88	Ephrin type-A receptor 2; cell-free protein synthe	99.11
2kg5_A		100	ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-	99.11
2eam_A		80	Putative 47 kDa protein; cell-free protein synthes	99.11
1ucv_A		81	Ephrin type-A receptor 8; receptor oligomerization	99.09
3h8m_A		90	Ephrin type-A receptor 7; SAM domain, kinase,struc	99.08
2k4p_A		86	Phosphatidylinositol-3,4,5-trisphosphate 5- phosph	99.08
2dl0_A		97	SAM and SH3 domain-containing protein 1; cell-free	99.08
2eao_A		99	Ephrin type-B receptor 1; cell-free protein synthe	99.01
3hil_A		82	Ephrin type-A receptor 1; ATP-binding, kinase, nuc	99.0
1b0x_A		94	Protein (EPHA4 receptor tyrosine kinase); protein	99.0
3kka_C		86	Ephrin type-A receptor 2; ATP-binding, kinase, nuc	98.99
3k1r_B		74	Usher syndrome type-1G protein; protein-protein co	98.98
1ow5_A		85	Serine/threonine-protein kinase STE11; MAP kinase,	98.95
1x40_A		91	ARAP2; ASAP-related protein2, GTPase activity, sig	98.93
1v38_A		78	SAM-domain protein samsn-1; structural genomics, h	98.91
1uqv_A		85	STE50 protein; SAM, sterIle alpha motif, helical,	98.89
2dkz_A		84	Hypothetical protein LOC64762; cell-free protein s	98.88
2lmr_A		101	ODIN, ankyrin repeat and SAM domain-containing pro	98.85
2l5y_A		150	Stromal interaction molecule 2; EF-hand, SAM domai	98.78
3sei_A		149	Caskin-1; SAM domain, protein-protein interaction,	98.77
2k60_A		150	Protein (stromal interaction molecule 1); EF-hand,	98.76
2kiv_A		148	Ankyrin repeat and sterIle alpha motif domain- con	98.63
1ucv_A		81	Ephrin type-A receptor 8; receptor oligomerization	98.59
1v38_A		78	SAM-domain protein samsn-1; structural genomics, h	98.58
2kg5_A		100	ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-	98.58
2ke7_A		103	Ankyrin repeat and sterIle alpha motif domain- con	98.57
1b4f_A		82	EPHB2; SAM domain, EPH receptor, signal transducti	98.56
2dl0_A		97	SAM and SH3 domain-containing protein 1; cell-free	98.55
2k4p_A		86	Phosphatidylinositol-3,4,5-trisphosphate 5- phosph	98.54
2kso_A		82	Ephrin type-A receptor 2; SAM domain, heterodimer,	98.54
3hil_A		82	Ephrin type-A receptor 1; ATP-binding, kinase, nuc	98.52
3h8m_A		90	Ephrin type-A receptor 7; SAM domain, kinase,struc	98.51
2f3n_A		76	SH3 and multiple ankyrin repeat domains 3; postsyn	98.51
2qkq_A		83	Ephrin type-B receptor 4; ATP-binding, glycoprotei	98.5
2e8n_A		88	Ephrin type-A receptor 2; cell-free protein synthe	98.48
1b0x_A		94	Protein (EPHA4 receptor tyrosine kinase); protein	98.47
1x40_A		91	ARAP2; ASAP-related protein2, GTPase activity, sig	98.47
3bq7_A		81	Diacylglycerol kinase delta; SAM domain, polymeriz	98.47
2eao_A		99	Ephrin type-B receptor 1; cell-free protein synthe	98.46
1eiw_A		111	Hypothetical protein MTH538; CHEY-like fold, flavo	98.46
2eam_A		80	Putative 47 kDa protein; cell-free protein synthes	98.46
3kka_C		86	Ephrin type-A receptor 2; ATP-binding, kinase, nuc	98.45
2gle_A		74	Neurabin-1; SAM domain, scaffold, protein protein	98.43
2lmr_A		101	ODIN, ankyrin repeat and SAM domain-containing pro	98.43
3bs5_B		80	Connector enhancer of kinase suppressor of RAS 2;	98.42
3k1r_B		74	Usher syndrome type-1G protein; protein-protein co	98.39
2ean_A		83	Connector enhancer of kinase suppressor of RAS 2;	98.37
2d3d_A		88	VTS1 protein; RNA binding, SAM domain, SRE hairpin	98.35
3bs7_A		78	Protein aveugle; sterIle alpha motif (SAM) domain,	98.34
2eap_A		90	Lymphocyte cytosolic protein 2; cell-free protein	98.34
3grl_A		651	General vesicular transport factor P115; vesicle t	98.32
3ltm_A		211	Alpha-REP4; protein engineering, heat-like repeat,	98.31
3grl_A		651	General vesicular transport factor P115; vesicle t	98.29
2b6g_A		119	VTS1P; alpha-helix, pentaloop, hairpin, RNA bindin	98.29
1v85_A		91	Similar to ring finger protein 36; apoptosis, neur	98.27
3bs5_A		106	Protein aveugle; sterIle alpha motif, SAM domain,	98.24
1ow5_A		85	Serine/threonine-protein kinase STE11; MAP kinase,	98.24
2es6_A		101	VTS1P; SAM domain, protein structure, gene regulat	98.21
2e8o_A		103	SAM domain and HD domain-containing protein 1; cel	98.16
2y9u_A		69	Tumor protein 63; apoptosis, sterIle alpha motif,	98.07
1wwv_A		91	Connector enhancer of kinase suppressor of RAS 1;	98.02
2y9t_A		82	Tumor protein 63; apoptosis, sterIle alpha motif,	98.01
2y9u_A		69	Tumor protein 63; apoptosis, sterIle alpha motif,	97.98
