Psyllid ID: psy5059

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------
GTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKFIESKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYQRRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDTKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQHCEKEGNIPATTSSRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKESTV
ccccccccEEEEEcccccccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccEEccccccccHHHHHccccccccccccccccccccEEEccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHcccccccccccHHHHcccccccHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHccccccccccEEEEEcccccccccHHHHHccccccEEEEEEEEEccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccHHHHccHHHHHHHccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHcc
ccccccccEEEEEEcccccccHHHHHHHcccccccccccEccccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHcccccccccccEEcccEEEEEEEccccccccccccccccccHHHcccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHcccccEEccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHccccccEEEEEEEcccccEEEEEcccccccccccEEEEEccEEcccccEEEEEcccHHHHHHcccccHHHHHHHHHHHHcHHHHHHcccccccccccHHHcEEcccccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHccccccEEEEEEEEEccccccccHHHHHcccEEEEEEEEEEEEEccHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHccccccHHHHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHcccHcHHHHHcHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccHHccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHccc
gtdaiqlpqiVVVGtqssgkssVIESlvgksflprgigivtrrplilqlyycpkddreKRTAAAVINKLQDVFNtvgtdaiqlpqivvvgtqssgkssVIESlvgksflprgigivtrrplilqlyycpkddrekRTAAagtmdldawgqflhtkdkvfrDFDDIRREIEDETERlagknkgicTMDLDAwgqflhtkdkvfrDFDDIRREIEDETERLagknkgicsepIILKIYSTSVLNltlvdlpgitkvpvgdqpdDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLaketdvdgrrtldlldidlpgitkvpvgdqpdDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLaketdvdgrrTLAVVTKIDLMDAGTDAIDILCGrvipvkldvdgRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLaketdvdgrrTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVnrsqqdiidnkSIKDAIKDEAAFLQRkyptlasrngTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNsygedvsdkSQTLLQIITKFASAYCSTVEENGIFKFieskknpalHERIVEVVTQLLRRRLPATNTMVENLLAIELAYIntkhpdfhkdaalVPSLIKSAEEDYQRRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYkadsasellnESEWVAQRRKeasdtkyptlasrnGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNsygedvsdkSQTLLQIITKFASAYCSTvegtarniettelcggaRICYIFHEIFGKvldginpldgltkMDILTAIRnatgprpalfvpeVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQHCekegnipattssrtlsekekRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYkadsasellnESEWVAQRRKESTV
gtdaiqlpqivvvgtqssgkssvieslvgksflprgigivtrrplILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESlvgksflprgigivtrrpliLQLYYCPKDDREKRTAAAGTMDldawgqflhtkdkvfrdFDDIRREIEDeterlagknkgiCTMDLDAwgqflhtkdkvfrdfDDIRREIEdeterlagknkgicsepIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLklaketdvdgrrtldlldidlpgitkvpvgdqpDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESlklaketdvdgrrTLAVVtkidlmdagtdaidilCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESlklaketdvdgrrTLAVVtkidlmdagTDAIDILCGRVIPVKLGIIgvvnrsqqdiidnkSIKDAIKDEAAFLQrkyptlasrngtLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKFieskknpalhERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYqrrtlsekekrdcdvIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRrkeasdtkyptlasrngTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQhcekegnipattssrtlsekekrdCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKAdsasellnesewvaqrrkestv
GTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVfrdfddirreiedeterLAGKNKGICTMDLDAWGQFLHTKDKVfrdfddirreiedeterLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKFIESKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYQRRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDTKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQHCEKEGNIPATTSSRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKESTV
********QIVVVGT******SVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMAT*****LA**TDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMAT***LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATS**LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKFIESKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLI******************DCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSA**LL****W**************TLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQHC*********************DCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKAD*********************
***AIQLPQIVVV*******************LPRGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYY********************WGQFLHTKDKVFRDFDDIRREIEDET***************DAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMA**ESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRR*YI******************ILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSY****SDKSQTLLQIITKFASAYCSTVEENGIFKFIESKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKD*****************************VIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDTKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQ**************KSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAI***********VPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQHCEKEGNIPATTSSRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADS*************RRKES**
GTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKFIESKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYQRRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWV***********YPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQHCEKEGNIPAT***********RDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNE*************
***AIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPK**************************KVFRDFDDIRREIE***************MDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKFIESKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYQRRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDTKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQHCEKEGNIPATTSSRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQR******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKFIESKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYQRRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDTKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQHCEKEGNIPATTSSRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKESTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1036 2.2.26 [Sep-21-2011]
O35303 755 Dynamin-1-like protein OS yes N/A 0.166 0.229 0.8 8e-85
O00429 736 Dynamin-1-like protein OS yes N/A 0.166 0.235 0.8 9e-85
Q2KIA5 749 Dynamin-1-like protein OS yes N/A 0.166 0.230 0.8 1e-84
Q8K1M6 742 Dynamin-1-like protein OS yes N/A 0.166 0.233 0.8 1e-84
Q7SXN5 691 Dynamin-1-like protein OS yes N/A 0.166 0.250 0.782 5e-83
Q94464853 Dynamin-A OS=Dictyosteliu yes N/A 0.194 0.235 0.507 2e-63
P54861757 Dynamin-related protein D yes N/A 0.218 0.298 0.494 8e-62
P21576704 Vacuolar protein sorting- no N/A 0.238 0.350 0.485 4e-61
Q09748781 Dynamin-like protein C12C yes N/A 0.246 0.326 0.467 6e-61
Q9URZ5678 Vacuolar protein sorting- no N/A 0.217 0.331 0.483 1e-56
>sp|O35303|DNM1L_RAT Dynamin-1-like protein OS=Rattus norvegicus GN=Dnm1l PE=1 SV=1 Back     alignment and function desciption
 Score =  316 bits (809), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 161/175 (92%)

Query: 768 KYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQ 827
           KYP+LA+RNGT YLA+TLNRLLMHHIRDCLP+LKTR+NV+ +Q+Q+LLNSYGE V DKS 
Sbjct: 285 KYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSA 344

Query: 828 TLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMD 887
           TLLQ+ITKFA+ YC+T+EGTA+ IET+ELCGGARICYIFHE FG+ L+ ++PL GL  +D
Sbjct: 345 TLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTID 404

Query: 888 ILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQRIIQHC 942
           ILTAIRNATGPRPALFVPEVSFELLVKRQI+RLEEPS RCVELVHEEMQRIIQHC
Sbjct: 405 ILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHC 459
Functions in mitochondrial and peroxisomal division. Mediates membrane fission through oligomerization into ring-like structures which wrap around the scission site to constict and sever the mitochondrial membrane through a GTP hydrolysis-dependent mechanism. Required for normal brain development. Facilitates developmentally-regulated apoptosis during neural tube development. Required for a normal rate of cytochrome c release and caspase activation during apoptosis. May be involved in vesicle transport (By similarity). Also required for mitochondrial fission during mitosis.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 6EC: .EC: 5EC: .EC: 5
>sp|O00429|DNM1L_HUMAN Dynamin-1-like protein OS=Homo sapiens GN=DNM1L PE=1 SV=2 Back     alignment and function description
>sp|Q2KIA5|DNM1L_BOVIN Dynamin-1-like protein OS=Bos taurus GN=DNM1L PE=2 SV=1 Back     alignment and function description
>sp|Q8K1M6|DNM1L_MOUSE Dynamin-1-like protein OS=Mus musculus GN=Dnm1l PE=1 SV=2 Back     alignment and function description
>sp|Q7SXN5|DNM1L_DANRE Dynamin-1-like protein OS=Danio rerio GN=dnm1l PE=2 SV=1 Back     alignment and function description
>sp|Q94464|DYNA_DICDI Dynamin-A OS=Dictyostelium discoideum GN=dymA PE=1 SV=2 Back     alignment and function description
>sp|P54861|DNM1_YEAST Dynamin-related protein DNM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNM1 PE=1 SV=1 Back     alignment and function description
>sp|P21576|VPS1_YEAST Vacuolar protein sorting-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS1 PE=1 SV=2 Back     alignment and function description
>sp|Q09748|YB68_SCHPO Dynamin-like protein C12C2.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.08 PE=3 SV=1 Back     alignment and function description
>sp|Q9URZ5|VPS1_SCHPO Vacuolar protein sorting-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1036
242004243534 dynamin, putative [Pediculus humanus cor 0.25 0.485 0.741 1e-113
328791681716 PREDICTED: dynamin related protein 1 iso 0.169 0.245 0.921 3e-94
380028458717 PREDICTED: dynamin-1-like protein [Apis 0.169 0.245 0.921 3e-94
170054101740 dynamin [Culex quinquefasciatus] gi|1678 0.256 0.359 0.592 3e-94
340708894719 PREDICTED: dynamin-1-like protein-like [ 0.169 0.244 0.921 3e-94
350419072719 PREDICTED: dynamin-1-like protein-like [ 0.169 0.244 0.921 5e-94
383865004736 PREDICTED: dynamin-1-like protein [Megac 0.169 0.239 0.915 6e-94
270007540748 hypothetical protein TcasGA2_TC014137 [T 0.193 0.267 0.806 5e-93
189237265713 PREDICTED: similar to dynamin [Tribolium 0.193 0.280 0.806 6e-93
194770996724 GF20595 [Drosophila ananassae] gi|190615 0.193 0.276 0.806 6e-93
>gi|242004243|ref|XP_002423017.1| dynamin, putative [Pediculus humanus corporis] gi|212505948|gb|EEB10279.1| dynamin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  416 bits (1069), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 212/286 (74%), Positives = 233/286 (81%), Gaps = 27/286 (9%)

Query: 410 KLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTL 469
           K+ V  +   IE QIK LV  +ISNPNSIILAV+TANTDMATSESLKLAKE D DGRRTL
Sbjct: 35  KVPVGDQPEDIEVQIKDLVFKFISNPNSIILAVITANTDMATSESLKLAKECDPDGRRTL 94

Query: 470 AVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQR 529
           AVVTK+DLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQ+DII+NK I+ A+KDEA+FLQR
Sbjct: 95  AVVTKLDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQKDIIENKDIESALKDEASFLQR 154

Query: 530 KYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQ 589
           KYPTLA+RNGT YLAKTLNRLLMHHIRDCLPDLK RVN MISQFQTLLNSYGEDVSDKSQ
Sbjct: 155 KYPTLANRNGTPYLAKTLNRLLMHHIRDCLPDLKARVNAMISQFQTLLNSYGEDVSDKSQ 214

Query: 590 TLLQIITKFASAYCSTVEENGIFKFIESK-------------------------KNPALH 624
           TLLQIITKFASAYCST+E  G  + IE+                          + P L+
Sbjct: 215 TLLQIITKFASAYCSTIE--GTARNIETNELTLHQIXXQRIIQHCGVEVQQEMLRFPKLY 272

Query: 625 ERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAAL 670
           E+IV+VVT LLRRRLP TN MVENL+AIELAYINTKHPDFH+DAA+
Sbjct: 273 EKIVDVVTHLLRRRLPTTNQMVENLVAIELAYINTKHPDFHRDAAM 318

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328791681|ref|XP_394947.3| PREDICTED: dynamin related protein 1 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380028458|ref|XP_003697918.1| PREDICTED: dynamin-1-like protein [Apis florea] Back     alignment and taxonomy information
>gi|170054101|ref|XP_001862974.1| dynamin [Culex quinquefasciatus] gi|167874494|gb|EDS37877.1| dynamin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|340708894|ref|XP_003393052.1| PREDICTED: dynamin-1-like protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350419072|ref|XP_003492061.1| PREDICTED: dynamin-1-like protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383865004|ref|XP_003707967.1| PREDICTED: dynamin-1-like protein [Megachile rotundata] Back     alignment and taxonomy information
>gi|270007540|gb|EFA03988.1| hypothetical protein TcasGA2_TC014137 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189237265|ref|XP_001815130.1| PREDICTED: similar to dynamin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194770996|ref|XP_001967565.1| GF20595 [Drosophila ananassae] gi|190615066|gb|EDV30590.1| GF20595 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1036
FB|FBgn0026479 735 Drp1 "Dynamin related protein 0.257 0.363 0.633 1.1e-164
UNIPROTKB|O00429 736 DNM1L "Dynamin-1-like protein" 0.168 0.237 0.8 6.2e-179
UNIPROTKB|E1C255 722 DNM1L "Uncharacterized protein 0.168 0.242 0.8 2.7e-178
UNIPROTKB|J9NRH1 736 DNM1L "Uncharacterized protein 0.168 0.237 0.8 2.7e-178
UNIPROTKB|J9NZA2 701 DNM1L "Uncharacterized protein 0.168 0.249 0.8 2.7e-178
UNIPROTKB|F1NPT0 696 DNM1L "Uncharacterized protein 0.168 0.251 0.8 2.7e-178
ZFIN|ZDB-GENE-040426-1556 691 dnm1l "dynamin 1-like" [Danio 0.168 0.253 0.782 3e-177
MGI|MGI:1921256 742 Dnm1l "dynamin 1-like" [Mus mu 0.168 0.235 0.8 1e-176
UNIPROTKB|G8JLD5 712 DNM1L "Dynamin-1-like protein" 0.168 0.245 0.8 1.5e-175
UNIPROTKB|J3KPI2 738 DNM1L "Dynamin-1-like protein" 0.168 0.237 0.8 1.5e-175
FB|FBgn0026479 Drp1 "Dynamin related protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 831 (297.6 bits), Expect = 1.1e-164, Sum P(3) = 1.1e-164
 Identities = 173/273 (63%), Positives = 204/273 (74%)

Query:   746 SASELLNESEWVAQRRKEAS--DTKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTR 803
             S  +++++     Q + EA+    KYPTLA+RNGT YLAKTLNRLLMHHIRDCLPDLKTR
Sbjct:   247 SQKDIMDQKHIDDQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLKTR 306

Query:   804 VNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARIC 863
             VN+M +QFQ+LLNSYGEDVSDKSQTLLQIITKF+SAYC T+EGTARNIETTELCGGAR+ 
Sbjct:   307 VNIMATQFQSLLNSYGEDVSDKSQTLLQIITKFSSAYCCTIEGTARNIETTELCGGARMG 366

Query:   864 YIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEP 923
             YIFHE FG+ LD I+PL GL+KMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEP
Sbjct:   367 YIFHETFGRTLDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEP 426

Query:   924 SQRCVELVHEEMQRIIQHCEKEGNIPATTSSRTLSEKEKRDCDVIERLIKSYFYIIRKSI 983
             S RCVEL+HEEMQRI+QHC   GN       R     EK   DV+ +L++         +
Sbjct:   427 SLRCVELIHEEMQRIVQHC---GNEVQQEMLRFPKLHEKI-VDVVTQLLRRRLPHTNVMV 482

Query:   984 QDTVPKAIMHFLVNYVKDNLQSELVTHLYKADS 1016
             ++ V   + +    +   +  + LV  L K DS
Sbjct:   483 ENIVAIELAYINTKHPDFHKDAALVPSLLKTDS 515
GO:0005875 "microtubule associated complex" evidence=ISS;IDA
GO:0016185 "synaptic vesicle budding from presynaptic membrane" evidence=NAS
GO:0003924 "GTPase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0000910 "cytokinesis" evidence=IMP
GO:0007005 "mitochondrion organization" evidence=IMP
GO:0016050 "vesicle organization" evidence=IMP
GO:0048312 "intracellular distribution of mitochondria" evidence=IMP
GO:0051646 "mitochondrion localization" evidence=IMP
GO:0030382 "sperm mitochondrion organization" evidence=IMP
UNIPROTKB|O00429 DNM1L "Dynamin-1-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C255 DNM1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRH1 DNM1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZA2 DNM1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPT0 DNM1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1556 dnm1l "dynamin 1-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1921256 Dnm1l "dynamin 1-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G8JLD5 DNM1L "Dynamin-1-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KPI2 DNM1L "Dynamin-1-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.5.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1036
cd08771278 cd08771, DLP_1, Dynamin_like protein family includ 1e-76
pfam01031296 pfam01031, Dynamin_M, Dynamin central region 3e-73
smart00053240 smart00053, DYNc, Dynamin, GTPase 1e-64
cd08771278 cd08771, DLP_1, Dynamin_like protein family includ 1e-50
pfam01031296 pfam01031, Dynamin_M, Dynamin central region 3e-48
pfam00350168 pfam00350, Dynamin_N, Dynamin family 2e-45
cd08771278 cd08771, DLP_1, Dynamin_like protein family includ 6e-39
smart00053240 smart00053, DYNc, Dynamin, GTPase 2e-35
smart00053240 smart00053, DYNc, Dynamin, GTPase 7e-30
pfam0221290 pfam02212, GED, Dynamin GTPase effector domain 2e-26
pfam0221290 pfam02212, GED, Dynamin GTPase effector domain 2e-26
smart0030292 smart00302, GED, Dynamin GTPase effector domain 2e-22
smart0030292 smart00302, GED, Dynamin GTPase effector domain 2e-22
cd08771278 cd08771, DLP_1, Dynamin_like protein family includ 9e-22
pfam00350168 pfam00350, Dynamin_N, Dynamin family 9e-17
COG0699546 COG0699, COG0699, Predicted GTPases (dynamin-relat 1e-16
smart00053240 smart00053, DYNc, Dynamin, GTPase 9e-16
pfam00350168 pfam00350, Dynamin_N, Dynamin family 6e-15
COG0699546 COG0699, COG0699, Predicted GTPases (dynamin-relat 2e-14
pfam01031296 pfam01031, Dynamin_M, Dynamin central region 1e-11
pfam00350168 pfam00350, Dynamin_N, Dynamin family 2e-09
COG0699 546 COG0699, COG0699, Predicted GTPases (dynamin-relat 4e-05
COG0699546 COG0699, COG0699, Predicted GTPases (dynamin-relat 0.001
cd08771278 cd08771, DLP_1, Dynamin_like protein family includ 0.004
>gnl|CDD|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins Back     alignment and domain information 
 Score =  252 bits (646), Expect = 1e-76
 Identities = 125/242 (51%), Positives = 145/242 (59%), Gaps = 57/242 (23%)

Query: 81  IQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAA 140
           I LPQIVVVG QSSGKSSV+E+LVG+ FLPRG GI TRRPL LQL   P           
Sbjct: 1   IDLPQIVVVGDQSSGKSSVLEALVGRDFLPRGSGICTRRPLELQLRRSP----------- 49

Query: 141 GTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDK 200
                                        EDE E                WG+FLH K K
Sbjct: 50  -------------------------SESDEDEKEE---------------WGEFLHLKSK 69

Query: 201 VFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQP 260
            F DF+++R EIE ET+R+AG+NKGI  EPI L+I S  V NLTLVDLPG+ KVPVGDQP
Sbjct: 70  EFTDFEELREEIEKETDRVAGENKGISPEPIRLEIESPDVPNLTLVDLPGLIKVPVGDQP 129

Query: 261 DDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRT------LDL 314
           +DIE QI+ +V  YISNP SIILAVV AN D+A SE+LKLA+E D +G RT      LDL
Sbjct: 130 EDIEEQIRSMVKSYISNPRSIILAVVPANVDLANSEALKLAREVDPEGERTIGVLTKLDL 189

Query: 315 LD 316
           +D
Sbjct: 190 MD 191

The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes interferon-induced Mx proteins that inhibit a wide range of viruses by blocking an early stage of the replication cycle. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner. Length = 278
>gnl|CDD|216255 pfam01031, Dynamin_M, Dynamin central region Back     alignment and domain information
>gnl|CDD|197491 smart00053, DYNc, Dynamin, GTPase Back     alignment and domain information
>gnl|CDD|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins Back     alignment and domain information
>gnl|CDD|216255 pfam01031, Dynamin_M, Dynamin central region Back     alignment and domain information
>gnl|CDD|215874 pfam00350, Dynamin_N, Dynamin family Back     alignment and domain information
>gnl|CDD|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins Back     alignment and domain information
>gnl|CDD|197491 smart00053, DYNc, Dynamin, GTPase Back     alignment and domain information
>gnl|CDD|197491 smart00053, DYNc, Dynamin, GTPase Back     alignment and domain information
>gnl|CDD|202159 pfam02212, GED, Dynamin GTPase effector domain Back     alignment and domain information
>gnl|CDD|202159 pfam02212, GED, Dynamin GTPase effector domain Back     alignment and domain information
>gnl|CDD|128597 smart00302, GED, Dynamin GTPase effector domain Back     alignment and domain information
>gnl|CDD|128597 smart00302, GED, Dynamin GTPase effector domain Back     alignment and domain information
>gnl|CDD|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins Back     alignment and domain information
>gnl|CDD|215874 pfam00350, Dynamin_N, Dynamin family Back     alignment and domain information
>gnl|CDD|223771 COG0699, COG0699, Predicted GTPases (dynamin-related) [General function prediction only] Back     alignment and domain information
>gnl|CDD|197491 smart00053, DYNc, Dynamin, GTPase Back     alignment and domain information
>gnl|CDD|215874 pfam00350, Dynamin_N, Dynamin family Back     alignment and domain information
>gnl|CDD|223771 COG0699, COG0699, Predicted GTPases (dynamin-related) [General function prediction only] Back     alignment and domain information
>gnl|CDD|216255 pfam01031, Dynamin_M, Dynamin central region Back     alignment and domain information
>gnl|CDD|215874 pfam00350, Dynamin_N, Dynamin family Back     alignment and domain information
>gnl|CDD|223771 COG0699, COG0699, Predicted GTPases (dynamin-related) [General function prediction only] Back     alignment and domain information
>gnl|CDD|223771 COG0699, COG0699, Predicted GTPases (dynamin-related) [General function prediction only] Back     alignment and domain information
>gnl|CDD|206738 cd08771, DLP_1, Dynamin_like protein family includes dynamins and Mx proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1036
KOG0446|consensus657 100.0
KOG0446|consensus657 100.0
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 100.0
PF01031295 Dynamin_M: Dynamin central region; InterPro: IPR00 100.0
COG1160444 Predicted GTPases [General function prediction onl 99.97
KOG0447|consensus980 99.97
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 99.9
PF01031295 Dynamin_M: Dynamin central region; InterPro: IPR00 99.85
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.81
PRK03003472 GTP-binding protein Der; Reviewed 99.81
smart0030292 GED Dynamin GTPase effector domain. 99.8
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.8
smart0030292 GED Dynamin GTPase effector domain. 99.8
PRK00093435 GTP-binding protein Der; Reviewed 99.79
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.75
PF0221292 GED: Dynamin GTPase effector domain; InterPro: IPR 99.65
PF0221292 GED: Dynamin GTPase effector domain; InterPro: IPR 99.63
PRK09866741 hypothetical protein; Provisional 99.46
COG0218200 Predicted GTPase [General function prediction only 99.4
KOG0447|consensus980 99.21
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.12
COG0486454 ThdF Predicted GTPase [General function prediction 99.12
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.11
COG0699546 Predicted GTPases (dynamin-related) [General funct 99.08
COG1160444 Predicted GTPases [General function prediction onl 99.07
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.06
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.04
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.03
COG1159298 Era GTPase [General function prediction only] 99.03
PRK00089292 era GTPase Era; Reviewed 99.01
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.99
PRK12298390 obgE GTPase CgtA; Reviewed 98.94
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.91
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 98.91
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.89
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.88
KOG1191|consensus531 98.87
PRK04213201 GTP-binding protein; Provisional 98.85
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.84
PRK03003472 GTP-binding protein Der; Reviewed 98.83
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.81
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.8
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.79
PRK11058426 GTPase HflX; Provisional 98.79
PRK12299335 obgE GTPase CgtA; Reviewed 98.78
PRK15494339 era GTPase Era; Provisional 98.78
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.77
PRK00093435 GTP-binding protein Der; Reviewed 98.74
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.73
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.73
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.73
PRK12296500 obgE GTPase CgtA; Reviewed 98.71
PRK12297424 obgE GTPase CgtA; Reviewed 98.7
COG1084346 Predicted GTPase [General function prediction only 98.68
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.66
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.66
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.66
cd00881189 GTP_translation_factor GTP translation factor fami 98.65
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 98.65
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.64
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.64
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.64
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.63
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.62
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.61
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.6
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.6
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.59
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.59
cd01896233 DRG The developmentally regulated GTP-binding prot 98.59
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 98.59
PRK15467158 ethanolamine utilization protein EutP; Provisional 98.58
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.57
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.57
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.57
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.57
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.56
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.55
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.54
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.54
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.54
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.54
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.53
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.52
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.52
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.51
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.51
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.5
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.49
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.49
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 98.49
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.49
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.48
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.47
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.47
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.46
CHL00071409 tufA elongation factor Tu 98.45
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 98.45
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.44
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.44
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.44
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.44
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.44
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.43
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.42
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.41
PRK09554772 feoB ferrous iron transport protein B; Reviewed 98.41
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.41
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.41
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.4
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.39
PRK12317425 elongation factor 1-alpha; Reviewed 98.39
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.39
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.38
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.38
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 98.36
PRK12736394 elongation factor Tu; Reviewed 98.36
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.36
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.36
TIGR00475581 selB selenocysteine-specific elongation factor Sel 98.36
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.35
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.35
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.34
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.34
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 98.33
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.33
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.33
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.33
PLN03118211 Rab family protein; Provisional 98.32
KOG1423|consensus379 98.32
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.32
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.32
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.32
CHL00189742 infB translation initiation factor 2; Provisional 98.32
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 98.32
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.32
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 98.31
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 98.31
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.31
PLN03127447 Elongation factor Tu; Provisional 98.31
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.31
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 98.3
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.3
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.3
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 98.29
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.28
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.28
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.28
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.28
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.28
COG1163365 DRG Predicted GTPase [General function prediction 98.27
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.26
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 98.26
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 98.26
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.25
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.24
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.23
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.23
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 98.23
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 98.22
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.22
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 98.22
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 98.21
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.21
PLN00223181 ADP-ribosylation factor; Provisional 98.21
PLN03110216 Rab GTPase; Provisional 98.21
PRK00049396 elongation factor Tu; Reviewed 98.2
PTZ00133182 ADP-ribosylation factor; Provisional 98.2
PRK12735396 elongation factor Tu; Reviewed 98.2
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.2
PRK05306787 infB translation initiation factor IF-2; Validated 98.2
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.19
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.19
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.19
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.18
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.17
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 98.15
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 98.13
COG3596296 Predicted GTPase [General function prediction only 98.13
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.13
TIGR00485394 EF-Tu translation elongation factor TU. This align 98.12
PTZ00369189 Ras-like protein; Provisional 98.12
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.1
PLN03126478 Elongation factor Tu; Provisional 98.1
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 98.09
PLN03108210 Rab family protein; Provisional 98.09
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 98.09
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.08
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.08
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.07
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.05
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.04
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.04
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.04
PRK00007693 elongation factor G; Reviewed 98.03
PLN03071219 GTP-binding nuclear protein Ran; Provisional 98.03
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 98.03
PRK04004586 translation initiation factor IF-2; Validated 98.03
PRK12739691 elongation factor G; Reviewed 97.99
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 97.99
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 97.98
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 97.97
PRK09602396 translation-associated GTPase; Reviewed 97.95
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 97.94
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 97.94
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 97.92
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 97.92
PRK05433600 GTP-binding protein LepA; Provisional 97.92
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.92
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 97.92
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 97.91
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 97.91
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 97.91
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 97.89
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 97.88
KOG1489|consensus366 97.88
TIGR00484689 EF-G translation elongation factor EF-G. After pep 97.87
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 97.85
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 97.85
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 97.84
cd04105203 SR_beta Signal recognition particle receptor, beta 97.84
PRK00741526 prfC peptide chain release factor 3; Provisional 97.84
PRK09435332 membrane ATPase/protein kinase; Provisional 97.84
PRK10218607 GTP-binding protein; Provisional 97.84
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 97.82
PTZ00141446 elongation factor 1- alpha; Provisional 97.81
PRK04000411 translation initiation factor IF-2 subunit gamma; 97.79
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 97.78
PRK13351687 elongation factor G; Reviewed 97.76
COG2262411 HflX GTPases [General function prediction only] 97.74
KOG0094|consensus221 97.68
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 97.68
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 97.65
KOG0448|consensus749 97.65
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 97.62
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 97.61
PRK12740668 elongation factor G; Reviewed 97.59
COG1100219 GTPase SAR1 and related small G proteins [General 97.57
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 97.56
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 97.55
PF00025175 Arf: ADP-ribosylation factor family The prints ent 97.55
COG4917148 EutP Ethanolamine utilization protein [Amino acid 97.53
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 97.53
COG0218200 Predicted GTPase [General function prediction only 97.52
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.43
KOG2486|consensus320 97.43
COG0536369 Obg Predicted GTPase [General function prediction 97.37
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 97.37
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 97.32
COG1159298 Era GTPase [General function prediction only] 97.31
TIGR00503527 prfC peptide chain release factor 3. This translat 97.3
KOG0078|consensus207 97.29
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 97.29
COG2229187 Predicted GTPase [General function prediction only 97.28
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 97.21
PLN00043447 elongation factor 1-alpha; Provisional 97.1
KOG1490|consensus620 97.09
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 97.09
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 97.07
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.04
PTZ00258390 GTP-binding protein; Provisional 97.03
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.02
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 96.99
PRK12289352 GTPase RsgA; Reviewed 96.92
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 96.9
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 96.88
PRK09601364 GTP-binding protein YchF; Reviewed 96.87
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.85
PRK09563287 rbgA GTPase YlqF; Reviewed 96.84
PLN00116843 translation elongation factor EF-2 subunit; Provis 96.84
KOG0084|consensus205 96.83
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 96.78
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 96.76
PTZ00416836 elongation factor 2; Provisional 96.74
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 96.63
PRK00454196 engB GTP-binding protein YsxC; Reviewed 96.62
cd01878204 HflX HflX subfamily. A distinct conserved domain w 96.62
PRK07560731 elongation factor EF-2; Reviewed 96.61
PLN00023334 GTP-binding protein; Provisional 96.6
PRK11058426 GTPase HflX; Provisional 96.59
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.58
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 96.56
PRK12288347 GTPase RsgA; Reviewed 96.55
KOG1191|consensus531 96.54
PRK04213201 GTP-binding protein; Provisional 96.49
COG0486454 ThdF Predicted GTPase [General function prediction 96.49
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.49
TIGR00101199 ureG urease accessory protein UreG. This model rep 96.45
KOG1423|consensus379 96.44
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 96.43
PF09439181 SRPRB: Signal recognition particle receptor beta s 96.43
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 96.41
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 96.36
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 96.35
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 96.34
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 96.33
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 96.3
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 96.27
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 96.26
PTZ00258390 GTP-binding protein; Provisional 96.26
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 96.21
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 96.21
PRK12298390 obgE GTPase CgtA; Reviewed 96.21
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 96.2
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.17
KOG0091|consensus213 96.16
PRK09601364 GTP-binding protein YchF; Reviewed 96.14
KOG0092|consensus200 96.1
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 96.05
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 96.01
PRK09602396 translation-associated GTPase; Reviewed 96.01
PRK09866741 hypothetical protein; Provisional 95.97
TIGR00436270 era GTP-binding protein Era. Era is an essential G 95.89
COG1084346 Predicted GTPase [General function prediction only 95.86
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 95.78
PRK00089292 era GTPase Era; Reviewed 95.78
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 95.78
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 95.78
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.76
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 95.75
KOG0090|consensus238 95.74
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 95.74
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 95.74
KOG1707|consensus625 95.73
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 95.72
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 95.71
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 95.71
cd00154159 Rab Rab family. Rab GTPases form the largest famil 95.69
PRK15467158 ethanolamine utilization protein EutP; Provisional 95.66
PRK10416318 signal recognition particle-docking protein FtsY; 95.65
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 95.63
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 95.63
COG1161322 Predicted GTPases [General function prediction onl 95.61
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.56
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 95.55
cd04171164 SelB SelB subfamily. SelB is an elongation factor 95.52
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 95.51
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 95.5
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 95.48
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 95.47
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.45
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 95.45
KOG0075|consensus186 95.45
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.43
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 95.41
COG1161322 Predicted GTPases [General function prediction onl 95.39
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 95.38
COG1163365 DRG Predicted GTPase [General function prediction 95.38
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 95.38
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 95.36
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 95.35
PRK12296500 obgE GTPase CgtA; Reviewed 95.34
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 95.31
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 95.29
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 95.24
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 95.23
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 95.2
PRK12299335 obgE GTPase CgtA; Reviewed 95.18
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 95.18
KOG0094|consensus221 95.17
PRK14974336 cell division protein FtsY; Provisional 95.17
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 95.14
PRK09563287 rbgA GTPase YlqF; Reviewed 95.12
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 95.08
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 95.08
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 95.07
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 95.06
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 95.04
PRK12297424 obgE GTPase CgtA; Reviewed 95.02
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 95.02
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 95.0
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 94.98
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 94.96
TIGR00231161 small_GTP small GTP-binding protein domain. This m 94.95
cd01896233 DRG The developmentally regulated GTP-binding prot 94.94
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 94.92
cd04123162 Rab21 Rab21 subfamily. The localization and functi 94.92
KOG0080|consensus209 94.91
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 94.9
COG2262411 HflX GTPases [General function prediction only] 94.85
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 94.84
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 94.82
COG3276447 SelB Selenocysteine-specific translation elongatio 94.81
KOG1145|consensus683 94.81
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 94.79
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 94.79
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 94.79
PRK12288347 GTPase RsgA; Reviewed 94.78
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 94.78
KOG1424|consensus562 94.76
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 94.76
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 94.74
cd00881189 GTP_translation_factor GTP translation factor fami 94.73
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 94.73
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 94.73
PRK13768253 GTPase; Provisional 94.7
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 94.64
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 94.62
cd00876160 Ras Ras family. The Ras family of the Ras superfam 94.62
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 94.62
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 94.61
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 94.6
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 94.6
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 94.57
PRK15494339 era GTPase Era; Provisional 94.57
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 94.57
cd01881176 Obg_like The Obg-like subfamily consists of five w 94.51
PRK12289352 GTPase RsgA; Reviewed 94.49
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 94.48
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 94.45
KOG0410|consensus410 94.45
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 94.45
smart00178184 SAR Sar1p-like members of the Ras-family of small 94.43
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 94.41
PRK148451049 translation initiation factor IF-2; Provisional 94.4
KOG2203|consensus772 94.37
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 94.36
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 94.34
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 94.33
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 94.31
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 94.3
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 94.29
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 94.28
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 94.28
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 94.26
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 94.26
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 94.25
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 94.23
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 94.2
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 94.18
PRK12317425 elongation factor 1-alpha; Reviewed 94.16
KOG0395|consensus196 94.14
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 94.09
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 94.07
PRK13796365 GTPase YqeH; Provisional 94.07
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 94.03
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 94.02
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 94.02
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 94.01
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 93.87
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 93.85
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 93.83
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 93.83
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 93.79
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.71
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 93.69
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 93.68
COG3596296 Predicted GTPase [General function prediction only 93.65
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 93.65
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 93.64
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.64
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 93.62
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 93.6
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 93.55
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 93.52
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 93.52
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 93.5
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 93.48
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 93.41
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 93.29
COG1162301 Predicted GTPases [General function prediction onl 93.26
PLN03108210 Rab family protein; Provisional 93.22
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 93.2
KOG1954|consensus532 93.18
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 93.12
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 93.11
PTZ00369189 Ras-like protein; Provisional 93.11
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 93.08
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 93.07
KOG0093|consensus193 93.07
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 93.05
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 92.99
KOG1489|consensus366 92.99
TIGR00064272 ftsY signal recognition particle-docking protein F 92.99
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 92.98
COG0480697 FusA Translation elongation factors (GTPases) [Tra 92.95
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 92.86
PF00005137 ABC_tran: ABC transporter This structure is on hol 92.85
PLN03110216 Rab GTPase; Provisional 92.85
KOG0462|consensus650 92.83
KOG2486|consensus320 92.77
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 92.75
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 92.71
PLN03118211 Rab family protein; Provisional 92.7
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 92.7
PRK09554772 feoB ferrous iron transport protein B; Reviewed 92.69
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 92.69
PRK00098298 GTPase RsgA; Reviewed 92.66
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 92.63
PTZ00141446 elongation factor 1- alpha; Provisional 92.61
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 92.57
COG0699546 Predicted GTPases (dynamin-related) [General funct 92.55
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 92.54
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 92.53
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 92.51
KOG2655|consensus366 92.51
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 92.51
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 92.49
COG0012372 Predicted GTPase, probable translation factor [Tra 92.47
COG1100219 GTPase SAR1 and related small G proteins [General 92.46
>KOG0446|consensus Back     alignment and domain information 
Probab=100.00  E-value=3e-101  Score=925.09  Aligned_cols=528  Identities=47%  Similarity=0.699  Sum_probs=473.7

Q ss_pred             hhhhHHHHHHHHHhhhhcC-CCCCCCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhh
Q psy5059          59 KRTAAAVINKLQDVFNTVG-TDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRT  137 (1036)
Q Consensus        59 ~~~~~~l~~kL~~~~~~~g-~~~i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~  137 (1036)
                      ++.+++++|++|+.|..+| ...+++|+|||||+||||||||||+++|++|||||+|+|||||+++||.+.....     
T Consensus         4 ~~~li~~vn~lqd~~~~l~~~~~i~lP~I~vvG~QSsGKSSvLE~lvG~~flpRg~givTRrPlvlqL~~~~~~~-----   78 (657)
T KOG0446|consen    4 MRLLIPLSNPLQDKLEILGSSSFIPLPQIVVVGGQSSGKSSVLESLVGFVFLPRGVGIVTRRPLILQLSIVAGGD-----   78 (657)
T ss_pred             hhhccccchHHHHHHHHhcCCCcccCCceEEecCCCCcchhHHHHhhccccccccccceecccceeecccccCCc-----
Confidence            5678899999999999999 6789999999999999999999999999999999999999999999999864321     


Q ss_pred             hccCCCCcccccccc-ccccccccchhhhhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHH
Q psy5059         138 AAAGTMDLDAWGQFL-HTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDET  216 (1036)
Q Consensus       138 ~~~~~~~~~~w~~~~-~~~~~~~~df~~~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~  216 (1036)
                              .+|++|+ |++.+.|.||+                                           +++++|+.++
T Consensus        79 --------~e~~~f~~h~~~~~~~D~~-------------------------------------------~vrkeI~~et  107 (657)
T KOG0446|consen   79 --------EEEASFLTHDKKKRFTDFE-------------------------------------------EVRKEIRSET  107 (657)
T ss_pred             --------ccchhccccccccccCCHH-------------------------------------------HHHHHHHhhH
Confidence                    2566666 65555555554                                           4555556667


Q ss_pred             HHhcCCCCCcCCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccch
Q psy5059         217 ERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSE  296 (1036)
Q Consensus       217 ~~~~g~~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~  296 (1036)
                      +++.|.++|+|+.+|.|+|++|++++||+|||||++++|+++||+|++.+|++|++.||++++||||+|.+||+|+++|+
T Consensus       108 ~~~~g~~kgiS~~pI~L~i~s~~v~~lTLvDlPG~tkvpv~dqp~di~~qI~~mi~~yi~~~~~iILav~~an~d~ats~  187 (657)
T KOG0446|consen  108 DRITGSNKGISPVPITLKIFSALVANLTLVDLPGLTKVPVADQPDDIEEEIKSMIEEYIEKPNRIILAVTPANSDIATSP  187 (657)
T ss_pred             HHhcCCCCCcCCCCceeeecCCCCchhhhcCCCCCcccccCCCCccHHHHHHHHHHHhccccchhhhhccchhhhhhcCH
Confidence            77777888999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             hhhhhhhcCCCCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhcc
Q psy5059         297 SLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETD  376 (1036)
Q Consensus       297 al~l~r~~Dp~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d  376 (1036)
                      |                                                                       +++|++||
T Consensus       188 a-----------------------------------------------------------------------lkiarevD  196 (657)
T KOG0446|consen  188 A-----------------------------------------------------------------------LVVAREVD  196 (657)
T ss_pred             H-----------------------------------------------------------------------HHHHHhhC
Confidence            5                                                                       45555555


Q ss_pred             ccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHH
Q psy5059         377 VDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLK  456 (1036)
Q Consensus       377 ~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~  456 (1036)
                      |.|.|||||+||||+||+||+++++|.|++||+++                                             
T Consensus       197 p~g~RTigvitK~DlmdkGt~~~~~L~g~~~~l~~---------------------------------------------  231 (657)
T KOG0446|consen  197 PGGSRTLEVITKFDFMDKGTNAVTRLVGRPITLKV---------------------------------------------  231 (657)
T ss_pred             CCccchhHHhhhHHhhhcCCcceeeecCCcccccc---------------------------------------------
Confidence            55666666888999999999988777777777664                                             


Q ss_pred             HhhhcCcCCCceeeeecccccccccchHHHHhcCcceeeeecEEEEEcCChhhhhhccCHHHHHHHHHHHhhcccccccc
Q psy5059         457 LAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLAS  536 (1036)
Q Consensus       457 la~~vd~~g~RtIgVlTK~Dlmd~gt~~~~il~g~~~~L~LG~~~V~NRs~~di~~~~s~~~al~~E~~fF~~~~~~l~~  536 (1036)
                                                               ||++|+||+|+|+..++++.+++.+|..||.        
T Consensus       232 -----------------------------------------g~v~vvnR~q~di~~~k~~~~al~~e~~~f~--------  262 (657)
T KOG0446|consen  232 -----------------------------------------GYVGVVNRSQSIIDFKKSILEALNDEVPSFE--------  262 (657)
T ss_pred             -----------------------------------------ceeeeeccchhhhhhhhhHHHHHHhhhhhhh--------
Confidence                                                     6777899999999999999999999988874        


Q ss_pred             ccChHHHHHHHHHHHHHHHHhhchhHHHHHHHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHHHHhhhhccccchhHHHh
Q psy5059         537 RNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKFIE  616 (1036)
Q Consensus       537 ~~G~~~L~~~L~~iL~~hIr~~LP~l~~~I~~~l~~~e~~L~~lG~~~~~~~~~L~~~~~~F~~~~~~~le~~~i~~~~e  616 (1036)
                                                                                                      
T Consensus       263 --------------------------------------------------------------------------------  262 (657)
T KOG0446|consen  263 --------------------------------------------------------------------------------  262 (657)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hccChhHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHhhhccCCCCccchhchhhhhhhhhhHHhhhhcchhhhhhhHH
Q psy5059         617 SKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYQRRTLSEKEKRDCD  696 (1036)
Q Consensus       617 ~~r~p~L~~rI~evv~~lL~~~~~~~~~~i~~li~~E~~yint~hpdf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  696 (1036)
                                                                                                      
T Consensus       263 --------------------------------------------------------------------------------  262 (657)
T KOG0446|consen  263 --------------------------------------------------------------------------------  262 (657)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHhhcccchHHhhhcCHHHHHhhhhhhccCCcchhhcc
Q psy5059         697 VIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDTKYPTLASRN  776 (1036)
Q Consensus       697 ~i~~~~~sYf~iv~k~~~d~vPk~i~~~lv~~~~~~l~~~l~~~l~~~~~~~~ll~E~~~ia~rR~~~~~~~y~~~~~r~  776 (1036)
                                                                                          +||.|++++++|
T Consensus       263 --------------------------------------------------------------------~~p~y~~~~~~~  274 (657)
T KOG0446|consen  263 --------------------------------------------------------------------SVPSYPILLTIS  274 (657)
T ss_pred             --------------------------------------------------------------------cccccccccccc
Confidence                                                                                356899999999


Q ss_pred             chHHHHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHhhcC--CCCcchHHHHHHHHHHHHHhhcccccccccccccc
Q psy5059         777 GTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYG--EDVSDKSQTLLQIITKFASAYCSTVEGTARNIETT  854 (1036)
Q Consensus       777 G~~~L~~~Ln~~L~~hi~~~LP~l~~~i~~~l~~~~~~l~~~~--d~~~~~~~~lL~~i~~F~~~f~~~I~G~~~~~~~~  854 (1036)
                      |+|||++.||++|.+||+++||+|+++|+.++.+++++|+.||  ++...+...++++++.|+.+|+..++|.++.+.+.
T Consensus       275 g~p~La~~L~~~l~~hi~~~lP~l~~~i~~~~~~~~~el~~~g~~~~~~~~~~~ll~~i~~~~~~~~~~v~g~~~~~~~~  354 (657)
T KOG0446|consen  275 GVPYLALLLPGYLQSHIRDQLPELKTKINKLLEKYQDELNRIGAVDVDLANSAALLAIIREDPRGLRTGVIGKLDLVPTK  354 (657)
T ss_pred             CcchHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHhcccCCccchhhHHHHHHHHHHHHHHHhhcccccccchh
Confidence            9999999999999999999999999999999999999999999  77778999999999999999999999998876699


Q ss_pred             ccccceeehhhhhhhhhhhccccCCCCCCCHHHHHHHHHhccCCCCCCCCChhHHHHHHHHHHHHhhccHHHHHHHHHHH
Q psy5059         855 ELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEE  934 (1036)
Q Consensus       855 el~GGAri~~iF~~~F~~~i~~~~p~~~l~~~dIr~aI~n~~G~~~~lfvp~~aFe~Lvk~qI~~l~~Psl~cvdlV~~E  934 (1036)
                      +++|||||+|+||++|+..+.+++|++++++.+|+++|.|++|++++||+|+.|||.+|++||+++++||++||++|++|
T Consensus       355 elsggari~~~F~~~f~~~i~~i~~~~~~~~~~i~~~i~~~~G~~~~lf~p~~afe~lvk~~i~~l~~p~l~~v~~v~~e  434 (657)
T KOG0446|consen  355 ALSGGARINYPFHGGFPGVIKKLPPDRKLLGQNIEKLVSEASGIRPSLFVPESSFESLVKGQIQSLRDPSLKCVEEVHRE  434 (657)
T ss_pred             cccchhhhhhhhhhccchhhhcCCcchhhhHHHHHHHHHhccCCCccccCChHHHHHHHHHHHHHHhhhHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhccC--C-CC-----------------------------------------C--------------------
Q psy5059         935 MQRIIQHCEKEG--N-IP-----------------------------------------A--------------------  950 (1036)
Q Consensus       935 L~~i~~~~~~~~--~-~p-----------------------------------------~--------------------  950 (1036)
                      |.+++++|....  . ||                                         .                    
T Consensus       435 l~~~~~~~~~~~~l~rfp~l~~~~~~~~~~~~~~~~~~t~~~v~~~i~~e~~yinT~h~df~~~~~~al~~~~~~~~~~~  514 (657)
T KOG0446|consen  435 LVRIVADSIRATELKRFPVLYSELVEIASSLIAEGLDETKKAVKNLIDLEQSYLNTDHPDFRSLTDSALSSVTSPSIAAM  514 (657)
T ss_pred             HHHHHHHHhhhHHHHHhHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHhcCcChhhhhhHHHHHHHhhccccccc
Confidence            999999999852  1 10                                         0                    


Q ss_pred             --------CC---------------C--------------CCCCCHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHH
Q psy5059         951 --------TT---------------S--------------SRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMH  993 (1036)
Q Consensus       951 --------~~---------------~--------------~~~~~~~e~~q~~~i~~lv~sYf~Iv~k~i~D~VPK~Im~  993 (1036)
                              .+               .              ...+++++..+++.|+.++.|||+||+++|+|.|||+|||
T Consensus       515 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~sY~~iv~~~i~d~vpk~i~~  594 (657)
T KOG0446|consen  515 KLISAQLLKEELGECNSALKAIKNAVGSIRLDPSDIVLSRALVLKKRECKETEEISSCPESYLNIVSDKLVDTVPKALNH  594 (657)
T ss_pred             ccccccccccccccccchhhhhcchhhhhhhcccchhhhhhhhcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                    00               0              0235888889999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhcC-ccchhHHhcCCHHHHHHhhhhc
Q psy5059         994 FLVNYVKDNLQSELVTHLYK-ADSASELLNESEWVAQRRKEST 1035 (1036)
Q Consensus       994 ~lVn~~~~~l~~~L~~~Ly~-~~~~~~Ll~E~~~i~~~R~~~~ 1035 (1036)
                      +|||.+++.|+++|+++||. .+.++.||+|+|.++++|++|+
T Consensus       595 ~lv~~~k~~l~~~l~~~L~~~~~~~~~ll~E~~~i~~~R~~~~  637 (657)
T KOG0446|consen  595 ELLNEFKDDLPNELDQRLYAGDEQLESLLKEDPRIKRRRELQQ  637 (657)
T ss_pred             HHHHHHHHHHHHHHHHHHHhchhHHHHHHccCHHHHHHHHHHH
Confidence            99999999999999999999 9999999999999999999985

>KOG0446|consensus Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PF01031 Dynamin_M: Dynamin central region; InterPro: IPR000375 Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0447|consensus Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PF01031 Dynamin_M: Dynamin central region; InterPro: IPR000375 Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>smart00302 GED Dynamin GTPase effector domain Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>smart00302 GED Dynamin GTPase effector domain Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PF02212 GED: Dynamin GTPase effector domain; InterPro: IPR003130 Dynamin GTPase effector domain found in proteins related to dynamin Back     alignment and domain information
>PF02212 GED: Dynamin GTPase effector domain; InterPro: IPR003130 Dynamin GTPase effector domain found in proteins related to dynamin Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0447|consensus Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>COG0699 Predicted GTPases (dynamin-related) [General function prediction only] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>KOG0448|consensus Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>KOG2203|consensus Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>COG0699 Predicted GTPases (dynamin-related) [General function prediction only] Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1036
1jwy_B315 Crystal Structure Of The Dynamin A Gtpase Domain Co 1e-56
1jwy_B315 Crystal Structure Of The Dynamin A Gtpase Domain Co 2e-48
1jwy_B315 Crystal Structure Of The Dynamin A Gtpase Domain Co 1e-10
3l43_A319 Crystal Structure Of The Dynamin 3 Gtpase Domain Bo 2e-44
3l43_A319 Crystal Structure Of The Dynamin 3 Gtpase Domain Bo 2e-34
3zvr_A772 Crystal Structure Of Dynamin Length = 772 4e-44
3zvr_A772 Crystal Structure Of Dynamin Length = 772 3e-38
3zvr_A 772 Crystal Structure Of Dynamin Length = 772 1e-28
3zvr_A772 Crystal Structure Of Dynamin Length = 772 6e-09
3snh_A743 Crystal Structure Of Nucleotide-Free Human Dynamin1 4e-44
3snh_A743 Crystal Structure Of Nucleotide-Free Human Dynamin1 6e-38
3snh_A 743 Crystal Structure Of Nucleotide-Free Human Dynamin1 1e-27
3snh_A743 Crystal Structure Of Nucleotide-Free Human Dynamin1 7e-09
3zyc_A353 Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gm 2e-43
3zyc_A353 Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gm 3e-34
3zyc_A353 Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gm 1e-04
2aka_B299 Structure Of The Nucleotide-Free Myosin Ii Motor Do 2e-43
2aka_B299 Structure Of The Nucleotide-Free Myosin Ii Motor Do 9e-34
2aka_B299 Structure Of The Nucleotide-Free Myosin Ii Motor Do 4e-04
2x2e_A353 Dynamin Gtpase Dimer, Long Axis Form Length = 353 4e-42
2x2e_A353 Dynamin Gtpase Dimer, Long Axis Form Length = 353 6e-33
2x2e_A353 Dynamin Gtpase Dimer, Long Axis Form Length = 353 7e-05
3t34_A360 Arabidopsis Thaliana Dynamin-Related Protein 1a (At 2e-33
3t34_A360 Arabidopsis Thaliana Dynamin-Related Protein 1a (At 1e-29
3szr_A608 Crystal Structure Of Modified Nucleotide-Free Human 5e-19
3szr_A608 Crystal Structure Of Modified Nucleotide-Free Human 2e-18
3szr_A608 Crystal Structure Of Modified Nucleotide-Free Human 4e-17
3zys_B662 Human Dynamin 1 Deltaprd Polymer Stabilized With Gm 6e-19
3zys_B662 Human Dynamin 1 Deltaprd Polymer Stabilized With Gm 3e-18
3zys_B662 Human Dynamin 1 Deltaprd Polymer Stabilized With Gm 5e-17
>pdb|1JWY|B Chain B, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 315 Back     alignment and structure 
Iteration: 1

 Score =  218 bits (556), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 152/258 (58%), Gaps = 57/258 (22%)
Query: 65  VINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQ 124
           VINKLQDVFNT+G+D + LPQIVVVG+QSSGKSSV+E++VG+ FLPRG GIVTRRPLILQ
Sbjct: 6   VINKLQDVFNTLGSDPLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRRPLILQ 65
Query: 125 LYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVXXXXXXXXXXXXXXXXXLAGKNKGIC 184
           L + P  D   +T                                               
Sbjct: 66  LTHLPIADDGSQTQE--------------------------------------------- 80
Query: 185 TMDLDAWGQFLHTKDKVXXXXXXXXXXXXXXXXXLAGKNKGICSEPIILKIYSTSVLNLT 244
                 WG+FLH  + +                 + GKNKGI ++PI LKIYS  V+NLT
Sbjct: 81  ------WGEFLHKPNDMFYDFSEIREEIIRDTDRMTGKNKGISAQPINLKIYSPHVVNLT 134
Query: 245 LVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKET 304
           LVDLPGITKVPVGDQP DIE QI+++V+ YI   N+II+AV  ANTD+A S++L+LAKE 
Sbjct: 135 LVDLPGITKVPVGDQPTDIEQQIRRMVMAYIKKQNAIIVAVTPANTDLANSDALQLAKEV 194
Query: 305 DVDGRRT------LDLLD 316
           D +G+RT      LDL+D
Sbjct: 195 DPEGKRTIGVITKLDLMD 212
>pdb|1JWY|B Chain B, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 315 Back     alignment and structure
>pdb|1JWY|B Chain B, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 315 Back     alignment and structure
>pdb|3L43|A Chain A, Crystal Structure Of The Dynamin 3 Gtpase Domain Bound With Gdp Length = 319 Back     alignment and structure
>pdb|3L43|A Chain A, Crystal Structure Of The Dynamin 3 Gtpase Domain Bound With Gdp Length = 319 Back     alignment and structure
>pdb|3ZVR|A Chain A, Crystal Structure Of Dynamin Length = 772 Back     alignment and structure
>pdb|3ZVR|A Chain A, Crystal Structure Of Dynamin Length = 772 Back     alignment and structure
>pdb|3ZVR|A Chain A, Crystal Structure Of Dynamin Length = 772 Back     alignment and structure
>pdb|3ZVR|A Chain A, Crystal Structure Of Dynamin Length = 772 Back     alignment and structure
>pdb|3SNH|A Chain A, Crystal Structure Of Nucleotide-Free Human Dynamin1 Length = 743 Back     alignment and structure
>pdb|3SNH|A Chain A, Crystal Structure Of Nucleotide-Free Human Dynamin1 Length = 743 Back     alignment and structure
>pdb|3SNH|A Chain A, Crystal Structure Of Nucleotide-Free Human Dynamin1 Length = 743 Back     alignment and structure
>pdb|3SNH|A Chain A, Crystal Structure Of Nucleotide-Free Human Dynamin1 Length = 743 Back     alignment and structure
>pdb|3ZYC|A Chain A, Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gmppcp Length = 353 Back     alignment and structure
>pdb|3ZYC|A Chain A, Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gmppcp Length = 353 Back     alignment and structure
>pdb|3ZYC|A Chain A, Dynamin 1 Gtpase Ged Fusion Dimer Complexed With Gmppcp Length = 353 Back     alignment and structure
>pdb|2AKA|B Chain B, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 299 Back     alignment and structure
>pdb|2AKA|B Chain B, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 299 Back     alignment and structure
>pdb|2AKA|B Chain B, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 299 Back     alignment and structure
>pdb|2X2E|A Chain A, Dynamin Gtpase Dimer, Long Axis Form Length = 353 Back     alignment and structure
>pdb|2X2E|A Chain A, Dynamin Gtpase Dimer, Long Axis Form Length = 353 Back     alignment and structure
>pdb|2X2E|A Chain A, Dynamin Gtpase Dimer, Long Axis Form Length = 353 Back     alignment and structure
>pdb|3T34|A Chain A, Arabidopsis Thaliana Dynamin-Related Protein 1a (Atdrp1a) In Prefission State Length = 360 Back     alignment and structure
>pdb|3T34|A Chain A, Arabidopsis Thaliana Dynamin-Related Protein 1a (Atdrp1a) In Prefission State Length = 360 Back     alignment and structure
>pdb|3SZR|A Chain A, Crystal Structure Of Modified Nucleotide-Free Human Mxa Length = 608 Back     alignment and structure
>pdb|3SZR|A Chain A, Crystal Structure Of Modified Nucleotide-Free Human Mxa Length = 608 Back     alignment and structure
>pdb|3SZR|A Chain A, Crystal Structure Of Modified Nucleotide-Free Human Mxa Length = 608 Back     alignment and structure
>pdb|3ZYS|B Chain B, Human Dynamin 1 Deltaprd Polymer Stabilized With Gmppcp Length = 662 Back     alignment and structure
>pdb|3ZYS|B Chain B, Human Dynamin 1 Deltaprd Polymer Stabilized With Gmppcp Length = 662 Back     alignment and structure
>pdb|3ZYS|B Chain B, Human Dynamin 1 Deltaprd Polymer Stabilized With Gmppcp Length = 662 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1036
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 2e-88
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 2e-61
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 3e-36
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 1e-13
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 3e-72
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 2e-62
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 3e-40
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 2e-15
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 1e-10
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 6e-71
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 5e-67
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 1e-40
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 3e-17
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 2e-16
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 6e-65
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 2e-57
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 1e-39
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 2e-13
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 5e-09
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 9e-64
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 5e-63
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 4e-39
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 2e-15
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 5e-13
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 8e-61
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 5e-59
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 1e-58
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 2e-34
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 1e-13
3ljb_A271 Interferon-induced GTP-binding protein MX1; four-h 2e-34
3ljb_A271 Interferon-induced GTP-binding protein MX1; four-h 2e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Length = 772 Back     alignment and structure
 Score =  299 bits (767), Expect = 2e-88
 Identities = 146/636 (22%), Positives = 251/636 (39%), Gaps = 60/636 (9%)

Query: 409  VKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRT 468
             K+ V  +   IE QI+ +++ +++  N +ILAV  AN+D+A S++LK+AKE D  G+RT
Sbjct: 161  TKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRT 220

Query: 469  LAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFL- 527
            + V+TK+DLMD GTDA D+L  +++P++ G IGVVNRSQ+DI   K I  A+  E  F  
Sbjct: 221  IGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFL 280

Query: 528  -QRKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSD 586
                Y  LA R GT YL K LN+ L +HIRD LP L+ ++   +   +  ++ Y     D
Sbjct: 281  SHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPD 340

Query: 587  ----KSQTLLQIITKFASAYCSTVEENGIFKFIESKKNPALHERIVEVVTQLLRRRL--- 639
                K++ LLQ++ +FA  +   +E  G    I++ +      RI  +  +     L   
Sbjct: 341  DPARKTKALLQMVQQFAVDFEKRIE--GSGDQIDTYELS-GGARINRIFHERFPFELVKM 397

Query: 640  -PATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYQRRTLSEKEKRDCDVI 698
                  +   +        + +   F  D A   + +K      Q + L E   +  D  
Sbjct: 398  EFDEKELRREISYAIKNIHDIRTGLFTPDLAFE-ATVKK-----QVQKLKEPSIKCVD-- 449

Query: 699  ERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVA 758
                     ++   +  T+ K        Y    L+ E+          +  + E E   
Sbjct: 450  ---------MVVSELTSTIRKCSEKL-QQY--PRLREEME------RIVTTHIREREGRT 491

Query: 759  QRRKEASDTKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSY 818
            +                         L  + + ++     D     N      Q      
Sbjct: 492  KE--------------------QVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKT 531

Query: 819  GEDVSDKSQTLLQIITKFASAYCSTVEGTARNIETTELCGGARICYIFHEIFGKVLDGIN 878
              +  +        +T                + T E     +      + +   +D + 
Sbjct: 532  SGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLK 591

Query: 879  PLDGLTKMDILTAIRNATGPRPALFVPEVS-FELLVKRQIRRLEEPSQRCVELVHEEMQR 937
              D          I             +    EL  + Q       +      V+ E   
Sbjct: 592  LRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVG 651

Query: 938  IIQHCEKEGNIPATTSSRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVN 997
              +   +     + +   ++  + +R  + I  L+ SY  I+ K+++D +PK IMH ++N
Sbjct: 652  DKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMIN 711

Query: 998  YVKDNLQSELVTHLYKADSASELLNESEWVAQRRKE 1033
              K+ + SEL+ +LY     + L+ ES   AQRR E
Sbjct: 712  NTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDE 747
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Length = 772 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Length = 772 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Length = 772 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Length = 315 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Length = 315 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Length = 315 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Length = 315 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Length = 315 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Length = 360 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Length = 360 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Length = 360 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Length = 360 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Length = 360 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Length = 299 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Length = 299 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Length = 299 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Length = 299 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Length = 299 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Length = 353 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Length = 353 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Length = 353 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Length = 353 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Length = 353 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Length = 608 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Length = 608 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Length = 608 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Length = 608 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Length = 608 Back     alignment and structure
>3ljb_A Interferon-induced GTP-binding protein MX1; four-helix-bundle, antiviral protein; 2.40A {Homo sapiens} Length = 271 Back     alignment and structure
>3ljb_A Interferon-induced GTP-binding protein MX1; four-helix-bundle, antiviral protein; 2.40A {Homo sapiens} Length = 271 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1036
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 100.0
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 100.0
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 100.0
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 100.0
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 100.0
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 100.0
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 100.0
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 100.0
3ljb_A271 Interferon-induced GTP-binding protein MX1; four-h 99.95
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.84
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.83
3ljb_A271 Interferon-induced GTP-binding protein MX1; four-h 99.8
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.79
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.78
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.73
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.52
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.49
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.18
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.14
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.06
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.06
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.06
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.98
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.95
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.92
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.89
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.89
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.87
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.83
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.79
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.77
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.75
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.75
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.74
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.73
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.73
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.72
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.72
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.71
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.71
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.7
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.7
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.69
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.69
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.68
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.67
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 98.67
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.67
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.66
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.66
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.66
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.65
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 98.65
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.65
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.65
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.65
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.64
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.64
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.63
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.63
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.63
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.63
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.63
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.62
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.62
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.62
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.62
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.62
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.62
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.62
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.62
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.61
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.61
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.61
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.61
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.6
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.59
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.59
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.59
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.58
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.58
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.57
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.57
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.57
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.56
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.56
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.56
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.56
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.56
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 98.56
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.56
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.55
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.55
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.55
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.55
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.55
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.55
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.54
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.53
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.52
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.52
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.52
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.52
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.52
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.52
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 98.51
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.51
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.51
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.5
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.5
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.49
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.49
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.49
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.49
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.48
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.48
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.48
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.47
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.47
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.46
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.46
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.45
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.45
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.44
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.43
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 98.41
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.41
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 98.39
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.39
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.38
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.38
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.38
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.37
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.36
2ged_A193 SR-beta, signal recognition particle receptor beta 98.36
1wb1_A482 Translation elongation factor SELB; selenocysteine 98.36
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.35
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.35
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.34
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.34
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.34
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.33
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.31
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 98.31
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.31
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 98.31
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.3
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.3
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 98.29
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.28
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.28
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 98.27
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.27
3izy_P537 Translation initiation factor IF-2, mitochondrial; 98.26
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.26
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.24
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.21
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.21
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 98.19
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.49
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.17
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.17
1f60_A458 Elongation factor EEF1A; protein-protein complex, 98.17
2elf_A370 Protein translation elongation factor 1A; tRNA, py 98.16
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.14
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.14
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 98.11
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.1
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.1
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.08
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.07
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.07
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.06
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.05
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 98.05
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.04
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 98.03
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 98.03
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.02
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 98.02
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.0
2xex_A693 Elongation factor G; GTPase, translation, biosynth 98.0
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 97.96
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 97.95
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 97.94
3avx_A1289 Elongation factor TS, elongation factor TU, linke 97.91
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 97.91
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.88
1wxq_A397 GTP-binding protein; structural genomics, riken st 97.83
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.76
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.76
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 97.7
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 97.68
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.65
2dy1_A665 Elongation factor G; translocation, GTP complex, s 97.64
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.63
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 97.51
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.51
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 97.48
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 97.45
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.44
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.38
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 97.34
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 97.32
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.3
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 97.13
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 97.07
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.07
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 96.99
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 96.97
3vqt_A548 RF-3, peptide chain release factor 3; translation, 96.95
2hf9_A226 Probable hydrogenase nickel incorporation protein 96.92
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.87
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 96.87
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 96.87
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 96.86
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.85
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.74
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 96.73
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 96.71
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 96.7
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.65
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 96.56
1jal_A363 YCHF protein; nucleotide-binding fold, structural 96.53
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 96.53
3iby_A256 Ferrous iron transport protein B; G protein, G dom 96.43
3cnl_A262 YLQF, putative uncharacterized protein; circular p 96.37
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.34
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 96.22
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 96.17
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 96.17
3lxw_A247 GTPase IMAP family member 1; immunity, structural 96.08
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.07
2wji_A165 Ferrous iron transport protein B homolog; membrane 95.99
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.96
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 95.95
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 95.93
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 95.89
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 95.87
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.85
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 95.83
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 95.8
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 95.8
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.78
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 95.76
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 95.75
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 95.75
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 95.73
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 95.72
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 95.71
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.71
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 95.68
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 95.64
2ged_A193 SR-beta, signal recognition particle receptor beta 95.61
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 95.59
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 95.59
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.59
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.58
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 95.56
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 95.56
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 95.54
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.54
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.52
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.52
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 95.51
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.5
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.49
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 95.48
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 95.48
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 95.43
1jal_A363 YCHF protein; nucleotide-binding fold, structural 95.41
1wxq_A397 GTP-binding protein; structural genomics, riken st 95.4
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 95.4
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 95.4
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 95.38
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.38
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 95.37
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 95.34
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 95.33
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.32
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.31
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.27
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.26
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 95.26
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.26
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.24
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.23
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 95.21
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 95.19
2www_A349 Methylmalonic aciduria type A protein, mitochondri 95.17
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 95.17
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 95.16
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 95.16
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 95.14
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.1
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 95.07
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 95.07
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 95.07
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.06
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 95.05
1nrj_B218 SR-beta, signal recognition particle receptor beta 95.05
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 95.03
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 95.03
2fh5_B214 SR-beta, signal recognition particle receptor beta 95.02
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 94.99
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 94.97
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 94.97
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 94.95
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 94.92
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 94.92
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 94.9
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 94.87
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 94.87
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 94.86
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 94.85
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 94.85
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 94.82
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 94.82
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 94.8
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 94.77
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 94.76
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 94.76
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 94.73
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 94.72
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 94.72
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 94.68
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 94.65
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 94.64
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.63
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.61
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 94.6
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 94.59
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 94.59
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 94.59
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 94.56
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 94.53
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 94.5
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 94.5
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 94.47
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 94.43
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 94.42
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 94.41
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 94.35
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 94.33
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 94.33
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 94.25
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 94.25
3cnl_A262 YLQF, putative uncharacterized protein; circular p 94.24
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 94.17
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 94.16
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 94.11
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.11
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 94.03
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 94.02
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 94.01
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 93.87
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 93.78
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 93.76
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.75
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 93.74
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 93.6
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.6
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 93.55
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 93.42
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 93.42
3llu_A196 RAS-related GTP-binding protein C; structural geno 93.41
3t1o_A198 Gliding protein MGLA; G domain containing protein, 93.38
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 93.35
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 93.34
2hf9_A226 Probable hydrogenase nickel incorporation protein 93.31
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 93.25
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 93.2
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 93.15
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 93.02
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 92.91
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 92.87
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 92.86
1vma_A306 Cell division protein FTSY; TM0570, structural gen 92.82
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 92.81
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 91.88
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 92.63
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 92.48
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 92.48
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 92.45
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 92.38
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 92.17
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 92.07
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 91.95
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 91.93
3o47_A329 ADP-ribosylation factor GTPase-activating protein 91.77
2xxa_A433 Signal recognition particle protein; protein trans 91.65
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 91.63
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 91.58
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 91.56
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 91.5
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 91.36
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 91.31
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 91.28
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 91.25
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 91.12
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 91.1
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 91.06
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 91.02
1wb1_A482 Translation elongation factor SELB; selenocysteine 90.97
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 90.88
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 90.81
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 90.71
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 90.69
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 90.53
3izy_P537 Translation initiation factor IF-2, mitochondrial; 90.48
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 90.3
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 90.11
2og2_A359 Putative signal recognition particle receptor; nuc 90.03
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 89.96
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 89.92
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.83
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 89.77
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 89.71
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 89.69
4a74_A231 DNA repair and recombination protein RADA; hydrola 89.67
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 89.65
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 89.52
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 89.4
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 89.37
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 89.36
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 89.35
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 89.16
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 89.12
1sgw_A214 Putative ABC transporter; structural genomics, P p 89.07
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 88.97
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 88.94
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 88.9
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 88.83
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.81
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 88.8
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 88.79
1xjc_A169 MOBB protein homolog; structural genomics, midwest 88.76
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 88.63
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 88.6
1ji0_A240 ABC transporter; ATP binding protein, structural g 88.52
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 88.48
1g6h_A257 High-affinity branched-chain amino acid transport 88.46
1b0u_A262 Histidine permease; ABC transporter, transport pro 88.45
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 88.42
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 88.42
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 88.4
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 88.29
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 88.24
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 88.22
2ghi_A260 Transport protein; multidrug resistance protein, M 88.08
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 88.08
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 88.08
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 88.07
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 88.07
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 88.05
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 88.03
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 88.02
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 87.99
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 87.99
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 87.88
2eyu_A261 Twitching motility protein PILT; pilus retraction 87.84
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 87.75
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 87.72
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 87.7
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 87.57
2oap_1511 GSPE-2, type II secretion system protein; hexameri 87.57
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 87.36
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 87.29
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 87.16
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 86.91
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 86.88
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 86.81
3kta_A182 Chromosome segregation protein SMC; structural mai 86.77
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 86.54
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 86.35
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 86.3
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 86.23
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 86.14
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 86.11
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 86.02
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 85.93
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 85.88
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 85.84
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 85.69
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 85.69
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 85.65
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 85.41
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 85.4
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 85.33
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 85.31
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 85.15
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 85.08
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 85.05
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 84.8
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 84.79
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 84.71
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 84.65
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 84.63
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 84.53
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 84.5
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
Probab=100.00  E-value=1.1e-91  Score=857.06  Aligned_cols=528  Identities=45%  Similarity=0.743  Sum_probs=443.5

Q ss_pred             hhhhhhhHHHHHHHHHhhhhcCC-CCCCCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchh
Q psy5059          56 DREKRTAAAVINKLQDVFNTVGT-DAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDRE  134 (1036)
Q Consensus        56 ~~~~~~~~~l~~kL~~~~~~~g~-~~i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~  134 (1036)
                      ...++.+++++|+|+|.+.++|. ..+++|+|+|+|+||+|||||||+|+|.+|||||.|+|||||+++++.+.+.    
T Consensus        23 ~~~~~~li~~inkl~d~l~~lg~~~~i~lp~I~vvG~~saGKSSllnaL~g~~~LP~g~g~~Tr~Pl~l~l~~~~~----   98 (772)
T 3zvr_A           23 NRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTT----   98 (772)
T ss_dssp             --CGGGHHHHHHHHHHHHHTTTCCGGGCCSEEEEEECTTTCHHHHHHHHHSSCCSCCSSSCSCSSCEEEEEEECSS----
T ss_pred             cccHHHHHHHHHHHHHHHHhcCccccCCCCEEEEECCCCCcHHHHHHHHhCCCccCcCCccccccceEEEeecCCc----
Confidence            34578999999999999999996 6799999999999999999999999999999999999999999999998542    


Q ss_pred             hhhhccCCCCccccccccccccccccchhhhhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHH
Q psy5059         135 KRTAAAGTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIED  214 (1036)
Q Consensus       135 ~~~~~~~~~~~~~w~~~~~~~~~~~~df~~~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~  214 (1036)
                                  +|++|+|.++                                           ..+.++++++.+|+.
T Consensus        99 ------------~~~~~l~~~~-------------------------------------------~~~~~~~~v~~~I~~  123 (772)
T 3zvr_A           99 ------------EYAEFLHCKG-------------------------------------------KKFTDFEEVRLEIEA  123 (772)
T ss_dssp             ------------CEEECSTTTT-------------------------------------------CCBCCHHHHHHHHHH
T ss_pred             ------------chhheeccCC-------------------------------------------cccCCHHHHHHHHHH
Confidence                        4666655444                                           344556666777777


Q ss_pred             HHHHhcCCCCCcCCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEecccccccc
Q psy5059         215 ETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMAT  294 (1036)
Q Consensus       215 ~~~~~~g~~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~  294 (1036)
                      .+..+.|.+++||.++|.++|++|++++++||||||+.+.+.++||.++...+++++.+|+.++.++||+|++|+.++.+
T Consensus       124 ~~~~~~g~~~~is~~~i~l~I~~P~~~qL~LVDTPGi~~~~~~~qp~di~~~i~~lv~~yi~~~aDlIL~VVDAs~~~~~  203 (772)
T 3zvr_A          124 ETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLAN  203 (772)
T ss_dssp             HHHHHHCSTTCCCSCCEEEEEEETTCCSEEEEECCCCCCCCSSCCCCHHHHHHHHHHHHHHTSTTEEEEEEEETTSCSSS
T ss_pred             HHhhhcCCCCcccccceEEEEecCCCCceEEEECCCcccCCCCCCcHHHHHHHHHHHHHHHhcCCcEEEEEEcCCCCcch
Confidence            77788888999999999999999999999999999999999999999988889999999998888888888888877766


Q ss_pred             chhhhhhhhcCCCCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhh
Q psy5059         295 SESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKE  374 (1036)
Q Consensus       295 s~al~l~r~~Dp~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~  374 (1036)
                      ++                                                                       .+.++++
T Consensus       204 ~d-----------------------------------------------------------------------~l~ll~~  212 (772)
T 3zvr_A          204 SD-----------------------------------------------------------------------ALKIAKE  212 (772)
T ss_dssp             CH-----------------------------------------------------------------------HHHHHHH
T ss_pred             hH-----------------------------------------------------------------------HHHHHHH
Confidence            55                                                                       3468888


Q ss_pred             ccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHH
Q psy5059         375 TDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSES  454 (1036)
Q Consensus       375 ~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qei  454 (1036)
                      +++.|.++|+|+||||++++++...+                                                      
T Consensus       213 L~~~g~pvIlVlNKiDlv~~~~~~~~------------------------------------------------------  238 (772)
T 3zvr_A          213 VDPQGQRTIGVITKLDLMDEGTDARD------------------------------------------------------  238 (772)
T ss_dssp             HCTTCSSEEEEEECTTSSCTTCCSHH------------------------------------------------------
T ss_pred             HHhcCCCEEEEEeCcccCCcchhhHH------------------------------------------------------
Confidence            88899999999999999987655432                                                      


Q ss_pred             HHHhhhcCcCCCceeeeecccccccccchHHHHhcCcceeeeecEEEEEcCChhhhhhccCHHHHHHHHHHHhhcccccc
Q psy5059         455 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTL  534 (1036)
Q Consensus       455 l~la~~vd~~g~RtIgVlTK~Dlmd~gt~~~~il~g~~~~L~LG~~~V~NRs~~di~~~~s~~~al~~E~~fF~~~~~~l  534 (1036)
                                                      ++.++..++++||+.|++.|+.+...-..+.+++..|..||.      
T Consensus       239 --------------------------------il~~~~~~l~lg~~~VV~iSA~~G~GvdeL~eaI~~e~~ffp------  280 (772)
T 3zvr_A          239 --------------------------------VLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFL------  280 (772)
T ss_dssp             --------------------------------HHTTCSSCCSSCEEECCCCCCEESSSSEEHHHHHHHHHHHHH------
T ss_pred             --------------------------------HHHHHhhhhhccCCceEEecccccccchhHHHHHHHHHHhcc------
Confidence                                            223344455567888888887765554456666666666652      


Q ss_pred             ccccChHHHHHHHHHHHHHHHHhhchhHHHHHHHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHHHHhhhhccccchhHH
Q psy5059         535 ASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKF  614 (1036)
Q Consensus       535 ~~~~G~~~L~~~L~~iL~~hIr~~LP~l~~~I~~~l~~~e~~L~~lG~~~~~~~~~L~~~~~~F~~~~~~~le~~~i~~~  614 (1036)
                                                                                                      
T Consensus       281 --------------------------------------------------------------------------------  280 (772)
T 3zvr_A          281 --------------------------------------------------------------------------------  280 (772)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HhhccChhHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHhhhccCCCCccchhchhhhhhhhhhHHhhhhcchhhhhhh
Q psy5059         615 IESKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYQRRTLSEKEKRD  694 (1036)
Q Consensus       615 ~e~~r~p~L~~rI~evv~~lL~~~~~~~~~~i~~li~~E~~yint~hpdf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  694 (1036)
                                                                                                      
T Consensus       281 --------------------------------------------------------------------------------  280 (772)
T 3zvr_A          281 --------------------------------------------------------------------------------  280 (772)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHhhcccchHHhhhcCHHHHHhhhhhhccCCcchhh
Q psy5059         695 CDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDTKYPTLAS  774 (1036)
Q Consensus       695 ~~~i~~~~~sYf~iv~k~~~d~vPk~i~~~lv~~~~~~l~~~l~~~l~~~~~~~~ll~E~~~ia~rR~~~~~~~y~~~~~  774 (1036)
                                                                                            .+|.|..+.+
T Consensus       281 ----------------------------------------------------------------------e~P~yd~ltD  290 (772)
T 3zvr_A          281 ----------------------------------------------------------------------SHPSYRHLAD  290 (772)
T ss_dssp             ----------------------------------------------------------------------HCTTTGGGGG
T ss_pred             ----------------------------------------------------------------------CCcchhhhhh
Confidence                                                                                  2456778889


Q ss_pred             ccchHHHHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHhhcC----CCCcchHHHHHHHHHHHHHhhcccccccccc
Q psy5059         775 RNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYG----EDVSDKSQTLLQIITKFASAYCSTVEGTARN  850 (1036)
Q Consensus       775 r~G~~~L~~~Ln~~L~~hi~~~LP~l~~~i~~~l~~~~~~l~~~~----d~~~~~~~~lL~~i~~F~~~f~~~I~G~~~~  850 (1036)
                      |+|+..|.+.|+++|.+||++.||.|+++|+.++++++.+++.||    +++.+++.+|++++++|++.|+++|+|++.+
T Consensus       291 r~g~~~LaEiLrEkL~~hi~~ELP~l~~~I~~~l~s~~vele~~~~~~~~~~~~~~~~ll~~~~~f~~~~~~~i~G~~~~  370 (772)
T 3zvr_A          291 RMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQ  370 (772)
T ss_dssp             GCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCSSSCSHHHHHHHHHHHHHHHHHHHTC----
T ss_pred             cccHHHHHHHHHHHHHHHHHhhCccHHHHHHHHHHHHHHHHHHhCCCCCCChHHHHHHHHHHHHHHHHHHHHHhCCCCCC
Confidence            999999999999999999999999999999999999999999985    5567789999999999999999999999999


Q ss_pred             ccccccccceeehhhhhhhhhhhccccCCCCCCCHHHHHHHHHhccCCCCCCCCChhHHHHHHHHHHHHhhccHHHHHHH
Q psy5059         851 IETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVEL  930 (1036)
Q Consensus       851 ~~~~el~GGAri~~iF~~~F~~~i~~~~p~~~l~~~dIr~aI~n~~G~~~~lfvp~~aFe~Lvk~qI~~l~~Psl~cvdl  930 (1036)
                      +++++|+|||||+||||+.|++.+.+++|+++++++|||++|+|++|+++++|+|+.|||.|||+||++|++||++|||+
T Consensus       371 ~~~~el~ggari~~if~~~f~~~~~~~~~~~~~~~~~I~~~i~n~~G~~~~lf~p~~~fe~LVk~QI~rl~ePsl~CVdl  450 (772)
T 3zvr_A          371 IDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHDIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDM  450 (772)
T ss_dssp             -----CCHHHHHHHHHHTHHHHHHHTTSCCHHHHHHHHHHHHHHCC------CHHHHHHHHHHHHHHHTTHHHHHHHHHH
T ss_pred             cCcccCCCCeeeehhHHHHhHHHHhcCCCchhhhHHHHHHHHHhCCCCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhccCC-------------------------------------C-----C-------------------
Q psy5059         931 VHEEMQRIIQHCEKEGN-------------------------------------I-----P-------------------  949 (1036)
Q Consensus       931 V~~EL~~i~~~~~~~~~-------------------------------------~-----p-------------------  949 (1036)
                      |++||.+++++|..+..                                     |     |                   
T Consensus       451 V~~eL~~iv~~~~~~l~RfP~Lr~ei~~iv~~~Lre~~~~t~~~V~~LId~E~ayintnHpdf~~~~~~~~~~~~~~~~~  530 (772)
T 3zvr_A          451 VVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKK  530 (772)
T ss_dssp             HHHHHHHHHHHHGGGGTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCTTCTTCCCC--------------
T ss_pred             HHHHHHHHHHHHHHHhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCChhhhchHHHHHHHHHHhhcc
Confidence            99999999999976532                                     0     0                   


Q ss_pred             ----C---------------------------------------------------------------------------
Q psy5059         950 ----A---------------------------------------------------------------------------  950 (1036)
Q Consensus       950 ----~---------------------------------------------------------------------------  950 (1036)
                          +                                                                           
T Consensus       531 ~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  610 (772)
T 3zvr_A          531 TSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFN  610 (772)
T ss_dssp             -------CCEEEEEEEEESSSCCC---CCEEEEEEESSEEEEESSTTCCCEEEEEECTTEEEEEC-------CEEEEEEE
T ss_pred             cccCCccccceeeeeeeecccccccCCCccceeeccccccccccchhhhcccccccccccccchhhhccccccccccccC
Confidence                0                                                                           


Q ss_pred             -----------------------------------CC---C----------------CCCCCHHHHHHHHHHHHHHHHHH
Q psy5059         951 -----------------------------------TT---S----------------SRTLSEKEKRDCDVIERLIKSYF  976 (1036)
Q Consensus       951 -----------------------------------~~---~----------------~~~~~~~e~~q~~~i~~lv~sYf  976 (1036)
                                                         .|   .                ..+++||+++|+++|++||+|||
T Consensus       611 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~q~e~~~~l~~sy~  690 (772)
T 3zvr_A          611 TEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYM  690 (772)
T ss_dssp             TTSSCSBTTBSEEEEEESSHHHHHHHHHHHHHTTCCBC------------------------CHHHHHHHHHHHHHHHHH
T ss_pred             CccccccchhhhhhhhccccccchhhHHhhhhcccCCccccccccccccCCccccccccCCCHHHHHHHHHHHHHHHHHH
Confidence                                               00   0                00268999999999999999999


Q ss_pred             HHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHhcCccchhHHhcCCHHHHHHhhhhc
Q psy5059         977 YIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEST 1035 (1036)
Q Consensus       977 ~Iv~k~i~D~VPK~Im~~lVn~~~~~l~~~L~~~Ly~~~~~~~Ll~E~~~i~~~R~~~~ 1035 (1036)
                      +||+|+++|+|||+|||||||++|++|++||+++||+++++++||+|||++++||++|.
T Consensus       691 ~iv~k~~~d~~pk~im~~~vn~~k~~~~~el~~~ly~~~~~~~lm~Es~~~~~~r~~~~  749 (772)
T 3zvr_A          691 AIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEML  749 (772)
T ss_dssp             HHHHHHHHHHHHHHHHHHTHHHHHHHHHHTHHHHHHHTCCTTTTTCCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCHHHHHhcCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999985
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3ljb_A Interferon-induced GTP-binding protein MX1; four-helix-bundle, antiviral protein; 2.40A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ljb_A Interferon-induced GTP-binding protein MX1; four-helix-bundle, antiviral protein; 2.40A {Homo sapiens} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1036
d1jwyb_306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 3e-53
d1jwyb_306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 4e-39
d1jwyb_306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 3e-21
d1jwyb_306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 1e-17
d1jwyb_306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 8e-08
d2akab1299 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus n 4e-42
d2akab1299 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus n 1e-34
d2akab1299 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus n 4e-18
d2akab1299 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus n 3e-14
d2akab1299 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus n 8e-07
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 0.001
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Dictyostelium discoideum [TaxId: 44689]

 Score =  186 bits (473), Expect = 3e-53
 Identities = 137/310 (44%), Positives = 182/310 (58%), Gaps = 61/310 (19%)

Query: 65  VINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQ 124
           VINKLQDVFNT+G+D + LPQIVVVG+QSSGKSSV+E++VG+ FLPRG GIVTRRPLILQ
Sbjct: 6   VINKLQDVFNTLGSDPLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRRPLILQ 65

Query: 125 LYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGIC 184
           L + P  D   +T                                               
Sbjct: 66  LTHLPIADDGSQTQ---------------------------------------------- 79

Query: 185 TMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLT 244
                 WG+FLH  + +F DF +IR EI  +T+R+ GKNKGI ++PI LKIYS  V+NLT
Sbjct: 80  -----EWGEFLHKPNDMFYDFSEIREEIIRDTDRMTGKNKGISAQPINLKIYSPHVVNLT 134

Query: 245 LVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKET 304
           LVDLPGITKVPVGDQP DIE QI+++V+ YI   N+II+AV  ANTD+A S++L+LAKE 
Sbjct: 135 LVDLPGITKVPVGDQPTDIEQQIRRMVMAYIKKQNAIIVAVTPANTDLANSDALQLAKEV 194

Query: 305 DVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMA 364
           D +G+RT+ +       ITK+   D  D     ++ L    I      I  +  +  D+ 
Sbjct: 195 DPEGKRTIGV-------ITKL---DLMDKGTDAMEVLTGRVIPLTLGFIGVINRSQEDII 244

Query: 365 TSESLKLAKE 374
             +S++ + +
Sbjct: 245 AKKSIRESLK 254
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1036
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 100.0
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 100.0
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 99.69
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 99.63
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.17
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.15
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.15
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.13
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.03
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.0
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.0
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 98.95
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.93
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 98.87
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.75
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.72
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.66
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 98.66
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.66
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.63
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.62
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.58
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.55
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.53
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.52
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 98.51
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 98.5
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.48
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.48
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.47
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.41
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.38
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.37
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.32
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.29
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.27
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.26
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.26
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.25
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.24
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.18
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.18
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.17
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.17
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.17
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.15
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.15
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.14
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.14
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.13
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.07
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.06
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.04
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.03
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.02
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.01
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.01
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.98
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 97.97
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.92
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.83
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 97.79
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.78
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.74
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.72
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.66
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.55
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 97.53
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 97.45
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.43
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 97.42
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 97.38
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 97.34
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 97.23
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.17
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 97.16
d1nrjb_209 Signal recognition particle receptor beta-subunit 97.15
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.1
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.06
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 97.03
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.01
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 96.85
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.81
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.66
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.64
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.62
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.62
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.61
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.58
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.57
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.5
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 96.48
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 96.47
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.47
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 96.37
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 96.36
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.33
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 96.33
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.3
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.25
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.05
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.02
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.95
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.92
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.89
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 95.87
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 95.82
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 95.78
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 95.75
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 95.74
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.71
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.69
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.67
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 95.62
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.58
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.55
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 95.55
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.54
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 95.49
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 95.47
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 95.46
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 95.44
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.39
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.37
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.37
d1okkd2207 GTPase domain of the signal recognition particle r 95.36
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.36
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.33
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 95.32
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.3
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.29
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.28
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.19
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 95.18
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.14
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.08
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.06
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 95.06
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.05
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.04
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 95.02
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 94.9
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 94.87
d1vmaa2213 GTPase domain of the signal recognition particle r 94.82
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 94.77
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 94.76
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 94.72
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 94.66
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 94.66
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.66
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 94.64
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 94.58
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.55
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.53
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 94.39
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.24
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.23
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 93.98
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 93.9
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.84
d2qy9a2211 GTPase domain of the signal recognition particle r 93.6
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 93.43
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 93.39
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.84
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.81
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 92.57
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.31
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 92.21
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.03
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 92.03
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 91.96
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.62
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.45
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 91.37
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.32
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.8
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 90.74
d1ls1a2207 GTPase domain of the signal sequence recognition p 90.67
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 90.4
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 90.29
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.26
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 90.22
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 90.2
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 90.18
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.1
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 90.08
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 89.9
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 89.79
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 89.16
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 88.92
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 88.91
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 88.84
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 88.74
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 88.73
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 88.57
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 88.46
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 88.32
d2hyda1255 Putative multidrug export ATP-binding/permease pro 88.09
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 88.07
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.65
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 87.54
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 87.29
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 87.23
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 87.23
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 86.94
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 86.93
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.56
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 86.55
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 86.48
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 86.27
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 86.25
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 86.22
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 86.15
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 86.11
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 86.11
d2awna2232 Maltose transport protein MalK, N-terminal domain 86.05
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 85.87
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 85.73
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 85.65
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 85.48
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 85.29
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 85.23
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 85.2
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 84.97
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 84.86
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 84.84
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 84.81
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 84.75
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 84.68
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 84.48
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.28
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 84.28
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 84.27
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.18
d1g2912240 Maltose transport protein MalK, N-terminal domain 84.1
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 83.91
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 83.78
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 83.74
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.61
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 83.3
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 83.19
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 82.61
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 82.58
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 82.57
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 82.56
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 82.33
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 82.27
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 81.97
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 81.73
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 81.69
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 81.34
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 81.26
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 81.24
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 81.14
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 81.05
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 80.86
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 80.11
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Dictyostelium discoideum [TaxId: 44689]

Probab=100.00  E-value=2.9e-43  Score=389.86  Aligned_cols=302  Identities=61%  Similarity=1.002  Sum_probs=231.0

Q ss_pred             hhHHHHHHHHHhhhhcCCCCCCCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhcc
Q psy5059          61 TAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAA  140 (1036)
Q Consensus        61 ~~~~l~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~  140 (1036)
                      .+++++|+|++++..+|.+.+++|+|||||+||||||||||||+|.+|+|+|.|.|||||+++++.+.+.....      
T Consensus         2 ~l~~~~n~l~d~~~~~~~~~~~lP~ivVvG~~ssGKSSliNaLlG~~~lP~~~~~~T~~~~~i~~~~~~~~~~~------   75 (306)
T d1jwyb_           2 QLIPVINKLQDVFNTLGSDPLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRRPLILQLTHLPIADDG------   75 (306)
T ss_dssp             CHHHHHHHHHHHTTTSSSCTTCCCEEEEEECSSSSHHHHHHHHHTSCCCCC--------CEEEEEEECCCCTTS------
T ss_pred             chHHHHHHHHHHHHHhCcCCCCCCeEEEEeCCCCCHHHHHHHHhCCCCCCCCCCccccCCEEEEEecCCcccCc------
Confidence            58899999999999999889999999999999999999999999999999999999999999999876542110      


Q ss_pred             CCCCccccccccccccccccchhhhhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHHHHhc
Q psy5059         141 GTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLA  220 (1036)
Q Consensus       141 ~~~~~~~w~~~~~~~~~~~~df~~~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~~~~~  220 (1036)
                        .....|++                                           +.+.+...+.++.++..+|........
T Consensus        76 --~~~~~~~~-------------------------------------------~~~~~~~~~~~~~~~~~~i~~~~~~~~  110 (306)
T d1jwyb_          76 --SQTQEWGE-------------------------------------------FLHKPNDMFYDFSEIREEIIRDTDRMT  110 (306)
T ss_dssp             --CCCCCEEE-------------------------------------------ESSSTTCCBCCTHHHHHHHHHHCC---
T ss_pred             --cchhhhhH-------------------------------------------HhhcCCceecCHHHHHHHHHHHHHHhc
Confidence              01112333                                           333444455566667777766666666


Q ss_pred             CCCCCcCCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhh
Q psy5059         221 GKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKL  300 (1036)
Q Consensus       221 g~~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l  300 (1036)
                      +.+.+++.+++.+++.+|..++++||||||+...+..++.......+.+++..||.+++++||+|.+++.|+.++.    
T Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~l~iiDtPG~~~~~~~~~~~~~~~~~~~~~~~yi~~~~~~il~v~~~~~~~~~~~----  186 (306)
T d1jwyb_         111 GKNKGISAQPINLKIYSPHVVNLTLVDLPGITKVPVGDQPTDIEQQIRRMVMAYIKKQNAIIVAVTPANTDLANSD----  186 (306)
T ss_dssp             -----CCCCCEEEEEEETTSCSEEEEECCCCC---------CSHHHHHHHHHHHHHSTTEEEEEEEESSSCSTTCS----
T ss_pred             CCCCcccccceEEEecCCCCCCceEecCCCccccccCCcchhHHHHHHHHHHHHHhCCCceeEEeecccccccccH----
Confidence            7777889999999999999999999999999988888877777778899999999999999999888888887765    


Q ss_pred             hhhcCCCCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCC
Q psy5059         301 AKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGR  380 (1036)
Q Consensus       301 ~r~~Dp~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~  380 (1036)
                                                                                         ++.+++.+||.|.
T Consensus       187 -------------------------------------------------------------------~~~~~~~~~~~~~  199 (306)
T d1jwyb_         187 -------------------------------------------------------------------ALQLAKEVDPEGK  199 (306)
T ss_dssp             -------------------------------------------------------------------HHHHHHHHCSSCS
T ss_pred             -------------------------------------------------------------------HHHHHHHhCcCCC
Confidence                                                                               3556677777778


Q ss_pred             ceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhh
Q psy5059         381 RTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKE  460 (1036)
Q Consensus       381 rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~  460 (1036)
                      ||++|+||||..+++++.                                                              
T Consensus       200 r~i~Vitk~D~~~~~~~~--------------------------------------------------------------  217 (306)
T d1jwyb_         200 RTIGVITKLDLMDKGTDA--------------------------------------------------------------  217 (306)
T ss_dssp             SEEEEEECTTSSCSSCCC--------------------------------------------------------------
T ss_pred             eEEEEEeccccccchhHH--------------------------------------------------------------
Confidence            888888999888766553                                                              


Q ss_pred             cCcCCCceeeeecccccccccchHHHHhcCcceeeeecEEEEEcCChhhhhhccCHHHHHHHHHHHhhcc--cccccccc
Q psy5059         461 TDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRK--YPTLASRN  538 (1036)
Q Consensus       461 vd~~g~RtIgVlTK~Dlmd~gt~~~~il~g~~~~L~LG~~~V~NRs~~di~~~~s~~~al~~E~~fF~~~--~~~l~~~~  538 (1036)
                                              ..++.|...++.+||+.++|++..+.....++.++...|..||.++  |..+.+++
T Consensus       218 ------------------------~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~~f~~~~~~~~l~~r~  273 (306)
T d1jwyb_         218 ------------------------MEVLTGRVIPLTLGFIGVINRSQEDIIAKKSIRESLKSEILYFKNHPIYKSIANRS  273 (306)
T ss_dssp             ------------------------HHHHTTSSSCCTTCEEECCCCCHHHHSSSCCHHHHHHHHHHHHHTCTTGGGSGGGC
T ss_pred             ------------------------HHHHhCCcccccCCceeeecCchhhccccCCHHHHHHHHHHHHhCCchhcchHHHh
Confidence                                    3455666677788999999999999999999999999999999873  66788999


Q ss_pred             ChHHHHHHHHHHHHHHHHhhchhHHHHHHHHH
Q psy5059         539 GTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMI  570 (1036)
Q Consensus       539 G~~~L~~~L~~iL~~hIr~~LP~l~~~I~~~l  570 (1036)
                      |+.+|+.+|.++|.+||++.||.++.+|+..|
T Consensus       274 Gi~~L~~~L~~~L~~~i~~~lP~i~~~i~~~L  305 (306)
T d1jwyb_         274 GTAYLSKTLNKLLMFHIRDTLPDLKVKVSKML  305 (306)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHHHHHHHHHHHhHHHHHHHHHhh
Confidence            99999999999999999999999999988765
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure