Psyllid ID: psy5142


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
MAETDSSATNGNSGAEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLNENKDKNLKFNENCEHKNAEKFLNENKDKNLKFNENCEHSLLIKWQQEYHEEKKQEVRSKRDKSKKSTEGDGEGNTEGSKQVVLELPTGALLKISDIKEPVSREDIREVLEKVQTDDQEIVFIEFNVGEPTAFVRYKKENNAEAVLKALGSKEIVIKDVKVSIEVVTGEEEQTVLDRMKIDIFKRRQKLMNEKKSGRKFGKKGPRGTKRSRGGNFESNKKAKVE
cccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHcccccEEEHHHHHccHHHHHccccHHHHHHHHHHccccEEEEcccccEEEcccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccEEEEEEcccccHHHHccccccEEEEEEccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHHcccccccEEEEEEccccEEEEEcccHHHHHHHHHHHccccEEEccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccc
ccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccEEEEcccccEEEcccccccccccHHHHHHHHccEEEEEcccccccHHHHHHHHHHccccccEEEEEEEEcccccccccccccEEEEEEEccHHHHHHHHHHccccccccccHHHHHHHHHHHHHcHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHHcccccEEEEEEEEccccEEEEEEccHHHHHHHHHHHccccEEEEccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
maetdssatngnsgaeAEVSKLENQIIEQIEYYFSDINLARDKFLqgeikkddgWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIevnedgtkirrnpekelptfdidFVKDLIAQSLYvkyipvdatldDIKDFFKKNTSEDVKITNIIMRNYQDKlanqkkfkgsifvtfdnKENAEKFLNENkdknlkfnencEHKNAEKFLNEnkdknlkfneNCEHSLLIKWQQEYHEEKKQEVRskrdkskkstegdgegntegsKQVVLelptgallkisdikepvsrEDIREVLEKVQTDDQEIVFIEfnvgeptafvrykkENNAEAVLKALGSKEIVIKDVKVSIEVVtgeeeqtvLDRMKIDIFKRRQKLMNEkksgrkfgkkgprgtkrsrggnfesnkkakve
maetdssatngnsgaeaeVSKLENQIIEQIEYYFSDINLARDKFLQgeikkddgwvELTTMLKFARLAKMTTEAKVIVDalkkstsklievnedgtkirrnpekelptfDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFkkntsedvkitNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLNenkdknlkfNENCEHKNAEKFLNENKDKNLKFNENCEHSLLIKWQQEYHeekkqevrskrdkskkstegdgegntegskqvvlelptgallkisdikepvsrEDIREVLekvqtddqeivFIEFNVGEPTAFVRYKKENNAEAVLkalgskeivikdVKVSievvtgeeeqtvldrmkiDIFKRrqklmnekksgrkfgkkgprgtkrsrggnfesnkkakve
MAETDSSATNGNSGAEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLNENKDKNLKFNENCEHKNAEKFLNENKDKNLKFNENCEHSLLIKWQQEYHEEKKQEVRSKRDKSKKSTEGDGEGNTEGSKQVVLELPTGALLKISDIKEPVSREDIREVLEKVQTDDQEIVFIEFNVGEPTAFVRYKKENNAEAVLKALGSKEIVIKDVKVSIEVVTGEEEQTVLDRMKIDIFKRRQKLMNEKKSGRKFGKKGPRGTKRSRGGNFESNKKAKVE
***********************NQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIEV**************LPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDN***************************************KFNENCEHSLLIKWQ************************************VLELPTGALLKISDIKE*V**EDIREVLEKVQTDDQEIVFIEFNVGEPTAFVRYKKENNAEAVLKALGSKEIVIKDVKVSIEVVTGEEEQTVLDRMKIDIFK****************************************
************************QIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFKKNTSEDVKITNI************K*FKGSIFVTFDNKENAEKFLNENKDKNLKFNE************************************************************************************************VLEKVQTDDQEIVFIEFNVGEPTAFVRYKKENNAEA*L**LGSKEIVIKDVKVSIEVVTGEEEQTVLDR***********************************************
****************AEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLNENKDKNLKFNENCEHKNAEKFLNENKDKNLKFNENCEHSLLIKWQQEY*****************************SKQVVLELPTGALLKISDIKEPVSREDIREVLEKVQTDDQEIVFIEFNVGEPTAFVRYKKENNAEAVLKALGSKEIVIKDVKVSIEVVTGEEEQTVLDRMKIDIFKRRQKLMNEK*******************************
****************AEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLNENKDKNLKFNENCEHKNAEKFLNENKDKN*KFNENCEHSLLIKWQQEYHEEKKQEVRSKRDK*************EGSKQVVLELPTGALLKISDIKEPVSREDIREVLEKVQTDDQEIVFIEFNVGEPTAFVRYKKENNAEAVLKALGSKEIVIKDVKVSIEVVTGEEEQTVLDRMKIDIFKRRQK************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAETDSSATNGNSGAEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLNENKDKNLKFNENCEHKNAEKFLNENKDKNLKFNENCEHSLLIKWQQEYHEEKKQEVRSKRDKSKKSTEGDGEGNTEGSKQVVLELPTGALLKISDIKEPVSREDIREVLEKVQTDDQEIVFIEFNVGEPTAFVRYKKENNAEAVLKALGSKEIVIKDVKVSIEVVTGEEEQTVLDRMKIDIFKRRQKLMNEKKSGRKFGKKGPRGTKRSRGGNFESNKKAKVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query410 2.2.26 [Sep-21-2011]
P40796390 La protein homolog OS=Dro yes N/A 0.817 0.858 0.339 7e-45
P05455408 Lupus La protein OS=Homo yes N/A 0.812 0.816 0.353 9e-44
P32067415 Lupus La protein homolog yes N/A 0.797 0.787 0.356 2e-43
P10881404 Lupus La protein homolog yes N/A 0.826 0.839 0.340 9e-43
P38656415 Lupus La protein homolog yes N/A 0.812 0.802 0.339 1e-42
P28048428 Lupus La protein homolog N/A N/A 0.763 0.731 0.346 1e-42
Q26457383 La protein homolog OS=Aed N/A N/A 0.821 0.879 0.341 6e-42
P28049427 Lupus La protein homolog N/A N/A 0.763 0.733 0.346 2e-41
P87058298 La protein homolog OS=Sch yes N/A 0.395 0.543 0.374 9e-20
Q7ZWE3 555 La-related protein 7 OS=D no N/A 0.368 0.272 0.305 6e-15
>sp|P40796|LA_DROME La protein homolog OS=Drosophila melanogaster GN=La PE=1 SV=2 Back     alignment and function desciption
 Score =  181 bits (460), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 130/383 (33%), Positives = 198/383 (51%), Gaps = 48/383 (12%)

Query: 20  SKLENQIIEQIEYYFSDINLARDKFLQGEI-KKDDGWVELTTMLKFARLAKMTTEAKVIV 78
           +K E  II Q+EYYF D NL RDKFL+ +I K +DGWV L+ ++ F RLA ++T+   IV
Sbjct: 48  TKQERAIIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIV 107

Query: 79  DALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKD 138
            AL KS   L+E++ED   +RR+PE+ +P  + +  K++  ++ Y K  P+D+ + ++ D
Sbjct: 108 AALNKSEEGLVEISEDKLSLRRHPERPIPEHNEERRKEIQERTAYAKGFPLDSQISELLD 167

Query: 139 FFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLNENKDKNLKFNE 198
           F     +   K+ N+ MR + DK     KFKGSIF+TF+ K+ A+ FL +         E
Sbjct: 168 F----AANYDKVVNLTMRKHYDKPTKSYKFKGSIFLTFETKDQAKAFLEQ---------E 214

Query: 199 NCEHKNAEKFLNENKDKNLKFNENCEHSLLIKWQQEYHEEKKQEVRSKRDKSKKSTEGDG 258
              +K                    E  LL KWQ +Y +EK++E   K +K K   E   
Sbjct: 215 KIVYK--------------------ERELLRKWQVDYLKEKQEEYAQKNEKRKNKKEAKP 254

Query: 259 EGNTEGSKQVVLELPTGALLKISDIKEPVSREDIREVLEKVQTDDQEIVFIEFNVGEPTA 318
           E           ELP  A++      E  SRE+IRE  EK++  D E+ +IEF  GE   
Sbjct: 255 EP--------AFELPKNAIVVFEGAPETSSREEIREAFEKIK--DFEVAYIEFAKGETKG 304

Query: 319 FVRYKKENNAEAVLKALGSKEIVIKD-VKVSIEVVTGEEEQTVLDRMKIDIFKRRQKLMN 377
            VR  + + AE  +  +   ++  KD V +S+   T EEE+  +D+  I+  K+R+    
Sbjct: 305 SVRLTEADAAEKYIAKVEEGKLKFKDEVSLSLRKATEEEEKEFIDKA-IEFMKKRRDFTR 363

Query: 378 EKKSGRKFGKKGPRGTKRSRGGN 400
            K  G++F +K   G     GG 
Sbjct: 364 NK--GKRFNRKRHGGNDHKHGGG 384




May be involved in transcription termination by RNA polymerase III. Binds RNA and DNA. Binds to precursors of RNA polymerase III transcripts. May play a specialized role during fly development.
Drosophila melanogaster (taxid: 7227)
>sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens GN=SSB PE=1 SV=2 Back     alignment and function description
>sp|P32067|LA_MOUSE Lupus La protein homolog OS=Mus musculus GN=Ssb PE=2 SV=1 Back     alignment and function description
>sp|P10881|LA_BOVIN Lupus La protein homolog OS=Bos taurus GN=SSB PE=2 SV=2 Back     alignment and function description
>sp|P38656|LA_RAT Lupus La protein homolog OS=Rattus norvegicus GN=Ssb PE=2 SV=1 Back     alignment and function description
>sp|P28048|LAA_XENLA Lupus La protein homolog A OS=Xenopus laevis GN=ssb-a PE=2 SV=1 Back     alignment and function description
>sp|Q26457|LA_AEDAL La protein homolog OS=Aedes albopictus PE=1 SV=1 Back     alignment and function description
>sp|P28049|LAB_XENLA Lupus La protein homolog B OS=Xenopus laevis GN=ssb-b PE=2 SV=1 Back     alignment and function description
>sp|P87058|LAH1_SCHPO La protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sla1 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZWE3|LARP7_DANRE La-related protein 7 OS=Danio rerio GN=larp7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query410
357617844384 hypothetical protein KGM_09976 [Danaus p 0.778 0.830 0.371 1e-54
427787869417 Putative receptor-mediated endocytosis [ 0.726 0.714 0.364 1e-49
158299618429 AGAP008952-PA [Anopheles gambiae str. PE 0.814 0.778 0.340 5e-49
312383017402 hypothetical protein AND_04034 [Anophele 0.770 0.786 0.353 5e-47
346468663398 hypothetical protein [Amblyomma maculatu 0.809 0.834 0.335 1e-46
195436884404 GK18125 [Drosophila willistoni] gi|19416 0.817 0.829 0.337 2e-46
380012601404 PREDICTED: la protein homolog [Apis flor 0.858 0.871 0.331 2e-46
110759433404 PREDICTED: la protein homolog [Apis mell 0.858 0.871 0.331 2e-46
383848821406 PREDICTED: la protein homolog [Megachile 0.831 0.839 0.332 2e-46
194760049391 GF15376 [Drosophila ananassae] gi|190615 0.826 0.867 0.345 1e-44
>gi|357617844|gb|EHJ71027.1| hypothetical protein KGM_09976 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  220 bits (561), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 205/358 (57%), Gaps = 39/358 (10%)

Query: 18  EVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVI 77
           E S+L++ II QIEYYF D+NL RDKFL+ ++K DDGWV L  + +F RLAK+TT+  VI
Sbjct: 36  EKSELDSSIIRQIEYYFGDLNLPRDKFLREQVKLDDGWVPLEVLTRFNRLAKLTTDIGVI 95

Query: 78  VDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIK 137
            +A+ KSTS L+E+++D  K+RRNPE  +P  + +  K+L+++++Y K    DA+LDDI 
Sbjct: 96  ANAISKSTSGLLEISDDNLKVRRNPELPIPEMNEERRKELVSRTIYAKGFGKDASLDDIL 155

Query: 138 DFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLNENKDKNLKFN 197
            +FK+      ++ NIIMR YQD+      FKGS+F TF  K+ A+KF+   + K+ KFN
Sbjct: 156 KYFKQFE----EVENIIMRKYQDRKTKTFIFKGSVFATFKTKDQADKFM---ETKDYKFN 208

Query: 198 ENCEHKNAEKFLNENKDKNLKFNENCEHSLLIKWQQEYHEEKKQEVRSKRDKSKKSTEGD 257
           +                            LL+ WQ  Y E+K++E       S      +
Sbjct: 209 DT--------------------------DLLVMWQDAYVEKKREEYAK---LSANKKNKN 239

Query: 258 GEGNTEGSKQVVLELPTGALLKISDIKEPVSREDIREVLEKVQTDDQEIVFIEFNVGEPT 317
             G +E  ++   +LPTG +L  S   + ++RED++EVL  +     E+ FI F VG+  
Sbjct: 240 KNGESEQKEKSEFKLPTGTVLHFSQGHDKMTREDVKEVLTPLGG---EVAFISFKVGDTE 296

Query: 318 AFVRYKKENNAEAVLKALGSKEIVIKDVKVSIEVVTGEEEQTVLDRMKIDIFKRRQKL 375
            +VR   E +A+ V + +   +I I + +V   V+ GEEE+  LD+   ++ KRRQ +
Sbjct: 297 GWVRLANEGDAKKVAEKIPDGKIKIGESEVVFRVLEGEEEKNYLDKTIEEMSKRRQNM 354