1kw4_A		89	Polyhomeotic; SAM domain, polycomb group, polymer,	97.89
2d8c_A		97	Phosphatidylcholine:ceramide cholinephosphotransfe	97.87
2y9t_A		82	Tumor protein 63; apoptosis, sterIle alpha motif,	97.86
4gmo_A		684	Putative uncharacterized protein; ARM, heat, solen	97.82
1oyz_A		280	Hypothetical protein YIBA; structural genomics, PS	97.78
1oxj_A		173	RNA-binding protein smaug; SAM domain, PHAT domain	97.73
3ltj_A		201	Alpharep-4; protein engineering, heat-like repeat,	97.71
3ltj_A		201	Alpharep-4; protein engineering, heat-like repeat,	97.5
2d3d_A		88	VTS1 protein; RNA binding, SAM domain, SRE hairpin	97.5
1pk1_B		89	Sex COMB on midleg CG9495-PA; hetero SAM domain, p	97.33
2qar_B		93	Telsam domain; polymer, crystallization modules, s	97.28
2es6_A		101	VTS1P; SAM domain, protein structure, gene regulat	97.27
2b6g_A		119	VTS1P; alpha-helix, pentaloop, hairpin, RNA bindin	97.25
3ltm_A		211	Alpha-REP4; protein engineering, heat-like repeat,	97.22
1oyz_A		280	Hypothetical protein YIBA; structural genomics, PS	97.22
4gmo_A		684	Putative uncharacterized protein; ARM, heat, solen	97.19
3hyn_A		189	Putative signal transduction protein; DUF1863 fami	96.84
1ji7_A		89	ETS-related protein TEL1; helical polymer, transcr	96.8
1oxj_A		173	RNA-binding protein smaug; SAM domain, PHAT domain	96.66
1b3u_A		588	Protein (protein phosphatase PP2A); scaffold prote	96.6
1sv0_C		82	Modulator of the activity of ETS CG15085-PA; alpha	96.54
1b3u_A		588	Protein (protein phosphatase PP2A); scaffold prote	96.4
2dkz_A		84	Hypothetical protein LOC64762; cell-free protein s	96.4
1te4_A		131	Conserved protein MTH187; methanobacterium thermoa	96.31
3b2a_A		265	TON_1937, putative uncharacterized protein; heat-r	95.96
2vgl_B		591	AP-2 complex subunit beta-1; cytoplasmic vesicle,	95.76
2vgl_B		591	AP-2 complex subunit beta-1; cytoplasmic vesicle,	95.68
3dad_A		339	FH1/FH2 domain-containing protein 1; formin, FHOD1	95.45
1te4_A		131	Conserved protein MTH187; methanobacterium thermoa	95.34
2l5y_A		150	Stromal interaction molecule 2; EF-hand, SAM domai	94.89
4fdd_A		852	Transportin-1; heat repeats, karyopherin, nuclear	94.85
2k60_A		150	Protein (stromal interaction molecule 1); EF-hand,	94.8
4fdd_A		852	Transportin-1; heat repeats, karyopherin, nuclear	94.13
4ady_A		963	RPN2, 26S proteasome regulatory subunit RPN2; prot	94.06
2f62_A		161	Nucleoside 2-deoxyribosyltransferase; SGPP, struct	93.89
1x66_A		98	Friend leukemia integration 1 transcription factor	93.48
1sxe_A		97	Transcriptional regulator ERG; alpha helical, sign	93.42
2e8m_A		99	Epidermal growth factor receptor kinase substrate	93.12
1sv0_A		85	ETS DNA-binding protein pokkuri; alpha-helix, 3(10	93.1
1wwu_A		99	Hypothetical protein FLJ21935; structural genomics	92.67
1uqv_A		85	STE50 protein; SAM, sterIle alpha motif, helical,	92.51
1dxs_A		80	P53-like transcription factor; P73 SAM-like domain	92.45
1ibr_B		462	P95, importin beta-1 subunit, nuclear factor; smal	92.05
1sxd_A		91	GA repeat binding protein, alpha; alpha helical, t	91.79
2qk2_A		242	LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2	91.44
2dkx_A		96	SAM pointed domain-containing ETS transcription fa	91.32
3idw_A		72	Actin cytoskeleton-regulatory complex protein SLA;	90.73
2ytu_A		128	Friend leukemia integration 1 transcription factor	90.13
2jv3_A		110	ETS1 proto-oncogene; ETS-1 pointed (PNT) domain, M	90.04
2e8p_A		92	ELF3 protein; cell-free protein synthesis, protein	89.44
2qk1_A		249	Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h	89.15
1w63_A		618	Adapter-related protein complex 1 gamma 1 subunit;	88.94
3tjz_B		355	Coatomer subunit gamma; protein trafficking, golgi	88.39
1w63_A		618	Adapter-related protein complex 1 gamma 1 subunit;	87.95
1ibr_B		462	P95, importin beta-1 subunit, nuclear factor; smal	86.53
3ehd_A		162	Uncharacterized conserved protein; PSI,MCSG,PF0501	86.24
2khz_A		165	C-MYC-responsive protein RCL; flexible loop, nucle	84.33
4fyk_A		152	Deoxyribonucleoside 5'-monophosphate N-glycosidas;	83.62
1qgr_A		876	Protein (importin beta subunit); transport recepto	83.47
1dxs_A		80	P53-like transcription factor; P73 SAM-like domain	83.15
2vgl_A		621	Adaptor protein complex AP-2, alpha 2 subunit; cyt	81.35
2qb0_B		241	Telsam domain - lysozyme chimera; helical polymer,	80.66
4ady_A		963	RPN2, 26S proteasome regulatory subunit RPN2; prot	80.02

>3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus}	Back alignment and structure

Probab=99.96  E-value=1.1e-30  Score=278.66  Aligned_cols=232  Identities=20%  Similarity=0.334  Sum_probs=192.1

Q ss_pred             cCcCCCCCCCCCHHHHHHHHHHcCchHHHHHHHhcCCChhHHhcCChhhhccccCCCChHHHHHHHHHHHHHHhhc--cc
Q psy4858         499 PHKLSQQVPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFERELQNLKKMA--DY  576 (979)
Q Consensus       499 p~kl~~~V~~WS~EDVa~WL~~IGL~eY~~~F~en~IDG~~LL~LTeeDL~~dLGI~n~ghRKrLlreI~~Lk~~~--~y  576 (979)
                      .+....++..|+.++|+.||+.+||++|++.|.+|.+||..|+.||++||+.+|||++++|||||+++|++|+...  .|
T Consensus         8 ~~~~~~p~~~W~~e~V~~WLe~~GL~~Y~~~f~~n~~dG~~Ll~lt~~dLe~eLGI~nplHRkKL~laI~el~~~~~~~~   87 (265)
T 3tad_C            8 NSDLDMPFAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNY   87 (265)
T ss_dssp             ------CGGGSCHHHHHHHHHHTTCCTTHHHHTTTCSCSHHHHHSCHHHHHHHTCCCSHHHHHHHHHHHHHHHHCSCCSG
T ss_pred             CCCCCCChhhCChHHHHHHHHHHCHHHHHHHHHHhCCchHHHHhCCHHHHHHHhCCCCHHHHHHHHHHHHHhcccccccc
Confidence            3445568999999999999999999999999999999999999999999988999999999999999999999643  56


Q ss_pred             CCCCccChHHHhhhcCCCcchhHHHHHhcCCCchhhhccCHHHHHHHcCCCcchhHHHHHHHHHhhhhccccccCCCCCC
Q psy4858         577 SSKDVTNLNNFLLNLGQEFSIYTYSMLNAGVDKDSIKALSEEQLICECGIHNSIHRLRIMEAIHEIEREWNKEYEDNPDK  656 (979)
Q Consensus       577 ss~d~~~l~ewL~~IGpel~qYtys~l~~GvD~~~L~~LT~edL~~~cgItn~~Hr~rIl~AIk~l~~~~~~~~~~~~~~  656 (979)
                      +..++.++.+||.+||  |+||++.|.+++||+++|..||++||. +|||++.+||.+|+.||+.|+... ++       
T Consensus        88 ~~~d~~wv~~WL~~IG--L~QY~~~F~~~~iDg~~L~~LT~~DL~-~LGIt~~~HR~kil~aI~~L~~~~-~d-------  156 (265)
T 3tad_C           88 GKLDFNWVTRWLDDIG--LPQYKTQFDEGRVDGRMLHYMTVDDLL-SLKVVSVLHHLSIKRAIQVLRINN-FE-------  156 (265)
T ss_dssp             GGCCHHHHHHHHHHHT--CGGGHHHHHHHTCCHHHHHTCBHHHHH-HTTCCBHHHHHHHHHHHHHHHHTT-TC-------
T ss_pred             cccChHHHHHHHHHcC--cHHHHHHHHHcCCCHHHhcccCHHHHH-HcCCCcHHhHHHHHHHHHHHhhcC-CC-------
Confidence            7888999999999999  999999999999999999999999999 799999999999999999998654 22       


Q ss_pred             CCCeeEecccCCccchHHHHHHHHHhcCCceEeecccCCCCcchHHHHHHHHhCCEEEEEECcccchhhccc--CCCcCC
Q psy4858         657 NLDVFISYRRSNGSQLASLLKVHLELRQFKVFIDVERLEAGKFDNNLLQSIKQARNFLLVLTPKALDRCMED--NESECK  734 (979)
Q Consensus       657 ~yDVFISYRR~Dg~~~As~L~e~Le~~G~rVFiD~~~Ie~Gdf~~~L~~aI~~SrvfIvVLSp~~l~~~~~~--~i~~~S  734 (979)
                       ++... =|+.|..+.  ...+.+.|...+|.-+.++|...+|+++|.++..+..  ++|+.|.|-...+..  .|+..+
T Consensus       157 -~~~L~-rr~~~~~~~--~~~~v~~Wtn~rv~~Wl~~i~L~eya~NL~~sGvhGa--l~~le~~F~~~~lA~~L~iP~~k  230 (265)
T 3tad_C          157 -PNCLR-RRPSDENSI--TPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGG--LMVLEPRFNVETMAQLLNIPPNK  230 (265)
T ss_dssp             -TTSSS-CCCCSGGGS--SGGGGGGCCHHHHHHHHHHTTCTTTGGGGTTSCCCHH--HHHHCTTCCHHHHHHHTTCCTTC
T ss_pred             -HHHHH-hccccccCC--CcccccccchHHHHHHHHhCCHHHHHhHhhhcCccch--hhhccCCCCHHHHHHHhCCCCCc
Confidence             11121 122221111  1235578889999999999999999999999888877  788999875443333  688999


Q ss_pred             hhHHHHHHHHHhc
Q psy4858         735 DWVHREIVAALQS  747 (979)
Q Consensus       735 dWV~rEL~~Al~~  747 (979)
                      +-.|+.|++-++.
T Consensus       231 ~~~rrhl~~~f~~  243 (265)
T 3tad_C          231 TLLRRHLATHFNL  243 (265)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHH
Confidence            9999999887653

PyMOL of 3tad

>3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A	Back alignment and structure

>3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A	Back alignment and structure

>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum}	Back alignment and structure

>2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens}	Back alignment and structure

>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B	Back alignment and structure

>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ...	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens}	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A	Back alignment and structure

>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222}	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24	Back alignment and structure

>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}	Back alignment and structure

>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ...	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster}	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct}	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens}	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster}	Back alignment and structure

>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A	Back alignment and structure

>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A	Back alignment and structure

>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct}	Back alignment and structure

>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A	Back alignment and structure

>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A	Back alignment and structure

>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A	Back alignment and structure

>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A	Back alignment and structure

>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A*	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens}	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens}	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio}	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	Back alignment and structure

>1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus}	Back alignment and structure

>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens}	Back alignment and structure

>2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus}	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio}	Back alignment and structure

>3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster}	Back alignment and structure

>2d8c_A Phosphatidylcholine:ceramide cholinephosphotransferase 1; cell-free protein synthesis, protein regulation, lipid metabolism, structural genomics; NMR {Mus musculus} SCOP: a.60.1.2	Back alignment and structure

>3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens}	Back alignment and structure

>2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens}	Back alignment and structure

>2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A	Back alignment and structure

>3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster}	Back alignment and structure

>2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1kw4_A Polyhomeotic; SAM domain, polycomb group, polymer, DNA binding protein; 1.75A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk1_A	Back alignment and structure

>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>1pk1_B Sex COMB on midleg CG9495-PA; hetero SAM domain, polymers, transcriptional repression, transcription repression; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk3_A	Back alignment and structure

>2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens}	Back alignment and structure

>1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2	Back alignment and structure

>3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus}	Back alignment and structure

>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A*	Back alignment and structure

>2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens}	Back alignment and structure

>2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens}	Back alignment and structure

>1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A	Back alignment and structure

>2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2	Back alignment and structure

>3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens}	Back alignment and structure

>2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B	Back alignment and structure

>2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A	Back alignment and structure

>1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2	Back alignment and structure

>3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} SCOP: a.60.1.0	Back alignment and structure

>3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens}	Back alignment and structure

>1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A	Back alignment and structure

>1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2	Back alignment and structure

>1v38_A SAM-domain protein samsn-1; structural genomics, hypothetical protein, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.60.1.2	Back alignment and structure

>1uqv_A STE50 protein; SAM, sterIle alpha motif, helical, protein-protein interaction domain, growth arrest, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1z1v_A	Back alignment and structure

>2dkz_A Hypothetical protein LOC64762; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens}	Back alignment and structure

>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A	Back alignment and structure

>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens}	Back alignment and structure

>2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens}	Back alignment and structure

>1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2	Back alignment and structure

>1v38_A SAM-domain protein samsn-1; structural genomics, hypothetical protein, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.60.1.2	Back alignment and structure

>2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens}	Back alignment and structure

>1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A	Back alignment and structure

>2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B	Back alignment and structure

>2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens}	Back alignment and structure

>3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A	Back alignment and structure

>3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens}	Back alignment and structure

>2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A	Back alignment and structure

>2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens}	Back alignment and structure

>2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2	Back alignment and structure

>1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2	Back alignment and structure

>3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens}	Back alignment and structure

>2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1	Back alignment and structure

>2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} SCOP: a.60.1.0	Back alignment and structure

>2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus}	Back alignment and structure

>2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens}	Back alignment and structure

>3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens}	Back alignment and structure

>3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens}	Back alignment and structure

>2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d3d_A VTS1 protein; RNA binding, SAM domain, SRE hairpin binding, RNA binding protein; 1.60A {Saccharomyces cerevisiae} PDB: 2f8k_A 2fe9_A	Back alignment and structure

>3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster}	Back alignment and structure

>2eap_A Lymphocyte cytosolic protein 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A	Back alignment and structure

>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic}	Back alignment and structure

>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A	Back alignment and structure

>2b6g_A VTS1P; alpha-helix, pentaloop, hairpin, RNA binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus}	Back alignment and structure

>3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster}	Back alignment and structure

>1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A	Back alignment and structure

>2es6_A VTS1P; SAM domain, protein structure, gene regulation; NMR {Saccharomyces cerevisiae} PDB: 2ese_A	Back alignment and structure

>2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2y9u_A Tumor protein 63; apoptosis, sterIle alpha motif, 5-helix bundle, mutations, A syndrome; 1.60A {Homo sapiens} PDB: 1rg6_A	Back alignment and structure

>1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2	Back alignment and structure

>2y9t_A Tumor protein 63; apoptosis, sterIle alpha motif, 5-helix bundle; NMR {Homo sapiens}	Back alignment and structure

>2y9u_A Tumor protein 63; apoptosis, sterIle alpha motif, 5-helix bundle, mutations, A syndrome; 1.60A {Homo sapiens} PDB: 1rg6_A	Back alignment and structure

>1kw4_A Polyhomeotic; SAM domain, polycomb group, polymer, DNA binding protein; 1.75A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk1_A	Back alignment and structure

>2d8c_A Phosphatidylcholine:ceramide cholinephosphotransferase 1; cell-free protein synthesis, protein regulation, lipid metabolism, structural genomics; NMR {Mus musculus} SCOP: a.60.1.2	Back alignment and structure

>2y9t_A Tumor protein 63; apoptosis, sterIle alpha motif, 5-helix bundle; NMR {Homo sapiens}	Back alignment and structure

>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A	Back alignment and structure

>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16	Back alignment and structure

>1oxj_A RNA-binding protein smaug; SAM domain, PHAT domain; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 a.118.1.13	Back alignment and structure

>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic}	Back alignment and structure

>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic}	Back alignment and structure

>2d3d_A VTS1 protein; RNA binding, SAM domain, SRE hairpin binding, RNA binding protein; 1.60A {Saccharomyces cerevisiae} PDB: 2f8k_A 2fe9_A	Back alignment and structure

>1pk1_B Sex COMB on midleg CG9495-PA; hetero SAM domain, polymers, transcriptional repression, transcription repression; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk3_A	Back alignment and structure

>2qar_B Telsam domain; polymer, crystallization modules, sterIle alpha motif, hydro regulator; 2.40A {Escherichia coli}	Back alignment and structure

>2es6_A VTS1P; SAM domain, protein structure, gene regulation; NMR {Saccharomyces cerevisiae} PDB: 2ese_A	Back alignment and structure

>2b6g_A VTS1P; alpha-helix, pentaloop, hairpin, RNA binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic}	Back alignment and structure

>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16	Back alignment and structure

>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A	Back alignment and structure

>3hyn_A Putative signal transduction protein; DUF1863 family protein, nucleotide-binding protein, structur genomics; HET: MSE; 1.20A {Eubacterium rectale atcc 33656}	Back alignment and structure

>1ji7_A ETS-related protein TEL1; helical polymer, transcription; 1.45A {Homo sapiens} SCOP: a.60.1.1 PDB: 2qar_A 2qb0_A 1lky_A 1lky_B 2qb1_A	Back alignment and structure

>1oxj_A RNA-binding protein smaug; SAM domain, PHAT domain; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 a.118.1.13	Back alignment and structure

>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A	Back alignment and structure

>1sv0_C Modulator of the activity of ETS CG15085-PA; alpha-helix, 3(10) helix, transcription; 2.07A {Drosophila melanogaster} SCOP: a.60.1.1	Back alignment and structure

>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A	Back alignment and structure

>2dkz_A Hypothetical protein LOC64762; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16	Back alignment and structure

>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus}	Back alignment and structure

>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B	Back alignment and structure

>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B	Back alignment and structure

>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens}	Back alignment and structure

>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16	Back alignment and structure

>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B*	Back alignment and structure

>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens}	Back alignment and structure

>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B*	Back alignment and structure

>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N	Back alignment and structure

>2f62_A Nucleoside 2-deoxyribosyltransferase; SGPP, structural genomics, PSI, S genomics of pathogenic protozoa consortium; HET: 12M; 1.50A {Trypanosoma brucei} SCOP: c.23.14.1 PDB: 2a0k_A* 2f2t_A* 2f64_A* 2f67_A*	Back alignment and structure

>1x66_A Friend leukemia integration 1 transcription factor; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1sxe_A Transcriptional regulator ERG; alpha helical, signaling protein; NMR {Homo sapiens} SCOP: a.60.1.1	Back alignment and structure

>2e8m_A Epidermal growth factor receptor kinase substrate 8; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1sv0_A ETS DNA-binding protein pokkuri; alpha-helix, 3(10) helix, transcription; 2.07A {Drosophila melanogaster} SCOP: a.60.1.1 PDB: 1sv4_A	Back alignment and structure

>1wwu_A Hypothetical protein FLJ21935; structural genomics, protein regulation, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens}	Back alignment and structure

>1uqv_A STE50 protein; SAM, sterIle alpha motif, helical, protein-protein interaction domain, growth arrest, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1z1v_A	Back alignment and structure

>1dxs_A P53-like transcription factor; P73 SAM-like domain, gene regulation, P53 P63 homologue, sterIle alpha motif, tumour supressor; 2.54A {Homo sapiens} SCOP: a.60.1.2 PDB: 1cok_A	Back alignment and structure

>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A	Back alignment and structure

>1sxd_A GA repeat binding protein, alpha; alpha helical, transcription, signaling protein; NMR {Mus musculus} SCOP: a.60.1.1	Back alignment and structure

>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster}	Back alignment and structure

>2dkx_A SAM pointed domain-containing ETS transcription factor; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3idw_A Actin cytoskeleton-regulatory complex protein SLA; clathrin adaptor, endocytosis, SAM domain, yeast, actin-BIND membrane, endosome; 1.85A {Saccharomyces cerevisiae}	Back alignment and structure

>2ytu_A Friend leukemia integration 1 transcription factor; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jv3_A ETS1 proto-oncogene; ETS-1 pointed (PNT) domain, MAP kinase phosphorylation site, alpha-helical bundle, transcription factor, DNA-binding, nucleus; NMR {Mus musculus} PDB: 2kmd_A*	Back alignment and structure

>2e8p_A ELF3 protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus}	Back alignment and structure

>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A	Back alignment and structure

>3ehd_A Uncharacterized conserved protein; PSI,MCSG,PF05014, structural genomics, protein structure INI midwest center for structural genomics; HET: MSE; 2.15A {Enterococcus faecalis}	Back alignment and structure

>2khz_A C-MYC-responsive protein RCL; flexible loop, nucleus, phosphoprotein, nuclear protein; NMR {Rattus norvegicus} PDB: 2klh_A*	Back alignment and structure

>4fyk_A Deoxyribonucleoside 5'-monophosphate N-glycosidas; hydrolas; HET: SRA; 1.79A {Rattus norvegicus} PDB: 4fyh_A* 4fyi_A* 2klh_A*	Back alignment and structure

>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A	Back alignment and structure

>1dxs_A P53-like transcription factor; P73 SAM-like domain, gene regulation, P53 P63 homologue, sterIle alpha motif, tumour supressor; 2.54A {Homo sapiens} SCOP: a.60.1.2 PDB: 1cok_A	Back alignment and structure

>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A	Back alignment and structure

>2qb0_B Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli}	Back alignment and structure

>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		979
d2f3na1		64	a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat	5e-15
d2f3na1		64	a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat	0.001
d1kw4a_		70	a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaste	2e-13
d2d8ca1		85	a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {	4e-13
d1pk3a1		63	a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly	2e-12
d1pk3a1		63	a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly	0.002
d1b4fa_		74	a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens)	4e-11
d1v38a_		78	a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (M	1e-10
d1b0xa_		72	a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mou	3e-10
d1b0xa_		72	a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mou	0.001
d1wwva1		78	a.60.1.2 (A:8-85) Connector enhancer of kinase sup	8e-10
d1ucva_		81	a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal	9e-10
d1oxja1		62	a.60.1.2 (A:594-655) RNA-binding protein Smaug {Dr	6e-09
d1x40a1		78	a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human	2e-07
d1fyva_		161	c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H	3e-07
d1fyxa_		149	c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H	4e-07
d1ow5a_		60	a.60.1.2 (A:) Serine/threonine-protein kinase ste1	6e-06
d1dxsa_		57	a.60.1.2 (A:) C-terminal domain of p73 {Human (Hom	3e-04
d1xm9a1		457	a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo	0.003

>d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} Length = 64	Back information, alignment and structure


class: All alpha proteins
fold: SAM domain-like
superfamily: SAM/Pointed domain
family: SAM (sterile alpha motif) domain
domain: Sh3 and multiple ankyrin repeat domains 3 (Shank3)
species: Rat(Rattus norvegicus) [TaxId: 10116]

 Score = 68.0 bits (166), Expect = 5e-15
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 506 VPLWSTEDVREWVRQIGFAEYANNFVESRVDGDLLLQLNEEHLRDDIGIHNGIQRRRFER 565
           + LWS  DV +W+  I   E+ + F +  ++G  L  L +E    ++G+     R   ER
Sbjct: 1   LQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFV-ELGVTRVGHRENIER 59

Query: 566 ELQNL 570
            L+ L
Sbjct: 60  ALRQL 64

PyMOL of d2f3na1

>d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} Length = 64	Back information, alignment and structure

>d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} Length = 70	Back information, alignment and structure

>d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85	Back information, alignment and structure

>d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 63	Back information, alignment and structure

>d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 63	Back information, alignment and structure

>d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 78	Back information, alignment and structure

>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} Length = 72	Back information, alignment and structure

>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} Length = 72	Back information, alignment and structure

>d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78	Back information, alignment and structure

>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Drosophila melanogaster [TaxId: 7227]} Length = 62	Back information, alignment and structure

>d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} Length = 78	Back information, alignment and structure

>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161	Back information, alignment and structure

>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149	Back information, alignment and structure

>d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60	Back information, alignment and structure

>d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]} Length = 57	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		979
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	99.7
d1fyva_		161	Toll-like receptor 1, TLR1 {Human (Homo sapiens) [	99.67
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	99.61
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	99.6
d1fyxa_		149	Toll-like receptor 2, TLR2 {Human (Homo sapiens) [	99.59
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	99.54
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	99.54
d1wwva1		78	Connector enhancer of kinase suppressor of Ras 1,	99.51
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	99.51
d2f3na1		64	Sh3 and multiple ankyrin repeat domains 3 (Shank3)	99.5
d2d8ca1		85	Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculu	99.48
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	99.48
d1kw4a_		70	Polyhomeotic {Drosophila melanogaster [TaxId: 7227	99.44
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	99.43
d1pk3a1		63	Polycomb protein Scm {Fruit fly (Drosophila melano	99.34
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	99.3
d1v38a_		78	Sam-domain protein samsn-1 {Mouse (Mus musculus) [	99.28
d1b4fa_		74	EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]	99.27
d1ow5a_		60	Serine/threonine-protein kinase ste11 {Baker's yea	99.26
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	99.26
d1b0xa_		72	EphA4 receptor tyrosine kinases {Mouse (Mus muscul	99.18
d1x40a1		78	Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [Ta	99.16
d1ucva_		81	Ephrin type-A receptor 8, C-terminal domain {Human	99.15
d1oxja1		62	RNA-binding protein Smaug {Drosophila melanogaster	99.04
d1dxsa_		57	C-terminal domain of p73 {Human (Homo sapiens) [Ta	98.92
d1ow5a_		60	Serine/threonine-protein kinase ste11 {Baker's yea	98.68
d1b4fa_		74	EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]	98.67
d1ucva_		81	Ephrin type-A receptor 8, C-terminal domain {Human	98.66
d1dxsa_		57	C-terminal domain of p73 {Human (Homo sapiens) [Ta	98.66
d1v38a_		78	Sam-domain protein samsn-1 {Mouse (Mus musculus) [	98.62
d2f3na1		64	Sh3 and multiple ankyrin repeat domains 3 (Shank3)	98.57
d1b0xa_		72	EphA4 receptor tyrosine kinases {Mouse (Mus muscul	98.56
d1x40a1		78	Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [Ta	98.47
d1wwva1		78	Connector enhancer of kinase suppressor of Ras 1,	98.37
d1oxja1		62	RNA-binding protein Smaug {Drosophila melanogaster	98.33
d2d8ca1		85	Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculu	98.08
d1pk3a1		63	Polycomb protein Scm {Fruit fly (Drosophila melano	97.95
d1kw4a_		70	Polyhomeotic {Drosophila melanogaster [TaxId: 7227	97.9
d1b3ua_		588	Constant regulatory domain of protein phosphatase	97.0
d1oyza_		276	Hypothetical protein YibA {Escherichia coli [TaxId	96.74
d1z1va1		70	Ste50p, N-terminal domain {Baker's yeast (Saccharo	96.54
d1oyza_		276	Hypothetical protein YibA {Escherichia coli [TaxId	96.09
d1eiwa_		111	Hypothetical protein MTH538 {Archaeon Methanobacte	95.46
d1rg6a_		67	C-terminal domain of p63 {Human (Homo sapiens) [Ta	95.29
d1te4a_		111	MTH187 {Archaeon Methanobacterium thermoautotrophi	94.5
d1b3ua_		588	Constant regulatory domain of protein phosphatase	94.4
d1sxea_		97	Transcriptional regulator ERG {Human (Homo sapiens	94.01
d2vgla_		584	Adaptin alpha C subunit N-terminal fragment {Mouse	93.92
d1sv0a_		77	Ets DNA-binding protein pokkuri (Yan) {Fruit fly (	93.87
d1ji7a_		77	Etv6 transcription factor pointed domain (Tel SAM)	93.44
d1sv0c_		82	Modulator of the activity of Ets (MAE, CG15085-PA)	93.08
d1sxda_		91	GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 1	92.98
d2vglb_		579	Adaptin beta subunit N-terminal fragment {Human (H	92.76
d2f62a1		152	Nucleoside 2-deoxyribosyltransferase {Trypanosoma	92.36
d2jv3a_		110	Ets-1 transcription factor pointed domain {Mouse (	92.29
d1te4a_		111	MTH187 {Archaeon Methanobacterium thermoautotrophi	92.21
d1rg6a_		67	C-terminal domain of p63 {Human (Homo sapiens) [Ta	91.36
d2vglb_		579	Adaptin beta subunit N-terminal fragment {Human (H	88.84
d1u6gc_		1207	Cullin-associated NEDD8-dissociated protein 1 (Tip	88.29
d1u6gc_		1207	Cullin-associated NEDD8-dissociated protein 1 (Tip	86.82

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.70  E-value=2.8e-17  Score=180.74  Aligned_cols=264  Identities=15%  Similarity=0.106  Sum_probs=206.5

Q ss_pred             hcCChHHHHHhhcCCChhHHhHHHHHHHHhhc-cchhhHHHhhc--hhHHHhhhhhccccccccchhhhhhhHhhhhhhc
Q psy4858         211 NCGGMDLLISNCVEKDLDLQFSSARLLEQCLT-TENRDHVVENG--LDKVVRVACVCTKNINSVEHSRVGTGILEHLFKH  287 (979)
Q Consensus       211 ~~Ggld~Li~~~~s~~~~~q~~aa~~Le~~~~-~~Nr~~Iv~~G--l~~lv~la~~~tk~~~~~~~~r~~~giL~~lfkH  287 (979)
                      ..+.+..|++++.+.+.+++..|+++|.++.. ..+|..+++.+  +..|+++.    +...+++.++.++++|.+| .+
T Consensus        15 ~~~aip~L~~lL~~~~~~v~~~A~~~l~~l~~~~~~~~~~~~~~~~v~~l~~~L----~~~~~~~~~~~a~~~L~~l-~~   89 (529)
T d1jdha_          15 ATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTM----QNTNDVETARCTAGTLHNL-SH   89 (529)
T ss_dssp             --CHHHHHHHHHTCSCHHHHHHHHHHHHHHHTSHHHHHHHHTCHHHHHHHHHHH----HHCCCHHHHHHHHHHHHHH-TT
T ss_pred             HHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhccHHHHHHHHhhhHHHHHHHHH----cCCCCHHHHHHHHHHHHHH-hC
Confidence            36889999999999999999999999999974 57777777764  78888888    3335578999999999999 78


Q ss_pred             ChhhHHHHhhcCchHHHHhhhccCChhHHHHHHHhhhhhcccCCchhHHHHHhcCCcchhccccccCCccchhhHHHHHH
Q psy4858         288 SEGTCSDVIGLGGLDTVLFECRKNDIETLRHCAGALANLSLYGGAENQEAMIKRKVPVWLFPLAFHNDDNIKYYACLAIA  367 (979)
Q Consensus       288 Se~t~~~lV~~Ggl~~Ll~l~r~~d~~~lr~ca~ALaNlAl~~~~~~q~~mi~~~~~~wL~~La~s~dd~vr~~A~lAla  367 (979)
                      +++.+..+++.||++.|+.+|+++|++++++|+.||.||+.+... .+..+.+.|+++.|+.++.++++.++.+||.+|.
T Consensus        90 ~~~~~~~i~~~g~i~~Li~lL~~~~~~v~~~a~~aL~~l~~~~~~-~~~~~~~~g~i~~Lv~lL~~~~~~~~~~a~~~L~  168 (529)
T d1jdha_          90 HREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEG-AKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQ  168 (529)
T ss_dssp             SHHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHCTT-HHHHHHHHTHHHHHHHGGGCCCHHHHHHHHHHHH
T ss_pred             CchhHHHHHHCCCHHHHHHHhCCCCHHHHHHHHHHHHHhhcccch-hhhHHHhcCCchHHHHHHHccChHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999987643 3566779999999999999999999999999999


Q ss_pred             HHhcc-hHHHHHHHhhhhHHHHHhhCCccchHhhhhcCChhhh------hhhhhhccc-----CCCchhhhhhhhccccc
Q psy4858         368 VLVAN-TEIEAAVLKSVQEAAVLKSGTLDLVEPFVMSHSPSEF------AKSNLAHAH-----GQNRNWLQKLVPVLSSK  435 (979)
Q Consensus       368 ~Lasn-~ei~~~~~~~~~~~~V~~sG~l~lv~~~~~~~~P~~f------Ar~~l~~~~-----g~~~g~L~~LvplL~s~  435 (979)
                      +|+.+ .+.+..         +...|+++.+..+++.+++...      +..++....     -...|.+++|+.+|.+.
T Consensus       169 ~l~~~~~~~~~~---------~~~~~~~~~L~~ll~~~~~~~~~~~~~~~l~~ls~~~~~~~~~~~~g~~~~L~~ll~~~  239 (529)
T d1jdha_         169 ILAYGNQESKLI---------ILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP  239 (529)
T ss_dssp             HHHTTCHHHHHH---------HHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTTSS
T ss_pred             HHhhhhhHHHHH---------HHhcccchHHHHHHHhhhhHHHHHHHHHHHhhhhccccccchhhhhhhhhhHHHHhccc
Confidence            99975 555555         8889999888888877765321      122222111     13557899999999997


Q ss_pred             hHHHHHHHHHHhhHHhhhhhhcCCchhhhhhCccchhhhhhcCCccchhhhhhhhHhhc
Q psy4858         436 REEARNLAAFHFCMEAGIKKQQGKTDIFKEIGAIEPLKKVASCPNAVASKYAAQTLRLI  494 (979)
Q Consensus       436 ~eE~q~lAafhl~~ea~iKk~q~n~~~F~eiGaIe~LkrLasSpnd~asklAaqaLe~~  494 (979)
                      ..+.+..++..+. +..    ......+...|+++.|.++..+++......+..+|..+
T Consensus       240 ~~~~~~~a~~~l~-~ls----~~~~~~~~~~~~i~~Lv~ll~~~~~~~~~~a~~~L~~l  293 (529)
T d1jdha_         240 SQRLVQNCLWTLR-NLS----DAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNL  293 (529)
T ss_dssp             CHHHHHHHHHHHH-HHH----TTCTTCSCCHHHHHHHHHHTTCSCHHHHHHHHHHHHHH
T ss_pred             chhhhhhhhhHHH-hcc----ccccchhhhhhcchhhhhhcccccHHHHHHHHHHHHhh
Confidence            7777776666653 232    22233344458899999988776665555566676654

PyMOL of d1jdha_

>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z1va1 a.60.1.2 (A:33-102) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1eiwa_ c.23.3.1 (A:) Hypothetical protein MTH538 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1rg6a_ a.60.1.2 (A:) C-terminal domain of p63 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sxea_ a.60.1.1 (A:) Transcriptional regulator ERG {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sv0a_ a.60.1.1 (A:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1ji7a_ a.60.1.1 (A:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sv0c_ a.60.1.1 (C:) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1sxda_ a.60.1.1 (A:) GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2f62a1 c.23.14.1 (A:9-160) Nucleoside 2-deoxyribosyltransferase {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1rg6a_ a.60.1.2 (A:) C-terminal domain of p63 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure