Psyllid ID: psy4966
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| 262201331 | 542 | AMP-dependent synthetase and ligase [Gor | 0.798 | 0.219 | 0.444 | 5e-22 | |
| 321471684 | 595 | hypothetical protein DAPPUDRAFT_316477 [ | 0.791 | 0.198 | 0.428 | 2e-21 | |
| 359385572 | 547 | firefly luciferase [Drilaster axillaris] | 0.872 | 0.237 | 0.452 | 2e-21 | |
| 339251840 | 259 | hypothetical protein Tsp_10497 [Trichine | 0.785 | 0.451 | 0.417 | 5e-21 | |
| 380023013 | 525 | PREDICTED: luciferin 4-monooxygenase-lik | 0.785 | 0.222 | 0.416 | 6e-21 | |
| 301078349 | 547 | luciferase [Taximastinocerus sp. FGCA-20 | 0.778 | 0.212 | 0.396 | 7e-21 | |
| 321471668 | 538 | hypothetical protein DAPPUDRAFT_316454 [ | 0.791 | 0.219 | 0.406 | 7e-21 | |
| 312382599 | 564 | hypothetical protein AND_04666 [Anophele | 0.932 | 0.246 | 0.397 | 7e-21 | |
| 307209139 | 470 | Luciferin 4-monooxygenase [Harpegnathos | 0.785 | 0.248 | 0.416 | 1e-20 | |
| 374081828 | 555 | firefly luciferase [Stenocladius azumai] | 0.791 | 0.212 | 0.436 | 1e-20 |
| >gi|262201331|ref|YP_003272539.1| AMP-dependent synthetase and ligase [Gordonia bronchialis DSM 43247] gi|262084678|gb|ACY20646.1| AMP-dependent synthetase and ligase [Gordonia bronchialis DSM 43247] | Back alignment and taxonomy information |
|---|
Score = 109 bits (272), Expect = 5e-22, Method: Composition-based stats.
Identities = 60/135 (44%), Positives = 78/135 (57%), Gaps = 16/135 (11%)
Query: 25 HNAIKIIDPVTSVQLPDGKTGELCLKG-DVFLGYRNKVEATKEMLDDDGWLHTGDLAYRL 83
H IK++DPVT LP G+TGE C +G V GY N+ E T E +D DGW+HTGDLA
Sbjct: 363 HLEIKVVDPVTGETLPRGETGEFCTRGYSVMKGYWNQPEKTAEAIDGDGWMHTGDLAVMA 422
Query: 84 PDGTHFI--------------ISPCELESIFRQHPDVEDVAVIGIPHDVFG-ELPAAVVV 128
PDG I I P E+E HPD+ D VIG+P + +G EL A V +
Sbjct: 423 PDGYVAITGRIKDMVIRGGENIYPREIEEFLYTHPDILDAQVIGVPDEKYGEELMAWVRL 482
Query: 129 PKPNSSVTAEEVKQF 143
KP + +TAE+V++F
Sbjct: 483 RKPATDLTAEDVREF 497
|
Source: Gordonia bronchialis DSM 43247 Species: Gordonia bronchialis Genus: Gordonia Family: Gordoniaceae Order: Actinomycetales Class: Actinobacteria Phylum: Actinobacteria Superkingdom: Bacteria |
| >gi|321471684|gb|EFX82656.1| hypothetical protein DAPPUDRAFT_316477 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|359385572|dbj|BAL40875.1| firefly luciferase [Drilaster axillaris] | Back alignment and taxonomy information |
|---|
| >gi|339251840|ref|XP_003372942.1| hypothetical protein Tsp_10497 [Trichinella spiralis] gi|316968685|gb|EFV52938.1| hypothetical protein Tsp_10497 [Trichinella spiralis] | Back alignment and taxonomy information |
|---|
| >gi|380023013|ref|XP_003695326.1| PREDICTED: luciferin 4-monooxygenase-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|301078349|gb|ADK56478.1| luciferase [Taximastinocerus sp. FGCA-2010] | Back alignment and taxonomy information |
|---|
| >gi|321471668|gb|EFX82640.1| hypothetical protein DAPPUDRAFT_316454 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|312382599|gb|EFR28003.1| hypothetical protein AND_04666 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|307209139|gb|EFN86281.1| Luciferin 4-monooxygenase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|374081828|dbj|BAL46509.1| firefly luciferase [Stenocladius azumai] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| UNIPROTKB|Q26304 | 548 | Q26304 "Luciferin 4-monooxygen | 0.785 | 0.213 | 0.401 | 8.6e-20 | |
| TAIR|locus:2094716 | 556 | 4CL2 "4-coumarate:CoA ligase 2 | 0.798 | 0.214 | 0.4 | 1.1e-19 | |
| TAIR|locus:2015499 | 542 | ACOS5 "acyl-CoA synthetase 5" | 0.785 | 0.215 | 0.409 | 2.3e-19 | |
| UNIPROTKB|P08659 | 550 | P08659 "Luciferin 4-monooxygen | 0.778 | 0.210 | 0.412 | 3.9e-19 | |
| TAIR|locus:2017602 | 561 | 4CL1 "4-coumarate:CoA ligase 1 | 0.798 | 0.212 | 0.392 | 8.6e-19 | |
| WB|WBGene00008669 | 544 | acs-14 [Caenorhabditis elegans | 0.778 | 0.213 | 0.406 | 1.7e-18 | |
| TAIR|locus:2094771 | 570 | 4CL5 "4-coumarate:CoA ligase 5 | 0.798 | 0.208 | 0.362 | 4e-18 | |
| DICTYBASE|DDB_G0284831 | 551 | 4cl1 "4-coumarate-CoA ligase" | 0.751 | 0.203 | 0.409 | 7.8e-18 | |
| DICTYBASE|DDB_G0284745 | 551 | 4cl2 "4-coumarate-CoA ligase" | 0.758 | 0.205 | 0.398 | 1e-17 | |
| TAIR|locus:2158559 | 562 | AT5G63380 [Arabidopsis thalian | 0.812 | 0.215 | 0.397 | 1e-17 |
| UNIPROTKB|Q26304 Q26304 "Luciferin 4-monooxygenase" [Luciola mingrelica (taxid:27446)] | Back alignment and assigned GO terms |
|---|
Score = 243 (90.6 bits), Expect = 8.6e-20, P = 8.6e-20
Identities = 53/132 (40%), Positives = 75/132 (56%)
Query: 28 IKIIDPVTSVQLPDGKTGELCLKG-DVFLGYRNKVEATKEMLDDDGWLHTGDLAYRLPDG 86
+K+ID T L + GE+C+KG + LGY N EAT+E +D++GWLHTGD+ Y D
Sbjct: 373 VKVIDLDTKKTLGVNRRGEICVKGPSLMLGYSNNPEATRETIDEEGWLHTGDIGYYDEDE 432
Query: 87 THFIIS--------------PCELESIFRQHPDVEDVAVIGIPHDVFGELPAAVVVPKPN 132
FI+ P ELES+ QHP++ D V G+P GELP AVVV +
Sbjct: 433 HFFIVDRLKSLIKYKGYQVPPAELESVLLQHPNIFDAGVAGVPDPDAGELPGAVVVMEKG 492
Query: 133 SSVTAEEVKQFV 144
++T +E+ +V
Sbjct: 493 KTMTEKEIVDYV 504
|
|
| TAIR|locus:2094716 4CL2 "4-coumarate:CoA ligase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015499 ACOS5 "acyl-CoA synthetase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08659 P08659 "Luciferin 4-monooxygenase" [Photinus pyralis (taxid:7054)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2017602 4CL1 "4-coumarate:CoA ligase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00008669 acs-14 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094771 4CL5 "4-coumarate:CoA ligase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0284831 4cl1 "4-coumarate-CoA ligase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0284745 4cl2 "4-coumarate-CoA ligase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158559 AT5G63380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| cd05911 | 487 | cd05911, Firefly_Luc_like, Firefly luciferase of l | 1e-43 | |
| cd05917 | 347 | cd05917, FACL_like_2, Uncharacterized subfamily of | 8e-41 | |
| cd05904 | 504 | cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | 2e-38 | |
| COG0318 | 534 | COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ | 2e-36 | |
| cd05936 | 468 | cd05936, FC-FACS_FadD_like, Prokaryotic long-chain | 5e-36 | |
| cd05929 | 342 | cd05929, BACL_like, Bacterial Bile acid CoA ligase | 2e-35 | |
| PRK08315 | 559 | PRK08315, PRK08315, AMP-binding domain protein; Va | 3e-34 | |
| PRK06187 | 521 | PRK06187, PRK06187, long-chain-fatty-acid--CoA lig | 2e-33 | |
| cd05941 | 430 | cd05941, MCS, Malonyl-CoA synthetase (MCS) | 3e-33 | |
| cd05926 | 345 | cd05926, FACL_fum10p_like, Subfamily of fatty acid | 7e-33 | |
| PLN02246 | 537 | PLN02246, PLN02246, 4-coumarate--CoA ligase | 2e-31 | |
| cd04433 | 338 | cd04433, AFD_class_I, Adenylate forming domain, Cl | 2e-31 | |
| cd05935 | 430 | cd05935, LC_FACS_like, Putative long-chain fatty a | 1e-28 | |
| cd05920 | 483 | cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l | 5e-28 | |
| PRK12583 | 558 | PRK12583, PRK12583, acyl-CoA synthetase; Provision | 2e-27 | |
| PRK07656 | 513 | PRK07656, PRK07656, long-chain-fatty-acid--CoA lig | 3e-27 | |
| cd05934 | 421 | cd05934, FACL_DitJ_like, Uncharacterized subfamily | 3e-27 | |
| cd05903 | 437 | cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li | 4e-27 | |
| PRK05677 | 562 | PRK05677, PRK05677, long-chain-fatty-acid--CoA lig | 6e-27 | |
| PLN02330 | 546 | PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | 8e-27 | |
| cd12119 | 517 | cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth | 2e-26 | |
| cd12118 | 520 | cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt | 3e-26 | |
| PRK06188 | 524 | PRK06188, PRK06188, acyl-CoA synthetase; Validated | 2e-25 | |
| cd05912 | 407 | cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase | 3e-25 | |
| PRK06839 | 496 | PRK06839, PRK06839, acyl-CoA synthetase; Validated | 4e-24 | |
| PRK08008 | 517 | PRK08008, caiC, putative crotonobetaine/carnitine- | 5e-24 | |
| PLN02574 | 560 | PLN02574, PLN02574, 4-coumarate--CoA ligase-like | 2e-23 | |
| PRK08974 | 560 | PRK08974, PRK08974, long-chain-fatty-acid--CoA lig | 8e-23 | |
| PRK06178 | 567 | PRK06178, PRK06178, acyl-CoA synthetase; Validated | 5e-22 | |
| PRK12492 | 562 | PRK12492, PRK12492, long-chain-fatty-acid--CoA lig | 6e-22 | |
| PRK07470 | 528 | PRK07470, PRK07470, acyl-CoA synthetase; Validated | 1e-21 | |
| pfam00501 | 412 | pfam00501, AMP-binding, AMP-binding enzyme | 5e-21 | |
| cd05922 | 350 | cd05922, FACL_like_6, Uncharacterized subfamily of | 7e-21 | |
| PRK05605 | 573 | PRK05605, PRK05605, long-chain-fatty-acid--CoA lig | 3e-20 | |
| PRK07514 | 504 | PRK07514, PRK07514, malonyl-CoA synthase; Validate | 3e-20 | |
| PRK13295 | 547 | PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig | 4e-20 | |
| PRK09088 | 488 | PRK09088, PRK09088, acyl-CoA synthetase; Validated | 9e-20 | |
| COG1022 | 613 | COG1022, FAA1, Long-chain acyl-CoA synthetases (AM | 1e-19 | |
| PRK08314 | 546 | PRK08314, PRK08314, long-chain-fatty-acid--CoA lig | 4e-19 | |
| PRK03640 | 483 | PRK03640, PRK03640, O-succinylbenzoic acid--CoA li | 4e-19 | |
| PRK06164 | 540 | PRK06164, PRK06164, acyl-CoA synthetase; Validated | 5e-19 | |
| PRK08316 | 523 | PRK08316, PRK08316, acyl-CoA synthetase; Validated | 6e-19 | |
| PRK07787 | 471 | PRK07787, PRK07787, acyl-CoA synthetase; Validated | 6e-19 | |
| cd05959 | 506 | cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and | 6e-19 | |
| PRK08162 | 545 | PRK08162, PRK08162, acyl-CoA synthetase; Validated | 9e-19 | |
| cd05971 | 439 | cd05971, MACS_like_3, Uncharacterized subfamily of | 1e-18 | |
| PRK06087 | 547 | PRK06087, PRK06087, short chain acyl-CoA synthetas | 2e-18 | |
| cd05944 | 359 | cd05944, FACL_like_4, Uncharacterized subfamily of | 4e-18 | |
| PRK08751 | 560 | PRK08751, PRK08751, putative long-chain fatty acyl | 4e-18 | |
| cd05907 | 456 | cd05907, VL_LC_FACS_like, Long-chain fatty acid Co | 6e-18 | |
| PRK07529 | 632 | PRK07529, PRK07529, AMP-binding domain protein; Va | 2e-17 | |
| cd05927 | 539 | cd05927, LC-FACS_euk, Eukaryotic long-chain fatty | 3e-17 | |
| cd05972 | 430 | cd05972, MACS_like, Medium-chain acyl-CoA syntheta | 5e-17 | |
| cd05923 | 495 | cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) | 7e-17 | |
| PRK08276 | 502 | PRK08276, PRK08276, long-chain-fatty-acid--CoA lig | 2e-16 | |
| PLN02479 | 567 | PLN02479, PLN02479, acetate-CoA ligase | 2e-16 | |
| COG0365 | 528 | COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat | 3e-16 | |
| PRK06018 | 542 | PRK06018, PRK06018, putative acyl-CoA synthetase; | 3e-16 | |
| cd05919 | 436 | cd05919, BCL_like, Benzoate CoA ligase (BCL) and s | 4e-16 | |
| PRK05852 | 534 | PRK05852, PRK05852, acyl-CoA synthetase; Validated | 4e-16 | |
| cd05974 | 433 | cd05974, MACS_like_1, Uncharacterized subfamily of | 5e-16 | |
| PRK06710 | 563 | PRK06710, PRK06710, long-chain-fatty-acid--CoA lig | 1e-15 | |
| PRK07786 | 542 | PRK07786, PRK07786, long-chain-fatty-acid--CoA lig | 4e-15 | |
| cd05968 | 474 | cd05968, AACS_like, Uncharacterized acyl-CoA synth | 5e-15 | |
| cd05932 | 504 | cd05932, LC_FACS_bac, Bacterial long-chain fatty a | 5e-15 | |
| cd12117 | 474 | cd12117, A_NRPS_Srf_like, The adenylation domain o | 9e-15 | |
| PRK13382 | 537 | PRK13382, PRK13382, acyl-CoA synthetase; Provision | 2e-14 | |
| cd05969 | 443 | cd05969, MACS_like_4, Uncharacterized subfamily of | 2e-14 | |
| PRK07638 | 487 | PRK07638, PRK07638, acyl-CoA synthetase; Validated | 2e-14 | |
| cd05930 | 445 | cd05930, A_NRPS, The adenylation domain of nonribo | 3e-14 | |
| PRK06145 | 497 | PRK06145, PRK06145, acyl-CoA synthetase; Validated | 3e-14 | |
| PRK13391 | 511 | PRK13391, PRK13391, acyl-CoA synthetase; Provision | 5e-14 | |
| PRK07059 | 557 | PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig | 9e-14 | |
| TIGR03208 | 538 | TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate | 1e-13 | |
| cd05945 | 447 | cd05945, DltA, D-alanine:D-alanyl carrier protein | 1e-13 | |
| PRK07798 | 533 | PRK07798, PRK07798, acyl-CoA synthetase; Validated | 1e-13 | |
| cd12114 | 476 | cd12114, A_NRPS_TlmIV_like, The adenylation domain | 1e-13 | |
| PLN03102 | 579 | PLN03102, PLN03102, acyl-activating enzyme; Provis | 5e-13 | |
| cd05967 | 607 | cd05967, PrpE, Propionyl-CoA synthetase (PrpE) | 6e-13 | |
| PRK07867 | 529 | PRK07867, PRK07867, acyl-CoA synthetase; Validated | 8e-13 | |
| PRK07008 | 539 | PRK07008, PRK07008, long-chain-fatty-acid--CoA lig | 1e-12 | |
| cd05973 | 440 | cd05973, MACS_like_2, Uncharacterized subfamily of | 1e-12 | |
| PRK12406 | 509 | PRK12406, PRK12406, long-chain-fatty-acid--CoA lig | 2e-12 | |
| cd05931 | 547 | cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | 2e-12 | |
| cd12116 | 438 | cd12116, A_NRPS_Ta1_like, The adenylation domain o | 2e-12 | |
| cd05958 | 487 | cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) | 5e-12 | |
| TIGR01923 | 436 | TIGR01923, menE, O-succinylbenzoate-CoA ligase | 5e-12 | |
| PRK06155 | 542 | PRK06155, PRK06155, crotonobetaine/carnitine-CoA l | 6e-12 | |
| PRK07788 | 549 | PRK07788, PRK07788, acyl-CoA synthetase; Validated | 6e-12 | |
| cd05924 | 365 | cd05924, FACL_like_5, Uncharacterized subfamily of | 6e-12 | |
| PLN02430 | 660 | PLN02430, PLN02430, long-chain-fatty-acid-CoA liga | 9e-12 | |
| PTZ00216 | 700 | PTZ00216, PTZ00216, acyl-CoA synthetase; Provision | 3e-11 | |
| TIGR01733 | 409 | TIGR01733, AA-adenyl-dom, amino acid adenylation d | 3e-11 | |
| cd05933 | 594 | cd05933, ACSBG_like, Bubblegum-like very long-chai | 5e-11 | |
| PRK13388 | 540 | PRK13388, PRK13388, acyl-CoA synthetase; Provision | 9e-11 | |
| PLN02736 | 651 | PLN02736, PLN02736, long-chain acyl-CoA synthetase | 1e-10 | |
| cd05970 | 537 | cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s | 1e-10 | |
| cd05966 | 602 | cd05966, ACS, Acetyl-CoA synthetase (also known as | 1e-10 | |
| cd05940 | 444 | cd05940, FATP_FACS, Fatty acid transport proteins | 2e-10 | |
| TIGR03205 | 541 | TIGR03205, pimA, dicarboxylate--CoA ligase PimA | 2e-10 | |
| PRK07445 | 452 | PRK07445, PRK07445, O-succinylbenzoic acid--CoA li | 2e-10 | |
| TIGR02275 | 526 | TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP | 4e-10 | |
| cd12115 | 449 | cd12115, A_NRPS_Sfm_like, The adenylation domain o | 4e-10 | |
| PRK09192 | 579 | PRK09192, PRK09192, acyl-CoA synthetase; Validated | 5e-10 | |
| COG1021 | 542 | COG1021, EntE, Peptide arylation enzymes [Secondar | 6e-10 | |
| PRK04319 | 570 | PRK04319, PRK04319, acetyl-CoA synthetase; Provisi | 2e-09 | |
| PRK09274 | 552 | PRK09274, PRK09274, peptide synthase; Provisional | 6e-09 | |
| cd05908 | 499 | cd05908, A_NRPS_MycA_like, The adenylation domain | 7e-09 | |
| PRK05620 | 576 | PRK05620, PRK05620, long-chain-fatty-acid--CoA lig | 7e-09 | |
| PRK13383 | 516 | PRK13383, PRK13383, acyl-CoA synthetase; Provision | 8e-09 | |
| cd05909 | 489 | cd05909, AAS_C, C-terminal domain of the acyl-acyl | 9e-09 | |
| cd05906 | 560 | cd05906, A_NRPS_TubE_like, The adenylation domain | 1e-08 | |
| cd05915 | 509 | cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetase | 1e-08 | |
| PRK05857 | 540 | PRK05857, PRK05857, acyl-CoA synthetase; Validated | 1e-08 | |
| TIGR02188 | 625 | TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase | 2e-08 | |
| PLN02861 | 660 | PLN02861, PLN02861, long-chain-fatty-acid-CoA liga | 2e-08 | |
| cd05910 | 455 | cd05910, FACL_like_1, Uncharacterized subfamily of | 2e-08 | |
| PRK08633 | 1146 | PRK08633, PRK08633, 2-acyl-glycerophospho-ethanola | 5e-08 | |
| cd05914 | 448 | cd05914, FACL_like_3, Uncharacterized subfamily of | 5e-08 | |
| PRK10946 | 536 | PRK10946, entE, enterobactin synthase subunit E; P | 7e-08 | |
| COG1020 | 642 | COG1020, EntF, Non-ribosomal peptide synthetase mo | 8e-08 | |
| PRK07824 | 358 | PRK07824, PRK07824, O-succinylbenzoic acid--CoA li | 1e-07 | |
| PLN02860 | 563 | PLN02860, PLN02860, o-succinylbenzoate-CoA ligase | 1e-07 | |
| PRK05850 | 578 | PRK05850, PRK05850, acyl-CoA synthetase; Validated | 3e-07 | |
| PLN02614 | 666 | PLN02614, PLN02614, long-chain acyl-CoA synthetase | 9e-07 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 2e-06 | |
| cd05928 | 530 | cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co | 2e-06 | |
| PRK00174 | 637 | PRK00174, PRK00174, acetyl-CoA synthetase; Provisi | 2e-06 | |
| PRK13390 | 501 | PRK13390, PRK13390, acyl-CoA synthetase; Provision | 4e-06 | |
| PRK09029 | 458 | PRK09029, PRK09029, O-succinylbenzoic acid--CoA li | 1e-05 | |
| PRK12476 | 612 | PRK12476, PRK12476, putative fatty-acid--CoA ligas | 2e-05 | |
| TIGR02262 | 508 | TIGR02262, benz_CoA_lig, benzoate-CoA ligase famil | 2e-05 | |
| cd05918 | 447 | cd05918, A_NRPS_SidN3_like, The adenylation (A) do | 3e-05 | |
| PRK07769 | 631 | PRK07769, PRK07769, long-chain-fatty-acid--CoA lig | 5e-05 | |
| PRK07768 | 545 | PRK07768, PRK07768, long-chain-fatty-acid--CoA lig | 6e-05 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 1e-04 | |
| cd05921 | 559 | cd05921, FCS, Feruloyl-CoA synthetase (FCS) | 2e-04 | |
| TIGR03098 | 517 | TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-form | 3e-04 | |
| PRK08180 | 614 | PRK08180, PRK08180, feruloyl-CoA synthase; Reviewe | 4e-04 | |
| PRK10524 | 629 | PRK10524, prpE, propionyl-CoA synthetase; Provisio | 4e-04 | |
| PRK08308 | 414 | PRK08308, PRK08308, acyl-CoA synthetase; Validated | 7e-04 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 8e-04 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 0.003 | |
| TIGR02316 | 628 | TIGR02316, propion_prpE, propionate--CoA ligase | 0.004 |
| >gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
Score = 148 bits (377), Expect = 1e-43
Identities = 61/133 (45%), Positives = 77/133 (57%), Gaps = 15/133 (11%)
Query: 28 IKIIDPVTSVQLPDGKTGELCLKGD-VFLGYRNKVEATKEMLDDDGWLHTGDLAYRLPDG 86
KI+D L + GELC+KG + GY N EATKE +D+DGWLHTGD+ Y DG
Sbjct: 327 AKIVDEDGGKSLGPNERGELCVKGPQIMKGYLNNPEATKETIDEDGWLHTGDIGYFDEDG 386
Query: 87 THFI--------------ISPCELESIFRQHPDVEDVAVIGIPHDVFGELPAAVVVPKPN 132
+I + P ELE++ +HP V D AVIGIP +V GELP A VV KP
Sbjct: 387 NFYIVDRKKELIKYKGYQVPPAELEAVLLEHPKVADAAVIGIPDEVAGELPRAYVVLKPG 446
Query: 133 SSVTAEEVKQFVE 145
S +T +EVK +V
Sbjct: 447 SKLTEQEVKDYVA 459
|
This family contains two functionally unique groups of proteins; one group is insect firefly luciferases and the other is plant 4-coumarate:coenzyme A ligases. However, they share significant sequence similarity in spite of their functional diversity. Luciferase catalyzes the production of light in the presence of MgATP, molecular oxygen, and luciferin. In the first step, luciferin is activated by acylation of its carboxylate group with ATP, resulting in an enzyme-bound luciferyl adenylate. In the second step, luciferyl adenylate reacts with molecular oxygen, producing an enzyme-bound excited state product (Luc=O*) and releasing AMP. This excited-state product then decays to the ground state (Luc=O), emitting a quantum of visible light. 4-coumarate:coenzyme A ligase is a key enzyme in the phenylpropanoid metabolic pathway for monolignol and flavonoid biosynthesis. It catalyzes the synthesis of hydroxycinnamate-CoA thioesters in a two-step reaction, involving the formation of hydroxycinnamate-AMP anhydride and then the nucleophilic substitution of AMP by CoA. The phenylpropanoid pathway is one of the most important secondary metabolism pathways in plants and hydroxycinnamate-CoA thioesters are the precursors of lignin and other important phenylpropanoids. Length = 487 |
| >gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
| >gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD | Back alignment and domain information |
|---|
| >gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) | Back alignment and domain information |
|---|
| >gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis | Back alignment and domain information |
|---|
| >gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I | Back alignment and domain information |
|---|
| >gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) | Back alignment and domain information |
|---|
| >gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles | Back alignment and domain information |
|---|
| >gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis | Back alignment and domain information |
|---|
| >gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) | Back alignment and domain information |
|---|
| >gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236096 PRK07787, PRK07787, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase) | Back alignment and domain information |
|---|
| >gnl|CDD|236169 PRK08162, PRK08162, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) | Back alignment and domain information |
|---|
| >gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) | Back alignment and domain information |
|---|
| >gnl|CDD|213290 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) | Back alignment and domain information |
|---|
| >gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178097 PLN02479, PLN02479, acetate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235673 PRK06018, PRK06018, putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) | Back alignment and domain information |
|---|
| >gnl|CDD|172019 PRK13382, PRK13382, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) | Back alignment and domain information |
|---|
| >gnl|CDD|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) | Back alignment and domain information |
|---|
| >gnl|CDD|236100 PRK07798, PRK07798, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes | Back alignment and domain information |
|---|
| >gnl|CDD|215576 PLN03102, PLN03102, acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213314 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) | Back alignment and domain information |
|---|
| >gnl|CDD|236120 PRK07867, PRK07867, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235908 PRK07008, PRK07008, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | Back alignment and domain information |
|---|
| >gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) | Back alignment and domain information |
|---|
| >gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|235719 PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213291 cd05924, FACL_like_5, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|178049 PLN02430, PLN02430, long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|240316 PTZ00216, PTZ00216, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain | Back alignment and domain information |
|---|
| >gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) | Back alignment and domain information |
|---|
| >gnl|CDD|237374 PRK13388, PRK13388, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like | Back alignment and domain information |
|---|
| >gnl|CDD|213313 cd05966, ACS, Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme) | Back alignment and domain information |
|---|
| >gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|132249 TIGR03205, pimA, dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >gnl|CDD|236019 PRK07445, PRK07445, O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae | Back alignment and domain information |
|---|
| >gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223952 COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236443 PRK09274, PRK09274, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) | Back alignment and domain information |
|---|
| >gnl|CDD|180167 PRK05620, PRK05620, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|139531 PRK13383, PRK13383, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) | Back alignment and domain information |
|---|
| >gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents | Back alignment and domain information |
|---|
| >gnl|CDD|213283 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles | Back alignment and domain information |
|---|
| >gnl|CDD|180293 PRK05857, PRK05857, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233770 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|178452 PLN02861, PLN02861, long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213278 cd05910, FACL_like_1, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|236315 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|236803 PRK10946, entE, enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236108 PRK07824, PRK07824, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215464 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|235624 PRK05850, PRK05850, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|166255 PLN02614, PLN02614, long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM) | Back alignment and domain information |
|---|
| >gnl|CDD|234677 PRK00174, PRK00174, acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236363 PRK09029, PRK09029, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171527 PRK12476, PRK12476, putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233803 TIGR02262, benz_CoA_lig, benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|181109 PRK07769, PRK07769, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213288 cd05921, FCS, Feruloyl-CoA synthetase (FCS) | Back alignment and domain information |
|---|
| >gnl|CDD|211788 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-forming), exosortase A-associated | Back alignment and domain information |
|---|
| >gnl|CDD|236175 PRK08180, PRK08180, feruloyl-CoA synthase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182517 PRK10524, prpE, propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236231 PRK08308, PRK08308, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131369 TIGR02316, propion_prpE, propionate--CoA ligase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| KOG1176|consensus | 537 | 100.0 | ||
| COG0318 | 534 | CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l | 99.97 | |
| KOG1177|consensus | 596 | 99.96 | ||
| PLN02574 | 560 | 4-coumarate--CoA ligase-like | 99.96 | |
| COG0365 | 528 | Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l | 99.95 | |
| PTZ00237 | 647 | acetyl-CoA synthetase; Provisional | 99.95 | |
| PLN02654 | 666 | acetate-CoA ligase | 99.95 | |
| PRK05677 | 562 | long-chain-fatty-acid--CoA ligase; Validated | 99.95 | |
| PLN02614 | 666 | long-chain acyl-CoA synthetase | 99.95 | |
| TIGR02188 | 625 | Ac_CoA_lig_AcsA acetate--CoA ligase. This model de | 99.95 | |
| PRK00174 | 637 | acetyl-CoA synthetase; Provisional | 99.95 | |
| PRK07769 | 631 | long-chain-fatty-acid--CoA ligase; Validated | 99.95 | |
| PRK07529 | 632 | AMP-binding domain protein; Validated | 99.94 | |
| PRK09088 | 488 | acyl-CoA synthetase; Validated | 99.94 | |
| PLN02246 | 537 | 4-coumarate--CoA ligase | 99.94 | |
| PRK06839 | 496 | acyl-CoA synthetase; Validated | 99.94 | |
| PRK09274 | 552 | peptide synthase; Provisional | 99.94 | |
| PLN02330 | 546 | 4-coumarate--CoA ligase-like 1 | 99.94 | |
| PLN02861 | 660 | long-chain-fatty-acid-CoA ligase | 99.94 | |
| TIGR02316 | 628 | propion_prpE propionate--CoA ligase. This family c | 99.94 | |
| PLN03051 | 499 | acyl-activating enzyme; Provisional | 99.94 | |
| PRK08008 | 517 | caiC putative crotonobetaine/carnitine-CoA ligase; | 99.94 | |
| PLN02736 | 651 | long-chain acyl-CoA synthetase | 99.94 | |
| PRK07788 | 549 | acyl-CoA synthetase; Validated | 99.94 | |
| PTZ00342 | 746 | acyl-CoA synthetase; Provisional | 99.94 | |
| COG1021 | 542 | EntE Peptide arylation enzymes [Secondary metaboli | 99.94 | |
| PLN02860 | 563 | o-succinylbenzoate-CoA ligase | 99.94 | |
| PRK06155 | 542 | crotonobetaine/carnitine-CoA ligase; Provisional | 99.94 | |
| PRK04319 | 570 | acetyl-CoA synthetase; Provisional | 99.93 | |
| PRK06145 | 497 | acyl-CoA synthetase; Validated | 99.93 | |
| TIGR02275 | 527 | DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot | 99.93 | |
| PRK08314 | 546 | long-chain-fatty-acid--CoA ligase; Validated | 99.93 | |
| PRK06164 | 540 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK12476 | 612 | putative fatty-acid--CoA ligase; Provisional | 99.93 | |
| PRK08315 | 559 | AMP-binding domain protein; Validated | 99.93 | |
| PRK10946 | 536 | entE enterobactin synthase subunit E; Provisional | 99.93 | |
| PRK12492 | 562 | long-chain-fatty-acid--CoA ligase; Provisional | 99.93 | |
| PRK05852 | 534 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK06178 | 567 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK13382 | 537 | acyl-CoA synthetase; Provisional | 99.93 | |
| COG1022 | 613 | FAA1 Long-chain acyl-CoA synthetases (AMP-forming) | 99.93 | |
| PRK13295 | 547 | cyclohexanecarboxylate-CoA ligase; Reviewed | 99.93 | |
| PRK07514 | 504 | malonyl-CoA synthase; Validated | 99.93 | |
| PRK07638 | 487 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK07470 | 528 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK07867 | 529 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK06060 | 705 | acyl-CoA synthetase; Validated | 99.93 | |
| TIGR03208 | 538 | cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. | 99.93 | |
| PRK12583 | 558 | acyl-CoA synthetase; Provisional | 99.93 | |
| KOG1256|consensus | 691 | 99.93 | ||
| PRK10524 | 629 | prpE propionyl-CoA synthetase; Provisional | 99.93 | |
| PRK07059 | 557 | Long-chain-fatty-acid--CoA ligase; Validated | 99.93 | |
| PRK13390 | 501 | acyl-CoA synthetase; Provisional | 99.93 | |
| PRK07787 | 471 | acyl-CoA synthetase; Validated | 99.93 | |
| TIGR01217 | 652 | ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym | 99.93 | |
| PRK05605 | 573 | long-chain-fatty-acid--CoA ligase; Validated | 99.93 | |
| PRK06334 | 539 | long chain fatty acid--[acyl-carrier-protein] liga | 99.93 | |
| PLN02387 | 696 | long-chain-fatty-acid-CoA ligase family protein | 99.93 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 99.92 | |
| PRK07656 | 513 | long-chain-fatty-acid--CoA ligase; Validated | 99.92 | |
| PRK06087 | 547 | short chain acyl-CoA synthetase; Reviewed | 99.92 | |
| PRK06188 | 524 | acyl-CoA synthetase; Validated | 99.92 | |
| PRK03584 | 655 | acetoacetyl-CoA synthetase; Provisional | 99.92 | |
| PRK05851 | 525 | long-chain-fatty-acid--[acyl-carrier-protein] liga | 99.92 | |
| PRK08316 | 523 | acyl-CoA synthetase; Validated | 99.92 | |
| PRK06710 | 563 | long-chain-fatty-acid--CoA ligase; Validated | 99.92 | |
| PRK08751 | 560 | putative long-chain fatty acyl CoA ligase; Provisi | 99.92 | |
| TIGR03098 | 515 | ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor | 99.92 | |
| PRK05857 | 540 | acyl-CoA synthetase; Validated | 99.92 | |
| PRK13388 | 540 | acyl-CoA synthetase; Provisional | 99.92 | |
| PTZ00216 | 700 | acyl-CoA synthetase; Provisional | 99.92 | |
| PLN02430 | 660 | long-chain-fatty-acid-CoA ligase | 99.91 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.91 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 99.91 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.91 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.91 | |
| PRK07786 | 542 | long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| KOG1175|consensus | 626 | 99.91 | ||
| PRK08276 | 502 | long-chain-fatty-acid--CoA ligase; Validated | 99.91 | |
| PRK03640 | 483 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.91 | |
| PRK13383 | 516 | acyl-CoA synthetase; Provisional | 99.91 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 99.91 | |
| PRK12406 | 509 | long-chain-fatty-acid--CoA ligase; Provisional | 99.9 | |
| PLN03102 | 579 | acyl-activating enzyme; Provisional | 99.9 | |
| PRK08974 | 560 | long-chain-fatty-acid--CoA ligase; Validated | 99.9 | |
| PRK07445 | 452 | O-succinylbenzoic acid--CoA ligase; Reviewed | 99.9 | |
| TIGR03205 | 541 | pimA dicarboxylate--CoA ligase PimA. PimA, a membe | 99.9 | |
| PRK09192 | 579 | acyl-CoA synthetase; Validated | 99.9 | |
| PRK13391 | 511 | acyl-CoA synthetase; Provisional | 99.9 | |
| PRK05620 | 576 | long-chain-fatty-acid--CoA ligase; Validated | 99.9 | |
| PRK07008 | 539 | long-chain-fatty-acid--CoA ligase; Validated | 99.9 | |
| TIGR01734 | 502 | D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig | 99.9 | |
| TIGR02262 | 508 | benz_CoA_lig benzoate-CoA ligase family. Character | 99.9 | |
| PRK06187 | 521 | long-chain-fatty-acid--CoA ligase; Validated | 99.89 | |
| PRK08180 | 614 | feruloyl-CoA synthase; Reviewed | 99.89 | |
| PLN02479 | 567 | acetate-CoA ligase | 99.89 | |
| PRK08043 | 718 | bifunctional acyl-[acyl carrier protein] synthetas | 99.89 | |
| PRK08162 | 545 | acyl-CoA synthetase; Validated | 99.89 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 99.89 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.89 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.89 | |
| PRK05850 | 578 | acyl-CoA synthetase; Validated | 99.89 | |
| PRK06018 | 542 | putative acyl-CoA synthetase; Provisional | 99.88 | |
| PRK04813 | 503 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.88 | |
| PRK07824 | 358 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.88 | |
| PRK09029 | 458 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.88 | |
| PLN03052 | 728 | acetate--CoA ligase; Provisional | 99.87 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.87 | |
| KOG1180|consensus | 678 | 99.87 | ||
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 99.86 | |
| PRK12582 | 624 | acyl-CoA synthetase; Provisional | 99.86 | |
| PRK07798 | 533 | acyl-CoA synthetase; Validated | 99.86 | |
| PRK08279 | 600 | long-chain-acyl-CoA synthetase; Validated | 99.85 | |
| PRK07768 | 545 | long-chain-fatty-acid--CoA ligase; Validated | 99.84 | |
| TIGR01923 | 436 | menE O-succinylbenzoate-CoA ligase. This model rep | 99.83 | |
| TIGR01733 | 408 | AA-adenyl-dom amino acid adenylation domain. This | 99.82 | |
| PF00501 | 417 | AMP-binding: AMP-binding enzyme; InterPro: IPR0008 | 99.77 | |
| PRK08308 | 414 | acyl-CoA synthetase; Validated | 99.74 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 99.62 | |
| KOG1179|consensus | 649 | 99.57 | ||
| TIGR02155 | 422 | PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet | 99.49 | |
| COG1020 | 642 | EntF Non-ribosomal peptide synthetase modules and | 99.34 | |
| TIGR02372 | 386 | 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv | 99.29 | |
| PTZ00297 | 1452 | pantothenate kinase; Provisional | 98.84 | |
| PF13193 | 73 | AMP-binding_C: AMP-binding enzyme C-terminal domai | 98.78 | |
| TIGR03335 | 445 | F390_ftsA coenzyme F390 synthetase. This enzyme, c | 98.56 | |
| KOG3628|consensus | 1363 | 98.48 | ||
| COG1541 | 438 | PaaK Coenzyme F390 synthetase [Coenzyme metabolism | 98.37 | |
| KOG1178|consensus | 1032 | 97.95 | ||
| KOG3628|consensus | 1363 | 97.4 | ||
| PF14535 | 96 | AMP-binding_C_2: AMP-binding enzyme C-terminal dom | 95.14 | |
| PF04443 | 365 | LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR | 94.84 |
| >KOG1176|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.7e-37 Score=243.54 Aligned_cols=146 Identities=40% Similarity=0.705 Sum_probs=137.6
Q ss_pred CeeeeccCCccc--------c--cccCcCccccCCceEEEEcCCCCccCCCCCeeEEEEEcCC-CccccCCchhhhcccC
Q psy4966 1 MFLVVGLVGKSK--------Q--KATLTGKHFQEHNAIKIIDPVTSVQLPDGKTGELCLKGDV-FLGYRNKVEATKEMLD 69 (149)
Q Consensus 1 ~~~~~g~~e~~~--------~--~~~~~g~~p~~~~~~~i~d~~~g~~~~~g~~Gel~v~~~~-~~gY~~~~~~~~~~~~ 69 (149)
+.+.||+||.+. . +.+++|+ ++++++..+.+ ++|+.+++++.|||+++|++ |.|||+||++|++.|+
T Consensus 328 v~q~YGmTE~~~~~~~~~~~~e~k~~svG~-~~~g~~~~v~~-e~g~~l~~~~~GEI~vrg~~imkGY~~NpeaT~~~~~ 405 (537)
T KOG1176|consen 328 VIQGYGMTEAGGLITSNDWGPERKPGSVGR-LLPGVRVKVLD-ETGVSLGPNQTGEICVRGPQVMKGYLKNPEATKEAFD 405 (537)
T ss_pred EEEeeccccccCceeecCCCccCcccccCc-cccceEEEeeC-CCCCCCCCCCceEEEEECcccchhhcCChHHHHhhcc
Confidence 368999999982 2 6889999 99999988888 99999999999999999999 9999999999999997
Q ss_pred CCCeEEcCceEEEcCCCeEEEE--------------ChHHHHHHHhcCCCcccEEEEeeecCCCCCeEEEEEEeCCCCCC
Q psy4966 70 DDGWLHTGDLAYRLPDGTHFII--------------SPCELESIFRQHPDVEDVAVIGIPHDVFGELPAAVVVPKPNSSV 135 (149)
Q Consensus 70 ~~~~~~TGD~~~~~~~G~~~i~--------------~~~eIE~~l~~~~~V~~~~v~~~~~~~~g~~~~a~v~~~~~~~~ 135 (149)
.+|||+|||+|++|+||+|+|+ +|.|||++|..||.|.||+|++.+|+.+|+.++|+|+++++..+
T Consensus 406 ~~GW~~TGDiGy~D~DG~l~IvdR~KdlIk~~G~qv~P~EiE~vL~~hP~V~eaaVvgipDe~~Ge~p~A~VV~k~g~~l 485 (537)
T KOG1176|consen 406 DDGWFHTGDLGYFDEDGYLYIVDRSKDLIKYGGEQVSPAEIEAVLLTHPDVLEAAVVGIPDEVWGETPAAFVVLKKGSTL 485 (537)
T ss_pred cCCccccCceEEEcCCCeEEEecchhhheeeCCEEeCHHHHHHHHHhCCCccEEEEEcccccccCCcceEEEEecCCCcC
Confidence 7799999999999999999997 99999999999999999999999999999999999999999999
Q ss_pred CHHHHHHHhhccc
Q psy4966 136 TAEEVKQFVEFPR 148 (149)
Q Consensus 136 ~~~~l~~~l~~~~ 148 (149)
+.++|.++|+++.
T Consensus 486 te~di~~~v~k~l 498 (537)
T KOG1176|consen 486 TEKDIIEYVRKKL 498 (537)
T ss_pred CHHHHHHHHHhhC
Confidence 9999999999864
|
|
| >COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG1177|consensus | Back alignment and domain information |
|---|
| >PLN02574 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PTZ00237 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02654 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK05677 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PLN02614 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase | Back alignment and domain information |
|---|
| >PRK00174 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07769 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07529 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK09088 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PLN02246 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >PRK06839 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK09274 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02330 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >PLN02861 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >TIGR02316 propion_prpE propionate--CoA ligase | Back alignment and domain information |
|---|
| >PLN03051 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >PLN02736 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >PRK07788 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PTZ00342 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02860 o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK04319 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06145 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >PRK08314 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06164 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12476 putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08315 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK10946 entE enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >PRK12492 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK05852 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06178 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13382 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK07514 malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >PRK07638 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07470 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07867 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06060 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >PRK12583 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1256|consensus | Back alignment and domain information |
|---|
| >PRK10524 prpE propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07059 Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK13390 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07787 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK05605 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PLN02387 long-chain-fatty-acid-CoA ligase family protein | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07656 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06087 short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK06188 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK03584 acetoacetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PRK08316 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06710 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08751 putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK05857 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13388 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00216 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02430 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07786 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >KOG1175|consensus | Back alignment and domain information |
|---|
| >PRK08276 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK13383 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK12406 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PLN03102 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK08974 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03205 pimA dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >PRK09192 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13391 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05620 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07008 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >TIGR02262 benz_CoA_lig benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >PRK06187 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08180 feruloyl-CoA synthase; Reviewed | Back alignment and domain information |
|---|
| >PLN02479 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08162 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05850 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06018 putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PLN03052 acetate--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >KOG1180|consensus | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12582 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07798 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08279 long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07768 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR01923 menE O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >TIGR01733 AA-adenyl-dom amino acid adenylation domain | Back alignment and domain information |
|---|
| >PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] | Back alignment and domain information |
|---|
| >PRK08308 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1179|consensus | Back alignment and domain information |
|---|
| >TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase | Back alignment and domain information |
|---|
| >COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family | Back alignment and domain information |
|---|
| >PTZ00297 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B | Back alignment and domain information |
|---|
| >TIGR03335 F390_ftsA coenzyme F390 synthetase | Back alignment and domain information |
|---|
| >KOG3628|consensus | Back alignment and domain information |
|---|
| >COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1178|consensus | Back alignment and domain information |
|---|
| >KOG3628|consensus | Back alignment and domain information |
|---|
| >PF14535 AMP-binding_C_2: AMP-binding enzyme C-terminal domain; PDB: 2Y27_A 2Y4N_A 3QOV_B 3S89_D 3LAX_A 2Y4O_B | Back alignment and domain information |
|---|
| >PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 149 | ||||
| 3qya_A | 582 | Crystal Structure Of A Red-Emitter Mutant Of Lampyr | 5e-22 | ||
| 2d1q_A | 548 | Crystal Structure Of The Thermostable Japanese Fire | 1e-21 | ||
| 2d1t_A | 548 | Crystal Structure Of The Thermostable Japanese Fire | 1e-21 | ||
| 2d1s_A | 548 | Crystal Structure Of The Thermostable Japanese Fire | 1e-21 | ||
| 1ba3_A | 550 | Firefly Luciferase In Complex With Bromoform Length | 3e-21 | ||
| 4g36_A | 555 | Photinus Pyralis Luciferase In The Adenylate-Formin | 3e-21 | ||
| 3iep_A | 551 | Firefly Luciferase Apo Structure (P41 Form) Length | 3e-21 | ||
| 4g37_A | 555 | Structure Of Cross-Linked Firefly Luciferase In Sec | 4e-20 | ||
| 3a9u_A | 536 | Crystal Structures And Enzymatic Mechanisms Of A Po | 2e-19 | ||
| 3tsy_A | 979 | 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr | 1e-18 | ||
| 3ivr_A | 509 | Crystal Structure Of Putative Long-Chain-Fatty-Acid | 4e-14 | ||
| 4fuq_A | 503 | Crystal Structure Of Apo Matb From Rhodopseudomonas | 3e-11 | ||
| 4fut_A | 503 | Crystal Structure Of Atp Bound Matb From Rhodopseud | 1e-10 | ||
| 4gxq_A | 506 | Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimer | 1e-10 | ||
| 3r44_A | 517 | Mycobacterium Tuberculosis Fatty Acyl Coa Synthetas | 1e-10 | ||
| 3cw8_X | 504 | 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cb | 2e-10 | ||
| 1t5d_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chl | 4e-10 | ||
| 2qvz_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATIO | 4e-10 | ||
| 2qvx_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATIO | 4e-10 | ||
| 3dlp_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, | 5e-10 | ||
| 1t5h_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SE | 6e-10 | ||
| 3o82_A | 544 | Structure Of Base N-Terminal Domain From Acinetobac | 1e-09 | ||
| 3g7s_A | 549 | Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Li | 1e-09 | ||
| 4gxr_A | 503 | Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Len | 1e-09 | ||
| 1ult_A | 541 | Crystal Structure Of Tt0168 From Thermus Thermophil | 2e-09 | ||
| 2v7b_A | 529 | Crystal Structures Of A Benzoate Coa Ligase From Bu | 4e-08 | ||
| 3nyq_A | 505 | Malonyl-Coa Ligase Ternary Product Complex With Met | 4e-07 | ||
| 3etc_A | 580 | 2.1 A Structure Of Acyl-Adenylate Synthetase From M | 9e-06 | ||
| 2vsq_A | 1304 | Structure Of Surfactin A Synthetase C (Srfa-C), A N | 1e-05 | ||
| 1mdb_A | 539 | Crystal Structure Of Dhbe In Complex With Dhb-adeny | 6e-05 | ||
| 3ipl_A | 501 | Crystal Structure Of O-Succinylbenzoic Acid-Coa Lig | 1e-04 | ||
| 1md9_A | 539 | Crystal Structure Of Dhbe In Complex With Dhb And A | 2e-04 | ||
| 3b7w_A | 570 | Crystal Structure Of Human Acyl-Coa Synthetase Medi | 4e-04 | ||
| 2wd9_A | 569 | Crystal Structure Of Human Acyl-coa Synthetase Medi | 4e-04 |
| >pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 | Back alignment and structure |
|
| >pdb|2D1Q|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With Mgatp Length = 548 | Back alignment and structure |
| >pdb|2D1T|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Red-Color Emission S286n Mutant Complexed With High-Energy Intermediate Analogue Length = 548 | Back alignment and structure |
| >pdb|2D1S|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With High-Energy Intermediate Analogue Length = 548 | Back alignment and structure |
| >pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 | Back alignment and structure |
| >pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 | Back alignment and structure |
| >pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 | Back alignment and structure |
| >pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 | Back alignment and structure |
| >pdb|3A9U|A Chain A, Crystal Structures And Enzymatic Mechanisms Of A Populus Tomentosa 4- Coumarate--Coa Ligase Length = 536 | Back alignment and structure |
| >pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 | Back alignment and structure |
| >pdb|3IVR|A Chain A, Crystal Structure Of Putative Long-Chain-Fatty-Acid Coa Ligase From Rhodopseudomonas Palustris Cga009 Length = 509 | Back alignment and structure |
| >pdb|4FUQ|A Chain A, Crystal Structure Of Apo Matb From Rhodopseudomonas Palustris Length = 503 | Back alignment and structure |
| >pdb|4FUT|A Chain A, Crystal Structure Of Atp Bound Matb From Rhodopseudomonas Palustris Length = 503 | Back alignment and structure |
| >pdb|4GXQ|A Chain A, Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimera B1 Length = 506 | Back alignment and structure |
| >pdb|3R44|A Chain A, Mycobacterium Tuberculosis Fatty Acyl Coa Synthetase Length = 517 | Back alignment and structure |
| >pdb|3CW8|X Chain X, 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cba-adenylate Length = 504 | Back alignment and structure |
| >pdb|1T5D|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chlorobenzoate Length = 504 | Back alignment and structure |
| >pdb|2QVZ|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 | Back alignment and structure |
| >pdb|2QVX|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 | Back alignment and structure |
| >pdb|3DLP|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, BOUND To 4cb Length = 504 | Back alignment and structure |
| >pdb|1T5H|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SELENOMETHIONINE Length = 504 | Back alignment and structure |
| >pdb|3O82|A Chain A, Structure Of Base N-Terminal Domain From Acinetobacter Baumannii Bound To 5'-O-[n-(2,3-Dihydroxybenzoyl)sulfamoyl] Adenosine Length = 544 | Back alignment and structure |
| >pdb|3G7S|A Chain A, Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Ligase (Fadd1) From Archaeoglobus Fulgidus Length = 549 | Back alignment and structure |
| >pdb|4GXR|A Chain A, Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Length = 503 | Back alignment and structure |
| >pdb|1ULT|A Chain A, Crystal Structure Of Tt0168 From Thermus Thermophilus Hb8 Length = 541 | Back alignment and structure |
| >pdb|2V7B|A Chain A, Crystal Structures Of A Benzoate Coa Ligase From Burkholderia Xenovorans Lb400 Length = 529 | Back alignment and structure |
| >pdb|3NYQ|A Chain A, Malonyl-Coa Ligase Ternary Product Complex With Methylmalonyl-Coa And Amp Bound Length = 505 | Back alignment and structure |
| >pdb|3ETC|A Chain A, 2.1 A Structure Of Acyl-Adenylate Synthetase From Methanosarcina Acetivorans Containing A Link Between Lys256 And Cys298 Length = 580 | Back alignment and structure |
| >pdb|2VSQ|A Chain A, Structure Of Surfactin A Synthetase C (Srfa-C), A Nonribosomal Peptide Synthetase Termination Module Length = 1304 | Back alignment and structure |
| >pdb|1MDB|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb-adenylate Length = 539 | Back alignment and structure |
| >pdb|3IPL|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid-Coa Ligase From Staphylococcus Aureus Subsp. Aureus Mu50 Length = 501 | Back alignment and structure |
| >pdb|1MD9|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb And Amp Length = 539 | Back alignment and structure |
| >pdb|3B7W|A Chain A, Crystal Structure Of Human Acyl-Coa Synthetase Medium-Chain Family Member 2a, With L64p Mutation Length = 570 | Back alignment and structure |
| >pdb|2WD9|A Chain A, Crystal Structure Of Human Acyl-coa Synthetase Medium-chain Family Member 2a (l64p Mutation) In Complex With Ibuprofen Length = 569 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 3e-48 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 9e-48 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 1e-47 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 2e-47 | |
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 2e-42 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 3e-41 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 2e-39 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 2e-38 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 4e-38 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 4e-38 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 9e-38 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 4e-37 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 2e-35 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 2e-34 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 6e-31 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 3e-29 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 2e-23 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 2e-21 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 1e-15 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 6e-15 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 7e-13 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 5e-09 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 2e-08 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 2e-08 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 5e-08 | |
| 1pg4_A | 652 | Acetyl-COA synthetase; AMP-forming, adenylate-form | 1e-07 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 5e-07 | |
| 1ry2_A | 663 | Acetyl-coenzyme A synthetase 1, acyl-activating en | 6e-07 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 1e-06 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 1e-06 | |
| 3hgu_A | 369 | EHPF; phenazine, antibiotic, biosynthetic protein; | 8e-04 |
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 | Back alignment and structure |
|---|
Score = 161 bits (410), Expect = 3e-48
Identities = 51/133 (38%), Positives = 75/133 (56%), Gaps = 15/133 (11%)
Query: 28 IKIIDPVTSVQLPDGKTGELCLKGD-VFLGYRNKVEATKEMLDDDGWLHTGDLAYRLPDG 86
+KI+DP T LP + GE+C++GD + GY N EAT +D +GWLHTGD+ Y D
Sbjct: 366 MKIVDPETGASLPRNQPGEICIRGDQIMKGYLNDPEATSRTIDKEGWLHTGDIGYIDDDD 425
Query: 87 THFI--------------ISPCELESIFRQHPDVEDVAVIGIPHDVFGELPAAVVVPKPN 132
FI ++P ELE++ HP++ D AV+G+ + GE+P A VV
Sbjct: 426 ELFIVDRLKELIKYKGFQVAPAELEALLIAHPEISDAAVVGLKDEDAGEVPVAFVVKSEK 485
Query: 133 SSVTAEEVKQFVE 145
S T +E+KQ++
Sbjct: 486 SQATEDEIKQYIS 498
|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 | Back alignment and structure |
|---|
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Length = 521 | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Length = 563 | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 | Back alignment and structure |
|---|
| >1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Length = 652 | Back alignment and structure |
|---|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Length = 620 | Back alignment and structure |
|---|
| >1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Length = 663 | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Length = 512 | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 | Back alignment and structure |
|---|
| >3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Length = 369 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 100.0 | |
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 99.98 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 99.97 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 99.97 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 99.97 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 99.97 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 99.97 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 99.97 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 99.97 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 99.96 | |
| 4gr5_A | 570 | Non-ribosomal peptide synthetase; MBTH-like domain | 99.96 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 99.96 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 99.96 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 99.96 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.96 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 99.96 | |
| 1pg4_A | 652 | Acetyl-COA synthetase; AMP-forming, adenylate-form | 99.96 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 99.96 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 99.96 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.96 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.96 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 99.96 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 99.95 | |
| 1ry2_A | 663 | Acetyl-coenzyme A synthetase 1, acyl-activating en | 99.95 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 99.95 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 99.94 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 99.94 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 99.94 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 99.94 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 99.93 | |
| 3qov_A | 436 | Phenylacetate-coenzyme A ligase; acetyl-COA synthe | 99.84 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 99.83 | |
| 2y27_A | 437 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.82 | |
| 2y4o_A | 443 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.81 | |
| 4gs5_A | 358 | Acyl-COA synthetase (AMP-forming)/AMP-acid ligase | 99.68 | |
| 3hgu_A | 369 | EHPF; phenazine, antibiotic, biosynthetic protein; | 98.59 | |
| 3lax_A | 109 | Phenylacetate-coenzyme A ligase; structural genomi | 98.53 | |
| 3gxs_A | 109 | Phenylacetate-coenzyme A ligase; APC62324.1, struc | 98.11 | |
| 4eql_A | 581 | 4-substituted benzoates-glutamate ligase GH3.12; f | 90.36 | |
| 4b2g_A | 609 | GH3-1 auxin conjugating enzyme; signaling protein, | 90.24 | |
| 4epl_A | 581 | Jasmonic acid-amido synthetase JAR1; ANL adenylati | 82.64 |
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=6.7e-32 Score=215.06 Aligned_cols=147 Identities=37% Similarity=0.679 Sum_probs=135.3
Q ss_pred CeeeeccCCcccc--------------cccCcCccccCCceEEEEcCCCCccCCCCCeeEEEEEcCC-CccccCCchhhh
Q psy4966 1 MFLVVGLVGKSKQ--------------KATLTGKHFQEHNAIKIIDPVTSVQLPDGKTGELCLKGDV-FLGYRNKVEATK 65 (149)
Q Consensus 1 ~~~~~g~~e~~~~--------------~~~~~g~~p~~~~~~~i~d~~~g~~~~~g~~Gel~v~~~~-~~gY~~~~~~~~ 65 (149)
++..||+||++.. ..+++|+ |+++++++|+|+++++++|+|+.|||+++|+. +.|||++|+.|.
T Consensus 326 l~~~YG~TE~~~~~~~~~~~~~~~~~~~~~~~G~-~~~~~~~~i~d~~~~~~~~~g~~GEl~v~g~~v~~GY~~~p~~t~ 404 (536)
T 3ni2_A 326 LGQGYGMTEAGPVLAMCLAFAKEPFDIKPGACGT-VVRNAEMKIVDPETGASLPRNQPGEICIRGDQIMKGYLNDPEATS 404 (536)
T ss_dssp EEEEEECGGGSSEEEECGGGSSSCCCCCTTCCCE-ECSSCEEEEECTTTCCBCCTTCCEEEEEESTTSCSEETTCHHHHH
T ss_pred ccccccccccchhhhcccccCCccccCCCCCeeE-eCCCcEEEEEeCCCCcCCCCCCccEEEEeCcccchhhcCChhHHH
Confidence 3578999998732 3456788 99999999999888999999999999999999 999999999999
Q ss_pred cccCCCCeEEcCceEEEcCCCeEEEE--------------ChHHHHHHHhcCCCcccEEEEeeecCCCCCeEEEEEEeCC
Q psy4966 66 EMLDDDGWLHTGDLAYRLPDGTHFII--------------SPCELESIFRQHPDVEDVAVIGIPHDVFGELPAAVVVPKP 131 (149)
Q Consensus 66 ~~~~~~~~~~TGD~~~~~~~G~~~i~--------------~~~eIE~~l~~~~~V~~~~v~~~~~~~~g~~~~a~v~~~~ 131 (149)
..|..++||+|||+|++|+||+++|+ +|.|||++|.+||+|.+++|++++++.+|+.++|+|+..+
T Consensus 405 ~~~~~~g~~~TGDl~~~~~dG~l~~~GR~dd~ik~~G~~v~p~eIE~~l~~~p~V~~a~Vv~~~~~~~g~~~~a~vv~~~ 484 (536)
T 3ni2_A 405 RTIDKEGWLHTGDIGYIDDDDELFIVDRLKELIKYKGFQVAPAELEALLIAHPEISDAAVVGLKDEDAGEVPVAFVVKSE 484 (536)
T ss_dssp HHBCTTSCEEEEEEEEECTTSCEEEEEECSCCEEETTEEECHHHHHHHHHTSTTEEEEEEEEEEETTTEEEEEEEEEECT
T ss_pred hhccCCCceEcccEEEEcCCceEEEEecccceEEECCEEECHHHHHHHHHhCCCcceEEEEeeecCCCCceeEEEEEecC
Confidence 99988999999999999999999997 9999999999999999999999999999999999999998
Q ss_pred CCCCCHHHHHHHhhccc
Q psy4966 132 NSSVTAEEVKQFVEFPR 148 (149)
Q Consensus 132 ~~~~~~~~l~~~l~~~~ 148 (149)
+...+.++|+++|++..
T Consensus 485 ~~~~~~~~l~~~l~~~l 501 (536)
T 3ni2_A 485 KSQATEDEIKQYISKQV 501 (536)
T ss_dssp TCCCCHHHHHHHHHTTS
T ss_pred CCCCCHHHHHHHHHHhc
Confidence 88889999999998753
|
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 | Back alignment and structure |
|---|
| >1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} | Back alignment and structure |
|---|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* | Back alignment and structure |
|---|
| >3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A | Back alignment and structure |
|---|
| >2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* | Back alignment and structure |
|---|
| >2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* | Back alignment and structure |
|---|
| >3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* | Back alignment and structure |
|---|
| >4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} | Back alignment and structure |
|---|
| >4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 149 | ||||
| d1lcia_ | 541 | e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali | 2e-35 | |
| d1v25a_ | 534 | e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 | 3e-31 | |
| d1pg4a_ | 643 | e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en | 9e-28 | |
| d1ry2a_ | 640 | e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast | 1e-25 | |
| d1amua_ | 514 | e.23.1.1 (A:) Phenylalanine activating domain of g | 2e-24 | |
| d3cw9a1 | 503 | e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc | 5e-23 | |
| d1mdba_ | 536 | e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B | 3e-22 |
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Luciferase species: Firefly (Photinus pyralis) [TaxId: 7054]
Score = 126 bits (317), Expect = 2e-35
Identities = 54/132 (40%), Positives = 75/132 (56%), Gaps = 15/132 (11%)
Query: 28 IKIIDPVTSVQLPDGKTGELCLKGD-VFLGYRNKVEATKEMLDDDGWLHTGDLAYRLPDG 86
K++D T L + GELC++G + GY N EAT ++D DGWLH+GD+AY D
Sbjct: 368 AKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDE 427
Query: 87 THFI--------------ISPCELESIFRQHPDVEDVAVIGIPHDVFGELPAAVVVPKPN 132
FI ++P ELESI QHP++ D V G+P D GELPAAVVV +
Sbjct: 428 HFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHG 487
Query: 133 SSVTAEEVKQFV 144
++T +E+ +V
Sbjct: 488 KTMTEKEIVDYV 499
|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| d1lcia_ | 541 | Luciferase {Firefly (Photinus pyralis) [TaxId: 705 | 99.97 | |
| d1pg4a_ | 643 | Acetyl-CoA synthetase {Salmonella enterica [TaxId: | 99.96 | |
| d1v25a_ | 534 | Long chain fatty acid-CoA ligase TT0168 {Thermus t | 99.96 | |
| d1amua_ | 514 | Phenylalanine activating domain of gramicidin synt | 99.94 | |
| d1ry2a_ | 640 | Acetyl-CoA synthetase {Baker's yeast (Saccharomyce | 99.94 | |
| d1mdba_ | 536 | Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil | 99.91 | |
| d3cw9a1 | 503 | 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId | 99.87 | |
| d1rbli_ | 109 | Ribulose 1,5-bisphosphate carboxylase-oxygenase {S | 82.28 | |
| d2cyya2 | 86 | Putative transcriptional regulator PH1519 {Archaeo | 80.34 |
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Luciferase species: Firefly (Photinus pyralis) [TaxId: 7054]
Probab=99.97 E-value=2.2e-31 Score=208.39 Aligned_cols=145 Identities=41% Similarity=0.660 Sum_probs=133.2
Q ss_pred eeeeccCCccc---------ccccCcCccccCCceEEEEcCCCCccCCCCCeeEEEEEcCC-CccccCCchhhhcccCCC
Q psy4966 2 FLVVGLVGKSK---------QKATLTGKHFQEHNAIKIIDPVTSVQLPDGKTGELCLKGDV-FLGYRNKVEATKEMLDDD 71 (149)
Q Consensus 2 ~~~~g~~e~~~---------~~~~~~g~~p~~~~~~~i~d~~~g~~~~~g~~Gel~v~~~~-~~gY~~~~~~~~~~~~~~ 71 (149)
+..||+||++. ...+++|+ |+|+++++|+|++++++++.|+.|||+++|+. +.||+++++.+...+..+
T Consensus 334 ~~~YG~TE~~~~~~~~~~~~~~~~svG~-p~~~~~~~i~d~d~~~~~~~g~~Gel~v~g~~~~~gY~~~~~~~~~~~~~~ 412 (541)
T d1lcia_ 334 RQGYGLTETTSAILITPEGDDKPGAVGK-VVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKD 412 (541)
T ss_dssp BCEECCGGGSSCSEECCCC---CCCCBE-ECTTCEEEEECTTTCCBCCTTCCEEEEEESTTSCSEETTBHHHHHHHBCTT
T ss_pred eecCCccccCceEEecCcccCCCCcccc-ccCCCEEEEEECCCCcCCCCCCeEEEEEccCccCCeeCCChhhhhhcccCC
Confidence 56899999964 34567898 99999999999888999999999999999999 999999999998888789
Q ss_pred CeEEcCceEEEcCCCeEEEE--------------ChHHHHHHHhcCCCcccEEEEeeecCCCCCeEEEEEEeCCCCCCCH
Q psy4966 72 GWLHTGDLAYRLPDGTHFII--------------SPCELESIFRQHPDVEDVAVIGIPHDVFGELPAAVVVPKPNSSVTA 137 (149)
Q Consensus 72 ~~~~TGD~~~~~~~G~~~i~--------------~~~eIE~~l~~~~~V~~~~v~~~~~~~~g~~~~a~v~~~~~~~~~~ 137 (149)
+||+|||+++++++|++++. +|.|||++|.+||+|.+|+|++++++..|++++|+|+++++...+.
T Consensus 413 ~~~~TGDl~~~~~~G~~~~~GR~~d~i~~~G~~v~~~~IE~~l~~~p~V~~~~v~~~~~~~~g~~~~a~v~~~~~~~~~~ 492 (541)
T d1lcia_ 413 GWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTE 492 (541)
T ss_dssp SCEEEEEEEEECTTCCEEEC-----CEEETTEEECHHHHHHHHHTSTTEEEEEEEEEEETTTEEEEEEEEEECTTCCCCH
T ss_pred ccccCCCeeEEcCCeEEEEeeeecCEEEECCEEECHHHHHHHHHhCCCccEEEEEEEECCCCCEEEEEEEEECCCCCCCH
Confidence 99999999999999999996 9999999999999999999999999999999999999998888999
Q ss_pred HHHHHHhhcc
Q psy4966 138 EEVKQFVEFP 147 (149)
Q Consensus 138 ~~l~~~l~~~ 147 (149)
++|+++|+++
T Consensus 493 ~~l~~~~~~~ 502 (541)
T d1lcia_ 493 KEIVDYVASQ 502 (541)
T ss_dssp HHHHHHHHHH
T ss_pred HHHHHHHHHh
Confidence 9999988864
|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1rbli_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]} | Back information, alignment and structure |
|---|
| >d2cyya2 d.58.4.2 (A:65-150) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|