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|427787869|gb|JAA59386.1| Putative receptor-mediated endocytosis [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|158299618|ref|XP_319705.4| AGAP008952-PA [Anopheles gambiae str. PEST] gi|157013603|gb|EAA14810.4| AGAP008952-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312383017|gb|EFR28258.1| hypothetical protein AND_04034 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|346468663|gb|AEO34176.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|195436884|ref|XP_002066385.1| GK18125 [Drosophila willistoni] gi|194162470|gb|EDW77371.1| GK18125 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|380012601|ref|XP_003690368.1| PREDICTED: la protein homolog [Apis florea] Back     alignment and taxonomy information
>gi|110759433|ref|XP_395300.3| PREDICTED: la protein homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|383848821|ref|XP_003700046.1| PREDICTED: la protein homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|194760049|ref|XP_001962254.1| GF15376 [Drosophila ananassae] gi|190615951|gb|EDV31475.1| GF15376 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query410
MGI|MGI:98423415 Ssb "Sjogren syndrome antigen 0.495 0.489 0.431 6.8e-49
UNIPROTKB|Q66HM7415 Ssb "Sjogren syndrome antigen 0.495 0.489 0.426 2.9e-48
RGD|620804415 Ssb "Sjogren syndrome antigen 0.495 0.489 0.426 4.7e-48
RGD|1592944402 LOC680385 "similar to Sjogren 0.495 0.504 0.435 6e-48
UNIPROTKB|P05455408 SSB "Lupus La protein" [Homo s 0.546 0.549 0.410 4.3e-38
UNIPROTKB|E9PFH8361 SSB "Lupus La protein" [Homo s 0.546 0.620 0.410 4.3e-38
UNIPROTKB|E2RH09406 SSB "Uncharacterized protein" 0.546 0.551 0.401 5.5e-38
WB|WBGene00016653396 C44E4.4 [Caenorhabditis elegan 0.375 0.388 0.409 9.3e-38
UNIPROTKB|F1S1V1402 SSB "Uncharacterized protein" 0.524 0.534 0.418 4.9e-37
UNIPROTKB|P10881404 SSB "Lupus La protein homolog" 0.546 0.554 0.397 6.3e-37
MGI|MGI:98423 Ssb "Sjogren syndrome antigen B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 395 (144.1 bits), Expect = 6.8e-49, Sum P(2) = 6.8e-49
 Identities = 94/218 (43%), Positives = 131/218 (60%)

Query:    13 SGAEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTT 72
             +G   +++ LE +I  QIEYYF D NL RDKFL+ +IK D+GWV L TM+KF RL ++TT
Sbjct:     4 NGDNEKMTALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLETMIKFNRLNRLTT 63

Query:    73 EAKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDAT 132
             +  VIV AL KS +KL+EV+ D TKIRR+P + LP    ++  D+  +S+Y+K  P DAT
Sbjct:    64 DFNVIVQALSKSKAKLMEVSADKTKIRRSPSRPLPEVTDEYKNDVKNRSVYIKGFPTDAT 123

Query:   133 LDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLN----E 188
             LDDIK++      +  +I NI MR         K FKGSIF  FD+ ++A+KF+     +
Sbjct:   124 LDDIKEWL----DDKGQILNIQMRR-----TLHKTFKGSIFAVFDSIQSAKKFVEIPGQK 174

Query:   189 NKDKNLK--FNENCEHKNAEKFLNENKDKNLKFNENCE 224
              KD NL   F E+   K  E+      +  LK  +  E
Sbjct:   175 YKDTNLLILFKEDYFAKKNEERKQSKVEAKLKAKQEHE 212


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0006396 "RNA processing" evidence=IEA
GO:0008033 "tRNA processing" evidence=ISO
GO:0030529 "ribonucleoprotein complex" evidence=IEA
UNIPROTKB|Q66HM7 Ssb "Sjogren syndrome antigen B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|620804 Ssb "Sjogren syndrome antigen B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1592944 LOC680385 "similar to Sjogren syndrome antigen B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P05455 SSB "Lupus La protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PFH8 SSB "Lupus La protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RH09 SSB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00016653 C44E4.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1V1 SSB "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P10881 SSB "Lupus La protein homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P40796LA_DROMENo assigned EC number0.33940.81700.8589yesN/A
P38656LA_RATNo assigned EC number0.33920.81210.8024yesN/A
P10881LA_BOVINNo assigned EC number0.34090.82680.8391yesN/A
P32067LA_MOUSENo assigned EC number0.35650.79750.7879yesN/A
P05455LA_HUMANNo assigned EC number0.35320.81210.8161yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query410
cd0802882 cd08028, LARP_3, La RNA-binding domain of La-relat 7e-34
smart0071580 smart00715, LA, Domain in the RNA-binding Lupus La 1e-25
cd0732375 cd07323, LAM, LA motif RNA-binding domain 2e-22
pfam0538359 pfam05383, La, La domain 6e-21
cd0803377 cd08033, LARP_6, La RNA-binding domain of La-relat 3e-15
cd0802976 cd08029, LA_like_fungal, La-motif domain of fungal 2e-14
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 2e-13
cd0803282 cd08032, LARP_7, La RNA-binding domain of La-relat 5e-13
cd0803090 cd08030, LA_like_plant, La-motif domain of plant p 4e-11
cd1254176 cd12541, RRM2_La, RNA recognition motif 2 in La au 6e-11
pfam08777102 pfam08777, RRM_3, RNA binding motif 2e-10
cd0803473 cd08034, LARP_1_2, La RNA-binding domain proteins 2e-09
cd0803175 cd08031, LARP_4_5_like, La RNA-binding domain of p 4e-09
cd0803773 cd08037, LARP_1, La RNA-binding domain of La-relat 8e-07
cd0803873 cd08038, LARP_2, La RNA-binding domain of La-relat 1e-06
smart0036073 smart00360, RRM, RNA recognition motif 4e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 5e-06
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-05
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 4e-05
COG5193438 COG5193, LHP1, La protein, small RNA-binding pol I 5e-05
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 8e-05
cd1229275 cd12292, RRM2_La_like, RNA recognition motif 2 in 1e-04
cd0803675 cd08036, LARP_5, La RNA-binding domain of La-relat 3e-04
cd0803575 cd08035, LARP_4, La RNA-binding domain of La-relat 3e-04
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 0.004
>gnl|CDD|153397 cd08028, LARP_3, La RNA-binding domain of La-related protein 3 Back     alignment and domain information
 Score =  120 bits (304), Expect = 7e-34
 Identities = 50/82 (60%), Positives = 62/82 (75%)

Query: 19  VSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIV 78
           +  LE +II QIEYYF D NL RDKFL+ +IK+DDGWV +  MLKF RL  ++++ +VI 
Sbjct: 1   MDDLEKKIIRQIEYYFGDFNLPRDKFLKEQIKEDDGWVPMEVMLKFNRLKSLSSDPEVIA 60

Query: 79  DALKKSTSKLIEVNEDGTKIRR 100
            ALKKS S LIEV+ED TKIRR
Sbjct: 61  KALKKSKSGLIEVSEDKTKIRR 82


This domain is found at the N-terminus of the La autoantigen and similar proteins, and co-occurs with an RNA-recognition motif (RRM). Together these domains function to bind primary transcripts of RNA polymerase III at their 3' terminus and protect them from exonucleolytic degradation. Binding is specific for the 3'-terminal UUU-OH motif. The La autoantigen is also called Lupus La protein, LARP3, or Sjoegren syndrome type B antigen (SS-B). Length = 82

>gnl|CDD|128955 smart00715, LA, Domain in the RNA-binding Lupus La protein; unknown function Back     alignment and domain information
>gnl|CDD|153396 cd07323, LAM, LA motif RNA-binding domain Back     alignment and domain information
>gnl|CDD|203243 pfam05383, La, La domain Back     alignment and domain information
>gnl|CDD|153402 cd08033, LARP_6, La RNA-binding domain of La-related protein 6 Back     alignment and domain information
>gnl|CDD|153398 cd08029, LA_like_fungal, La-motif domain of fungal proteins similar to the La autoantigen Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|153401 cd08032, LARP_7, La RNA-binding domain of La-related protein 7 Back     alignment and domain information
>gnl|CDD|153399 cd08030, LA_like_plant, La-motif domain of plant proteins similar to the La autoantigen Back     alignment and domain information
>gnl|CDD|240985 cd12541, RRM2_La, RNA recognition motif 2 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|220013 pfam08777, RRM_3, RNA binding motif Back     alignment and domain information
>gnl|CDD|153403 cd08034, LARP_1_2, La RNA-binding domain proteins similar to La-related proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|153400 cd08031, LARP_4_5_like, La RNA-binding domain of proteins similar to La-related proteins 4 and 5 Back     alignment and domain information
>gnl|CDD|153406 cd08037, LARP_1, La RNA-binding domain of La-related protein 1 Back     alignment and domain information
>gnl|CDD|153407 cd08038, LARP_2, La RNA-binding domain of La-related protein 2 Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|227520 COG5193, LHP1, La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240738 cd12292, RRM2_La_like, RNA recognition motif 2 in La autoantigen (La or SS-B or LARP3), La-related protein 7 (LARP7 or PIP7S) and similar proteins Back     alignment and domain information
>gnl|CDD|153405 cd08036, LARP_5, La RNA-binding domain of La-related protein 5 Back     alignment and domain information
>gnl|CDD|153404 cd08035, LARP_4, La RNA-binding domain of La-related protein 4 Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 410
KOG4213|consensus205 100.0
KOG1855|consensus484 99.98
cd0803282 LARP_7 La RNA-binding domain of La-related protein 99.96
cd0802882 LARP_3 La RNA-binding domain of La-related protein 99.96
cd0803377 LARP_6 La RNA-binding domain of La-related protein 99.96
smart0071580 LA Domain in the RNA-binding Lupus La protein; unk 99.96
cd0803575 LARP_4 La RNA-binding domain of La-related protein 99.96
cd0803675 LARP_5 La RNA-binding domain of La-related protein 99.95
cd0802976 LA_like_fungal La-motif domain of fungal proteins 99.95
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.95
cd0803175 LARP_4_5_like La RNA-binding domain of proteins si 99.95
cd0803090 LA_like_plant La-motif domain of plant proteins si 99.95
cd0803773 LARP_1 La RNA-binding domain of La-related protein 99.94
cd0803873 LARP_2 La RNA-binding domain of La-related protein 99.94
cd0803473 LARP_1_2 La RNA-binding domain proteins similar to 99.94
cd0732375 LAM LA motif RNA-binding domain. This domain is fo 99.93
KOG0117|consensus 506 99.91
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.9
PF0538361 La: La domain; InterPro: IPR006630 Human Ro ribonu 99.89
KOG2591|consensus 684 99.89
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.89
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.88
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.87
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.87
KOG0148|consensus321 99.87
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.86
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 99.86
KOG0127|consensus 678 99.85
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.85
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.81
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.8
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.79
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.78
KOG0145|consensus360 99.78
KOG0131|consensus203 99.76
KOG0144|consensus 510 99.75
KOG0127|consensus 678 99.75
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.73
KOG0145|consensus360 99.69
KOG0124|consensus 544 99.69
KOG0123|consensus 369 99.66
COG5193438 LHP1 La protein, small RNA-binding pol III transcr 99.64
KOG0105|consensus241 99.63
KOG0110|consensus725 99.58
KOG0109|consensus 346 99.57
KOG0147|consensus 549 99.55
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.53
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.51
KOG4211|consensus 510 99.5
KOG4205|consensus311 99.49
KOG0144|consensus 510 99.48
KOG0146|consensus371 99.48
KOG4206|consensus221 99.47
KOG0123|consensus369 99.46
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.41
KOG0110|consensus725 99.38
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.35
KOG0106|consensus216 99.34
KOG0147|consensus549 99.32
KOG1548|consensus382 99.29
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.27
PLN03120260 nucleic acid binding protein; Provisional 99.21
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.2
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.19
KOG0121|consensus153 99.17
KOG0122|consensus270 99.16
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.13
KOG4212|consensus 608 99.12
KOG1457|consensus284 99.12
KOG0148|consensus 321 99.1
KOG0107|consensus195 99.09
smart0036272 RRM_2 RNA recognition motif. 99.07
KOG0149|consensus247 99.06
KOG0105|consensus 241 99.05
PLN03213 759 repressor of silencing 3; Provisional 99.04
PLN03121243 nucleic acid binding protein; Provisional 99.03
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.0
KOG0113|consensus335 98.98
KOG4207|consensus 256 98.98
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.98
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.98
KOG0107|consensus195 98.96
smart0036272 RRM_2 RNA recognition motif. 98.96
smart0036071 RRM RNA recognition motif. 98.95
KOG4207|consensus256 98.94
PLN03120 260 nucleic acid binding protein; Provisional 98.91
KOG0114|consensus124 98.9
KOG0126|consensus219 98.89
PLN03121 243 nucleic acid binding protein; Provisional 98.88
PLN03213 759 repressor of silencing 3; Provisional 98.87
KOG0125|consensus376 98.86
KOG1365|consensus508 98.84
KOG0108|consensus 435 98.82
smart0036071 RRM RNA recognition motif. 98.77
KOG0130|consensus170 98.75
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.74
KOG0111|consensus298 98.74
KOG1190|consensus 492 98.7
COG5193438 LHP1 La protein, small RNA-binding pol III transcr 98.69
KOG0121|consensus153 98.67
KOG0125|consensus 376 98.64
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.64
KOG0114|consensus124 98.64
KOG4212|consensus608 98.61
KOG0116|consensus419 98.61
smart0036170 RRM_1 RNA recognition motif. 98.6
KOG0113|consensus335 98.6
KOG0122|consensus270 98.59
KOG1190|consensus492 98.58
KOG0124|consensus544 98.55
KOG2590|consensus448 98.54
KOG0120|consensus500 98.52
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.49
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.45
KOG0149|consensus 247 98.39
KOG0109|consensus 346 98.37
KOG0130|consensus170 98.36
KOG4211|consensus 510 98.35
KOG0131|consensus203 98.33
KOG0128|consensus881 98.3
KOG0132|consensus 894 98.28
KOG0146|consensus371 98.24
KOG0112|consensus 975 98.24
KOG4454|consensus267 98.23
KOG4208|consensus214 98.23
KOG0153|consensus377 98.22
KOG0129|consensus520 98.2
KOG0117|consensus 506 98.18
smart0036170 RRM_1 RNA recognition motif. 98.12
KOG0153|consensus377 98.09
KOG1456|consensus 494 98.07
KOG4205|consensus311 98.01
KOG1456|consensus494 97.97
KOG0116|consensus419 97.96
KOG0533|consensus243 97.96
KOG0132|consensus 894 97.95
KOG4209|consensus231 97.95
KOG0111|consensus 298 97.94
KOG0126|consensus219 97.94
KOG1365|consensus 508 97.91
KOG0533|consensus243 97.88
KOG0415|consensus 479 97.85
KOG0108|consensus 435 97.81
KOG0415|consensus479 97.79
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.77
KOG4206|consensus221 97.66
KOG4210|consensus285 97.65
KOG0120|consensus500 97.64
KOG4660|consensus 549 97.61
KOG4661|consensus 940 97.52
KOG4208|consensus214 97.47
KOG4661|consensus 940 97.44
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.43
KOG0226|consensus290 97.37
KOG4307|consensus 944 97.35
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.34
KOG1457|consensus 284 97.28
KOG2193|consensus 584 97.11
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.05
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.01
KOG0106|consensus216 96.88
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.83
KOG4660|consensus 549 96.73
KOG0151|consensus 877 96.65
KOG4454|consensus 267 96.61
KOG0151|consensus 877 96.54
KOG1548|consensus 382 96.52
KOG4210|consensus285 96.28
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.26
KOG1995|consensus 351 96.22
KOG4307|consensus944 96.06
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.02
KOG2314|consensus 698 95.99
KOG3152|consensus278 95.97
KOG0226|consensus290 95.95
KOG4676|consensus 479 95.73
KOG1995|consensus351 95.62
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.56
COG5175480 MOT2 Transcriptional repressor [Transcription] 95.28
KOG4209|consensus231 95.19
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 95.18
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 95.18
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.07
KOG0129|consensus520 95.06
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.02
KOG3152|consensus278 94.48
KOG0115|consensus 275 93.54
KOG1855|consensus 484 93.49
KOG4676|consensus 479 93.15
KOG0128|consensus881 93.08
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.07
PF09421 989 FRQ: Frequency clock protein; InterPro: IPR018554 92.76
KOG2591|consensus 684 92.66
KOG4849|consensus 498 92.24
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 92.09
KOG3293|consensus134 91.53
KOG2416|consensus718 91.04
KOG4849|consensus 498 90.6
KOG2202|consensus260 90.46
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 90.12
KOG2416|consensus 718 89.17
KOG2314|consensus 698 89.13
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 89.12
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 88.65
KOG0115|consensus275 88.44
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 88.44
KOG0804|consensus 493 88.28
KOG2202|consensus260 87.81
KOG2068|consensus327 87.28
PF15023166 DUF4523: Protein of unknown function (DUF4523) 87.0
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 86.88
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 84.76
KOG1996|consensus378 83.91
PF01885186 PTS_2-RNA: RNA 2'-phosphotransferase, Tpt1 / KptA 82.67
KOG3973|consensus465 82.11
KOG4285|consensus350 80.04
>KOG4213|consensus Back     alignment and domain information
Probab=100.00  E-value=3.2e-33  Score=241.25  Aligned_cols=168  Identities=44%  Similarity=0.683  Sum_probs=151.4

Q ss_pred             CccchhHHHHHHHHHHHHHhCCCCCCCChhHHhhh-ccCCCeEehHHHHhhHHHHhccCcHHHHHHHHhhcCCceEEEec
Q psy5142          15 AEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEI-KKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIEVNE   93 (410)
Q Consensus        15 ~~~~~~~~~~~i~~QlEfYfsd~Nl~~D~fl~~~~-~~~~g~v~l~~l~~F~r~k~l~~d~~~i~~Al~~~~S~~levse   93 (410)
                      +...++++.++|+.||||||+|.||++|+||+++| ..++|||||.++++|||+..|++|..+|+.||+.|.+.++++|+
T Consensus         6 ~~~~~a~lE~kii~qleyy~Gd~nl~rdkfl~eqi~k~~~gwvpi~i~i~FnRla~lttD~~~Iv~al~ksk~~l~eise   85 (205)
T KOG4213|consen    6 DAVKMAALEAKIIHQLEYYFGDLNLPRDKFLREQIHKLDDGWVPIEIMIKFNRLASLTTDFNVIVEALSKSKAELMEISE   85 (205)
T ss_pred             cccchhHHHHhhhhhhhhhhcccCchHHHHHHHHhhhhccCCccchhhhhhhhhhhccccHHHHHHHHhhCHHhhhhhhh
Confidence            33448999999999999999999999999999999 55789999999999999999999999999999999999999999


Q ss_pred             CccceecCCCCCCCCCchhhhhhccceeeEeecCCCCCCHHHHHHHHhhccCCCCceEEEEEcccCcccccccccccEEE
Q psy5142          94 DGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIF  173 (410)
Q Consensus        94 d~~~vrR~~~~p~p~~~~~~~~~~~~rtv~V~~lp~~~t~~~L~~~F~~~~~~~G~I~~v~l~~~~~~~~~~~~~kG~af  173 (410)
                      |++++||.++.|+|+.+++++.....|++|.+  |.+...++|..|-+      |.+.+|.|++...+.   ..++|..|
T Consensus        86 dk~k~rr~~skplpEvt~e~~~~~~~r~v~~K--~td~ql~~l~qw~~------~k~~nv~mr~~~~k~---~~fkGsvk  154 (205)
T KOG4213|consen   86 DKTKIRRSPSKPLPEVTDEYKEGIKERTVYKK--ITDDQLDDLNQWAS------GKGHNVKMRRHGNKA---HPFKGSVK  154 (205)
T ss_pred             chhhhhcCcCCCCccccHHHHHHHHHhhhhcc--CCHHHHHHHHHHhc------ccceEeeccccCCCC---CCCCCceE
Confidence            99999999999999999999999999999999  66667777777665      688899999887663   36999999


Q ss_pred             EEecCHHHHHHHHHhcCCCCccc
Q psy5142         174 VTFDNKENAEKFLNENKDKNLKF  196 (410)
Q Consensus       174 VeF~~~e~A~~Al~~~~g~~~~~  196 (410)
                      |+|.+.++|..+++...   ..+
T Consensus       155 v~f~tk~qa~a~~~~~e---~~~  174 (205)
T KOG4213|consen  155 VTFQTKEQAFANDDTHE---EKG  174 (205)
T ss_pred             EEeecHHHHHhhhhhhh---hhc
Confidence            99999999999888766   455



>KOG1855|consensus Back     alignment and domain information
>cd08032 LARP_7 La RNA-binding domain of La-related protein 7 Back     alignment and domain information
>cd08028 LARP_3 La RNA-binding domain of La-related protein 3 Back     alignment and domain information
>cd08033 LARP_6 La RNA-binding domain of La-related protein 6 Back     alignment and domain information
>smart00715 LA Domain in the RNA-binding Lupus La protein; unknown function Back     alignment and domain information
>cd08035 LARP_4 La RNA-binding domain of La-related protein 4 Back     alignment and domain information
>cd08036 LARP_5 La RNA-binding domain of La-related protein 5 Back     alignment and domain information
>cd08029 LA_like_fungal La-motif domain of fungal proteins similar to the La autoantigen Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>cd08031 LARP_4_5_like La RNA-binding domain of proteins similar to La-related proteins 4 and 5 Back     alignment and domain information
>cd08030 LA_like_plant La-motif domain of plant proteins similar to the La autoantigen Back     alignment and domain information
>cd08037 LARP_1 La RNA-binding domain of La-related protein 1 Back     alignment and domain information
>cd08038 LARP_2 La RNA-binding domain of La-related protein 2 Back     alignment and domain information
>cd08034 LARP_1_2 La RNA-binding domain proteins similar to La-related proteins 1 and 2 Back     alignment and domain information
>cd07323 LAM LA motif RNA-binding domain Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>PF05383 La: La domain; InterPro: IPR006630 Human Ro ribonucleoproteins (RNPs) are composed of one of the four small Y RNAs and at least two proteins, Ro60 and La Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>COG5193 LHP1 La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>COG5193 LHP1 La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG2590|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF09421 FRQ: Frequency clock protein; InterPro: IPR018554 The frequency clock protein, is the central component of the frq-based circadian negative feedback loop, regulates various aspects of the circadian clock in Neurospora crassa [] Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG3293|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF01885 PTS_2-RNA: RNA 2'-phosphotransferase, Tpt1 / KptA family; InterPro: IPR002745 The final step of tRNA splicing in Saccharomyces cerevisiae (Baker's yeast) requires 2'-phosphotransferase (Tpt1) to transfer the 2'-phosphate from ligated tRNA to NAD, producing mature tRNA and ADP ribose-1' '-2' '-cyclic phosphate Back     alignment and domain information
>KOG3973|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query410
2vod_A193 Crystal Structure Of N-Terminal Domains Of Human La 1e-38
1zh5_A195 Structural Basis For Recognition Of Uuuoh 3'-Termin 3e-36
1yty_A194 Structural Basis For Recognition Of Uuuoh 3'-Termin 7e-36
1s7a_A103 Nmr Structure Of The La Motif Of Human La Protein L 2e-24
1s29_A92 La Autoantigen N-Terminal Domain Length = 92 1e-10
1s79_A103 Solution Structure Of The Central Rrm Of Human La P 4e-07
2cqk_A101 Solution Structure Of The La Domain Of C-Mpl Bindin 8e-04
>pdb|2VOD|A Chain A, Crystal Structure Of N-Terminal Domains Of Human La Protein Complexed With Rna Oligomer Auauuuu Length = 193 Back     alignment and structure

Iteration: 1

Score = 157 bits (396), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 84/176 (47%), Positives = 119/176 (67%), Gaps = 9/176 (5%) Query: 11 GNSGAEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKM 70 G++G +++ LE +I QIEYYF D NL RDKFL+ +IK D+GWV L M+KF RL ++ Sbjct: 1 GSNGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRL 60 Query: 71 TTEAKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVD 130 TT+ VIV+AL KS ++L+E++ED TKIRR+P K LP ++ D+ +S+Y+K P D Sbjct: 61 TTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTD 120 Query: 131 ATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFL 186 ATLDDIK++ + ++ NI MR K FKGSIFV FD+ E+A+KF+ Sbjct: 121 ATLDDIKEWLEDKG----QVLNIQMRR-----TLHKAFKGSIFVVFDSIESAKKFV 167
>pdb|1ZH5|A Chain A, Structural Basis For Recognition Of Uuuoh 3'-Terminii Of Nascent Rna Pol Iii Transcripts By La Autoantigen Length = 195 Back     alignment and structure
>pdb|1YTY|A Chain A, Structural Basis For Recognition Of Uuuoh 3'-Terminii Of Nascent Rna Pol Iii Transcripts By La Autoantigen Length = 194 Back     alignment and structure
>pdb|1S7A|A Chain A, Nmr Structure Of The La Motif Of Human La Protein Length = 103 Back     alignment and structure
>pdb|1S29|A Chain A, La Autoantigen N-Terminal Domain Length = 92 Back     alignment and structure
>pdb|1S79|A Chain A, Solution Structure Of The Central Rrm Of Human La Protein Length = 103 Back     alignment and structure
>pdb|2CQK|A Chain A, Solution Structure Of The La Domain Of C-Mpl Binding Protein Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query410
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 9e-34
1s29_A92 LA protein; winged helix-turn-helix, autoantigen, 3e-26
2cqk_A101 C-MPL binding protein; LA domain, structural genom 4e-25
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 5e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-06
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-06
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 7e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 9e-06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 9e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 9e-06
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-05
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-05
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-05
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-05
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 6e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-04
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-04
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-04
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-04
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-04
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-04
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-04
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 6e-04
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 7e-04
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
 Score =  123 bits (310), Expect = 9e-34
 Identities = 91/231 (39%), Positives = 132/231 (57%), Gaps = 38/231 (16%)

Query: 11  GNSGAEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKM 70
           G++G   +++ LE +I  QIEYYF D NL RDKFL+ +IK D+GWV L  M+KF RL ++
Sbjct: 1   GSNGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRL 60

Query: 71  TTEAKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVD 130
           TT+  VIV+AL KS ++L+E++ED TKIRR+P K LP    ++  D+  +S+Y+K  P D
Sbjct: 61  TTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTD 120

Query: 131 ATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKGSIFVTFDNKENAEKFLNENK 190
           ATLDDIK++ +       ++ NI MR    K      FKGSIFV FD+ E+A+KF+    
Sbjct: 121 ATLDDIKEWLEDKG----QVLNIQMRRTLHK-----AFKGSIFVVFDSIESAKKFVETP- 170

Query: 191 DKNLKFNENCEHKNAEKFLNENKDKNLKFNENCEHSLLIKWQQEYHEEKKQ 241
                                      K+ E     LLI ++ +Y  +K +
Sbjct: 171 -------------------------GQKYKET---DLLILFKDDYFAKKNE 193


>1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 Length = 92 Back     alignment and structure
>2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 Length = 101 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 121 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query410
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 100.0
2cqk_A101 C-MPL binding protein; LA domain, structural genom 99.96
1s29_A92 LA protein; winged helix-turn-helix, autoantigen, 99.96
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.94
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.94
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.93
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.93
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.93
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.93
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.93
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.92
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.91
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.91
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.91
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.9
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.9
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.9
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.9
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.89
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.88
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.88
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.88
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.88
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.87
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.72
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.66
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.61
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.6
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.58
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.55
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.55
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.54
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.53
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.53
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.53
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.52
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.52
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.51
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.51
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.51
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.51
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.51
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.5
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.5
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.5
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.5
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.49
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.49
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.49
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.49
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.49
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.49
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.49
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.49
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.49
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.49
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.49
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.49
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.49
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.48
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.48
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.48
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.48
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.48
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.48
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.48
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.48
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.48
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.48
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.48
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.48
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.48
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.48
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.48
2div_A99 TRNA selenocysteine associated protein; structural 99.48
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.47
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.47
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.47
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.47
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.47
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.47
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.46
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.46
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.46
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.46
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.46
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.46
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.46
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.45
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.45
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.45
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.45
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.45
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.45
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.44
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.44
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.44
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.44
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.44
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.44
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.44
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.44
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.44
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.44
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.44
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.43
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.43
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.43
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.43
2dis_A109 Unnamed protein product; structural genomics, RRM 99.43
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.43
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.43
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.42
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.42
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.42
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.42
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.42
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.42
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.42
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.42
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.42
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.42
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.41
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.41
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.41
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.41
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.41
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.41
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.4
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.4
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.4
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.4
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.4
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.39
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.39
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.39
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.39
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.39
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.39
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.39
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.39
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.39
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.38
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.38
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.38
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.38
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.37
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.37
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.37
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.37
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.37
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.37
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.37
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.36
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.36
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.36
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.36
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.36
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.35
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.35
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.35
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.35
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.35
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.35
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.35
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.34
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.34
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.34
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.34
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.34
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.33
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.33
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.33
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.33
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.33
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.33
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.32
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.32
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.32
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.32
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.32
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.32
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.0
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.32
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.32
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.32
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.31
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.31
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.31
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.31
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.31
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.31
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.31
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.31
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.31
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.31
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.31
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.31
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.31
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.31
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.31
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.3
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.3
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.3
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.3
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.3
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.3
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.29
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.29
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.29
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.29
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.29
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.29
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.29
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.29
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.29
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.29
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.29
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.28
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.28
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.28
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.28
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.27
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.27
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.27
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.27
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.27
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.26
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.26
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.26
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.26
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.26
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.26
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.26
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.26
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.26
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.26
2dis_A109 Unnamed protein product; structural genomics, RRM 99.26
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.25
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.25
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.25
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.25
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.25
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.25
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.24
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.24
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.24
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.24
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.24
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.24
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.24
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.24
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.24
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.23
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.23
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.23
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.23
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.23
1x5p_A97 Negative elongation factor E; structure genomics, 99.23
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.23
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.23
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.23
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.22
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.22
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.22
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.22
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.22
1x5p_A97 Negative elongation factor E; structure genomics, 99.22
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.22
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.21
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.21
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.21
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.21
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.21
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.21
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.21
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.21
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.21
2div_A99 TRNA selenocysteine associated protein; structural 99.21
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.2
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.2
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.2
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.2
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.2
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.2
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.19
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.19
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.19
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.19
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.19
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.18
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.18
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.18
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.18
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.17
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.17
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.17
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.17
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.17
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.17
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.17
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.17
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.16
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.16
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.15
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.15
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.15
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.14
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.14
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.14
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.75
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.14
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.13
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.13
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.13
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.13
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.13
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.13
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.12
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.11
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.11
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.11
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.11
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.1
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.1
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.1
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.1
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.09
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.09
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.08
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.08
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.07
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.06
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.06
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.05
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.05
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.05
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.04
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.03
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.02
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.01
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.01
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.0
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.99
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.98
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.98
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.98
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.98
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.98
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.96
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.94
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.94
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.93
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.91
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.91
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.9
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.89
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.87
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.86
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.85
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.81
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.79
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.79
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.76
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.69
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.66
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.62
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.6
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.58
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.53
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.53
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.47
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.2
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.03
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.94
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.77
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.69
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.65
4eyt_A129 Telomerase associated protein P65; RNA, LA protein 97.57
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.55
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.4
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.22
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.16
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.59
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.06
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.01
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 95.88
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.79
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.66
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.64
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.19
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.0
2lsl_A137 Telomerase associated protein P65; LA protein, LAR 92.55
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 92.84
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 92.51
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 90.39
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 85.94
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 84.76
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 82.89
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
Probab=100.00  E-value=2.4e-45  Score=335.07  Aligned_cols=192  Identities=47%  Similarity=0.807  Sum_probs=167.3

Q ss_pred             CCCCCccchhHHHHHHHHHHHHHhCCCCCCCChhHHhhhccCCCeEehHHHHhhHHHHhccCcHHHHHHHHhhcCCceEE
Q psy5142          11 GNSGAEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIE   90 (410)
Q Consensus        11 ~~~~~~~~~~~~~~~i~~QlEfYfsd~Nl~~D~fl~~~~~~~~g~v~l~~l~~F~r~k~l~~d~~~i~~Al~~~~S~~le   90 (410)
                      |.+|...+++++..+|++||||||||+||++|+||+++|..++|||||++|++|+||+.|+.|.+.|+.||+.|....|+
T Consensus         1 ~~~~~~~~~~~~~~~i~~q~e~yfs~~nl~~D~fl~~~~~~~~g~V~l~~i~sF~r~k~l~~d~~~I~~Al~~S~~~~le   80 (193)
T 2voo_A            1 GSNGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELME   80 (193)
T ss_dssp             --------CHHHHHHHHHHHHHHTSTTTGGGCHHHHHHHHHTTTCEEHHHHTTSHHHHHHCCCHHHHHHHHHTCSSCCEE
T ss_pred             CCCCCcCCcHHHHHHHHHHhheecchhhcccCHHHHHHhcccCCcEEeHHHhhhhHHHHhcCCHHHHHHHHhhcccceEE
Confidence            45666788999999999999999999999999999999997689999999999999999999999999999944339999


Q ss_pred             EecCccceecCCCCCCCCCchhhhhhccceeeEeecCCCCCCHHHHHHHHhhccCCCCceEEEEEcccCccccccccccc
Q psy5142          91 VNEDGTKIRRNPEKELPTFDIDFVKDLIAQSLYVKYIPVDATLDDIKDFFKKNTSEDVKITNIIMRNYQDKLANQKKFKG  170 (410)
Q Consensus        91 vsed~~~vrR~~~~p~p~~~~~~~~~~~~rtv~V~~lp~~~t~~~L~~~F~~~~~~~G~I~~v~l~~~~~~~~~~~~~kG  170 (410)
                      |++++.+|||.+..|+|+.+++.+.+...++|||+|||+++|+++|+++|++|    |.|.+|+|+++..+     .++|
T Consensus        81 v~ed~~~vrR~~~~p~p~~~~~~~~~~~~~~l~V~nLp~~~t~~~L~~~F~~~----G~v~~v~i~~~~~~-----~~kG  151 (193)
T 2voo_A           81 ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDK----GQVLNIQMRRTLHK-----AFKG  151 (193)
T ss_dssp             ECTTSSEEEECTTSCCCCCCHHHHHHHHHTEEEEECCCTTCCHHHHHHHHTTS----CCEEEEEEEECTTC-----CEEE
T ss_pred             EecccceEEecccCCCcccchhhhhccccCEEEecCCCCcCCHHHHHHHHhcC----CCEEEEEEEECCCC-----Cccc
Confidence            99999999999878899887777778889999999999999999999999999    99999999998765     8999


Q ss_pred             EEEEEecCHHHHHHHHHhcCCCCccccccccchhhhhhhhcccccccccCcccccchhhhchHHHHHHHH
Q psy5142         171 SIFVTFDNKENAEKFLNENKDKNLKFNENCEHKNAEKFLNENKDKNLKFNENCEHSLLIKWQQEYHEEKK  240 (410)
Q Consensus       171 ~afVeF~~~e~A~~Al~~~~g~~~~~~~~~~~~~~~k~~~~~~~~~~~~~g~~~~~L~v~~k~~~~~~k~  240 (410)
                      ||||+|.+.++|++|++..+   ..+                       .|   +.|.|.|+.+|.++|+
T Consensus       152 ~aFVeF~~~e~A~~A~~~~~---~~~-----------------------~G---r~l~V~~~~~y~~~K~  192 (193)
T 2voo_A          152 SIFVVFDSIESAKKFVETPG---QKY-----------------------KE---TDLLILFKDDYFAKKN  192 (193)
T ss_dssp             EEEEEESSHHHHHHHHHCTT---CEE-----------------------TT---EECEEEETTTC-----
T ss_pred             EEEEEECCHHHHHHHHHhCC---CeE-----------------------CC---EEEEEEEhHHHHHHhc
Confidence            99999999999999998876   567                       88   9999999999987653



>2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 Back     alignment and structure
>1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>4eyt_A Telomerase associated protein P65; RNA, LA protein, LARP7, RRM, XRRM, RNA binding protein; 2.50A {Tetrahymena thermophila} PDB: 4erd_A Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lsl_A Telomerase associated protein P65; LA protein, LARP7, RRM, RNA BI protein; NMR {Tetrahymena thermophila} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 410
d1zh5a199 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal 3e-30
d1s29a_92 a.4.5.46 (A:) Lupus La autoantigen N-terminal doma 6e-25
d2cqka188 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Hu 1e-24
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-04
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 7e-04
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 0.004
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 0.004
>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: La domain
domain: Lupus La autoantigen N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  110 bits (276), Expect = 3e-30
 Identities = 52/94 (55%), Positives = 70/94 (74%)

Query: 14  GAEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTE 73
           G   +++ LE +I  QIEYYF D NL RDKFL+ +IK D+GWV L  M+KF RL ++TT+
Sbjct: 1   GDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTD 60

Query: 74  AKVIVDALKKSTSKLIEVNEDGTKIRRNPEKELP 107
             VIV+AL KS ++L+E++ED TKIRR+P K LP
Sbjct: 61  FNVIVEALSKSKAELMEISEDKTKIRRSPSKPLP 94


>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Length = 92 Back     information, alignment and structure
>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query410
d1zh5a199 Lupus La autoantigen N-terminal domain {Human (Hom 99.97
d1s29a_92 Lupus La autoantigen N-terminal domain {Trypanosom 99.97
d2cqka188 La-related protein 4 LARP4 {Human (Homo sapiens) [ 99.95
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.91
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.79
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.71
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.61
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.61
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.61
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.61
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.6
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.6
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.6
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.6
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.59
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.59
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.59
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.59
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.59
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.57
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.57
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.56
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.56
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.56
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.56
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.56
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.55
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.55
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.55
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.55
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.54
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.54
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.53
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.53
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.52
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.52
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.52
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.51
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.51
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.51
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.51
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.49
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.49
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.49
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.49
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.49
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.48
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.48
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.46
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.45
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.45
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.44
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.44
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.43
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.42
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.41
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.41
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.41
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.41
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.4
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.4
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.4
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.4
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.4
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.39
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.39
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.39
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.38
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.38
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.38
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.38
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.38
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.38
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.37
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.37
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.36
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.36
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.36
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.36
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.36
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.36
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.35
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.35
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.35
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.35
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.35
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.34
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.34
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.34
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.34
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.34
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.33
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.33
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.33
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.33
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.33
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.33
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.33
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.33
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.33
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.32
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.32
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.32
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.31
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.31
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.31
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.31
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.31
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.31
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.3
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.3
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.3
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.29
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.29
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.29
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.29
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.29
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.29
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.29
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.28
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.28
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.28
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.27
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.27
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.27
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.26
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.26
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.25
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.25
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.25
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.25
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.25
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.24
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.24
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.24
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.24
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.24
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.24
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.23
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.23
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.22
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.22
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.21
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.2
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.2
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.2
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.19
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.19
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.17
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.16
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.15
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.15
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.13
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.13
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.13
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.12
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.1
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.1
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.09
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.09
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.08
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.07
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.06
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.05
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.03
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.02
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.0
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.94
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.86
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.83
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.75
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.69
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.64
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.55
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.51
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.34
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 95.93
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 95.6
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.25
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 89.55
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 85.57
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 80.32
>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: La domain
domain: Lupus La autoantigen N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=2.3e-32  Score=217.66  Aligned_cols=96  Identities=53%  Similarity=0.892  Sum_probs=88.9

Q ss_pred             CccchhHHHHHHHHHHHHHhCCCCCCCChhHHhhhccCCCeEehHHHHhhHHHHhccCcHHHHHHHHhhcCCceEEEecC
Q psy5142          15 AEAEVSKLENQIIEQIEYYFSDINLARDKFLQGEIKKDDGWVELTTMLKFARLAKMTTEAKVIVDALKKSTSKLIEVNED   94 (410)
Q Consensus        15 ~~~~~~~~~~~i~~QlEfYfsd~Nl~~D~fl~~~~~~~~g~v~l~~l~~F~r~k~l~~d~~~i~~Al~~~~S~~levsed   94 (410)
                      +..+++++.++|++||||||||+||++|+||+++|..++|||||++|++|+|||+|+.|++.|++||+.|.+..|+|++|
T Consensus         2 ~n~~~~~l~~~I~~QvEfYFSd~NL~~D~fL~~~m~~~eG~Vpl~~i~~F~r~k~l~~~~~~i~~Al~~S~~~~lev~~d   81 (99)
T d1zh5a1           2 DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISED   81 (99)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTSTTTGGGCHHHHHHHTTTTTCEEHHHHTTSHHHHHHCCCHHHHHHHHHTCSSCCEEECTT
T ss_pred             CchHHHHHHHHHHHHHHHhcCHhhhccCHHHHHHHhcCCCcccHHHHhcchHHHHHcCCHHHHHHHHHhCCCCeEEEcCC
Confidence            34568999999999999999999999999999999987899999999999999999999999999999666668999999


Q ss_pred             ccceecCCCCCCCCCc
Q psy5142          95 GTKIRRNPEKELPTFD  110 (410)
Q Consensus        95 ~~~vrR~~~~p~p~~~  110 (410)
                      +++|||++..|+|+.+
T Consensus        82 ~~~vRR~~~~plpe~~   97 (99)
T d1zh5a1          82 KTKIRRSPSKPLPEVT   97 (99)
T ss_dssp             SSEEEECTTSCCCCCC
T ss_pred             CceeCCCCCCCCCCcc
Confidence            9999999878999764



>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure