Psyllid ID: psy5157

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MTDLLATCIDVLNSDAKFNQNRSRQSRGIAEQTNSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIHSFHPTSIALIYSTK
ccHHHHHHHHHHHHcHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHcccccEEEcccccccccEEEEEEEccEEEEEEcccccccccccccccccccHHHHHHcccc
cccccccHHHHHcccHHHHHHHHHHHHccccccccccccccccHHHHHHHccccccccccHHHHHHHHcHHHcEEEEcccccccEEEEEEEEccEEEEEEEEccccHHHccHHHHHHHHccccEEEEcc
MTDLLATCIDVLnsdakfnqnrsrqsrgiaEQTNSHLnlmtqdvpvldnivpydtttpydmHQIIYNVidereffeiQPKYAKNIIVGFARinghsvgivanqpkvaagkwtfihsfhptsiALIYSTK
MTDLLATCIDvlnsdakfnqnrsrQSRGIAEQTNSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIhsfhptsialiystk
MTDLLATCIDVLNSDAKFNQNRSRQSRGIAEQTNSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIHSFHPTSIALIYSTK
****LATCIDVL************************LNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIHSFHPTSIALIY***
*TDLLATCIDVLNSDAKFNQNRSRQSRGIAE**NSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIHSFHPTSIALIYS**
MTDLLATCIDVLNSDAKFNQNRSRQSRGIAEQTNSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIHSFHPTSIALIYSTK
*****ATCIDVLNSDAKFNQNRSRQSRGIAEQTNSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIHSFHPTSIALIYSTK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDLLATCIDVLNSDAKFNQNRSRQSRGIAEQTNSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIHSFHPTSIALIYSTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
P79384 539 Propionyl-CoA carboxylase yes N/A 0.511 0.122 0.681 9e-22
P05166 539 Propionyl-CoA carboxylase yes N/A 0.511 0.122 0.696 2e-21
Q2TBR0 539 Propionyl-CoA carboxylase yes N/A 0.511 0.122 0.696 4e-21
Q99MN9 541 Propionyl-CoA carboxylase yes N/A 0.511 0.121 0.651 4e-20
P07633 541 Propionyl-CoA carboxylase yes N/A 0.511 0.121 0.636 6e-20
P54541 507 Putative propionyl-CoA ca yes N/A 0.527 0.134 0.529 1e-16
P96885 548 Probable propionyl-CoA ca yes N/A 0.542 0.127 0.527 9e-15
O31825 511 Uncharacterized carboxyla no N/A 0.488 0.123 0.507 5e-14
P53002 549 Probable propionyl-CoA ca yes N/A 0.550 0.129 0.486 6e-14
P53003 546 Propionyl-CoA carboxylase yes N/A 0.488 0.115 0.492 2e-12
>sp|P79384|PCCB_PIG Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa GN=PCCB PE=2 SV=1 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%)

Query: 44  VPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQ 103
           VP LD +VP ++T  YDM  IIY+++DER+FFEI P YAKNIIVGFAR+NG +VGIV NQ
Sbjct: 299 VPELDTVVPLESTRAYDMVDIIYSIVDERDFFEIMPNYAKNIIVGFARMNGRTVGIVGNQ 358

Query: 104 PKVAAG 109
           PKVA+G
Sbjct: 359 PKVASG 364

Sus scrofa (taxid: 9823)
EC: 6EC: .EC: 4EC: .EC: 1EC: .EC: 3
>sp|P05166|PCCB_HUMAN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=PCCB PE=1 SV=3 Back     alignment and function description
>sp|Q2TBR0|PCCB_BOVIN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Bos taurus GN=PCCB PE=2 SV=1 Back     alignment and function description
>sp|Q99MN9|PCCB_MOUSE Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Pccb PE=1 SV=2 Back     alignment and function description
>sp|P07633|PCCB_RAT Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Pccb PE=2 SV=1 Back     alignment and function description
>sp|P54541|PCCB_BACSU Putative propionyl-CoA carboxylase beta chain OS=Bacillus subtilis (strain 168) GN=yqjD PE=3 SV=2 Back     alignment and function description
>sp|P96885|PCC5_MYCTU Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis GN=accD5 PE=1 SV=1 Back     alignment and function description
>sp|O31825|YNGE_BACSU Uncharacterized carboxylase YngE OS=Bacillus subtilis (strain 168) GN=yngE PE=3 SV=2 Back     alignment and function description
>sp|P53002|PCCB_MYCLE Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium leprae (strain TN) GN=accD5 PE=3 SV=1 Back     alignment and function description
>sp|P53003|PCCB_SACEN Propionyl-CoA carboxylase beta chain OS=Saccharopolyspora erythraea (strain NRRL 23338) GN=pccB PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
417402493 539 Putative 3-methylcrotonyl-coa carboxylas 0.511 0.122 0.727 7e-21
194221630 539 PREDICTED: propionyl-CoA carboxylase bet 0.511 0.122 0.696 1e-20
403278849 539 PREDICTED: propionyl-CoA carboxylase bet 0.511 0.122 0.696 2e-20
147904714 541 propionyl CoA carboxylase, beta polypept 0.511 0.121 0.681 2e-20
403278855 520 PREDICTED: propionyl-CoA carboxylase bet 0.511 0.126 0.696 2e-20
38511450 541 MGC68650 protein [Xenopus laevis] 0.511 0.121 0.681 2e-20
321457584 538 hypothetical protein DAPPUDRAFT_301272 [ 0.527 0.126 0.705 2e-20
403278857 482 PREDICTED: propionyl-CoA carboxylase bet 0.511 0.136 0.696 2e-20
344296674 545 PREDICTED: propionyl-CoA carboxylase bet 0.511 0.121 0.696 2e-20
403278859 447 PREDICTED: propionyl-CoA carboxylase bet 0.511 0.147 0.696 2e-20
>gi|417402493|gb|JAA48093.1| Putative 3-methylcrotonyl-coa carboxylase non-biotin [Desmodus rotundus] Back     alignment and taxonomy information
 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 48/66 (72%), Positives = 55/66 (83%)

Query: 44  VPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQ 103
           VP LD IVP ++T  YDM  IIY+V+DEREFFEI P YAKNIIVGFAR+NG +VGIV NQ
Sbjct: 299 VPELDTIVPLESTKAYDMVDIIYSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQ 358

Query: 104 PKVAAG 109
           PKVA+G
Sbjct: 359 PKVASG 364

Source: Desmodus rotundus

Species: Desmodus rotundus

Genus: Desmodus

Family: Phyllostomidae

Order: Chiroptera

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|194221630|ref|XP_001496430.2| PREDICTED: propionyl-CoA carboxylase beta chain, mitochondrial [Equus caballus] Back     alignment and taxonomy information
>gi|403278849|ref|XP_003930995.1| PREDICTED: propionyl-CoA carboxylase beta chain, mitochondrial isoform 1 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|147904714|ref|NP_001083656.1| propionyl CoA carboxylase, beta polypeptide [Xenopus laevis] gi|62740260|gb|AAH94074.1| MGC68650 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|403278855|ref|XP_003930998.1| PREDICTED: propionyl-CoA carboxylase beta chain, mitochondrial isoform 4 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|38511450|gb|AAH61665.1| MGC68650 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|321457584|gb|EFX68668.1| hypothetical protein DAPPUDRAFT_301272 [Daphnia pulex] Back     alignment and taxonomy information
>gi|403278857|ref|XP_003930999.1| PREDICTED: propionyl-CoA carboxylase beta chain, mitochondrial isoform 5 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|344296674|ref|XP_003420030.1| PREDICTED: propionyl-CoA carboxylase beta chain, mitochondrial [Loxodonta africana] Back     alignment and taxonomy information
>gi|403278859|ref|XP_003931000.1| PREDICTED: propionyl-CoA carboxylase beta chain, mitochondrial isoform 6 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
UNIPROTKB|P79384 539 PCCB "Propionyl-CoA carboxylas 0.511 0.122 0.681 3.9e-20
UNIPROTKB|F8WBI9405 PCCB "Propionyl-CoA carboxylas 0.511 0.162 0.696 5e-20
UNIPROTKB|E9PEC3 423 PCCB "Propionyl-CoA carboxylas 0.511 0.156 0.696 6.2e-20
ZFIN|ZDB-GENE-040426-2467 558 pccb "propionyl Coenzyme A car 0.511 0.118 0.651 7e-20
UNIPROTKB|E7ETT4 482 PCCB "Propionyl-CoA carboxylas 0.511 0.136 0.696 9.9e-20
UNIPROTKB|E7EUY3 516 PCCB "Propionyl-CoA carboxylas 0.511 0.127 0.696 1.2e-19
UNIPROTKB|E7ETT1 520 PCCB "Propionyl-CoA carboxylas 0.511 0.126 0.696 1.2e-19
UNIPROTKB|P05166 539 PCCB "Propionyl-CoA carboxylas 0.511 0.122 0.696 1.4e-19
UNIPROTKB|E9PDR0 550 PCCB "Propionyl-CoA carboxylas 0.511 0.12 0.696 1.4e-19
UNIPROTKB|F1PTU4 554 PCCB "Uncharacterized protein" 0.511 0.119 0.696 1.5e-19
UNIPROTKB|P79384 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 3.9e-20, P = 3.9e-20
 Identities = 45/66 (68%), Positives = 55/66 (83%)

Query:    44 VPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQ 103
             VP LD +VP ++T  YDM  IIY+++DER+FFEI P YAKNIIVGFAR+NG +VGIV NQ
Sbjct:   299 VPELDTVVPLESTRAYDMVDIIYSIVDERDFFEIMPNYAKNIIVGFARMNGRTVGIVGNQ 358

Query:   104 PKVAAG 109
             PKVA+G
Sbjct:   359 PKVASG 364
GO:0005759 "mitochondrial matrix" evidence=IEA
GO:0004658 "propionyl-CoA carboxylase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|F8WBI9 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PEC3 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2467 pccb "propionyl Coenzyme A carboxylase, beta polypeptide" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETT4 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EUY3 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETT1 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P05166 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PDR0 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTU4 PCCB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P05166PCCB_HUMAN6, ., 4, ., 1, ., 30.69690.51160.1224yesN/A
Q2TBR0PCCB_BOVIN6, ., 4, ., 1, ., 30.69690.51160.1224yesN/A
Q99MN9PCCB_MOUSE6, ., 4, ., 1, ., 30.65150.51160.1219yesN/A
P54541PCCB_BACSU6, ., 4, ., 1, ., 30.52940.52710.1341yesN/A
P79384PCCB_PIG6, ., 4, ., 1, ., 30.68180.51160.1224yesN/A
P07633PCCB_RAT6, ., 4, ., 1, ., 30.63630.51160.1219yesN/A
P96885PCC5_MYCTU6, ., 4, ., 1, ., 30.52770.54260.1277yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
COG4799 526 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyl 1e-30
pfam01039 487 pfam01039, Carboxyl_trans, Carboxyl transferase do 1e-28
TIGR01117 512 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase a 3e-24
PLN02820 569 PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxyla 1e-10
>gnl|CDD|227136 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information 
 Score =  113 bits (286), Expect = 1e-30
 Identities = 34/69 (49%), Positives = 46/69 (66%)

Query: 43  DVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVAN 102
           D   LD+IVP D   PYD+ ++I  ++D+ EF E +  YAKNI+ GFARI+G  VGI+AN
Sbjct: 272 DDEELDSIVPDDPRKPYDVREVIARLVDDGEFLEFKAGYAKNIVTGFARIDGRPVGIIAN 331

Query: 103 QPKVAAGKW 111
           QP+   G  
Sbjct: 332 QPRHLGGVL 340

Length = 526
>gnl|CDD|216259 pfam01039, Carboxyl_trans, Carboxyl transferase domain Back     alignment and domain information
>gnl|CDD|130187 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|178415 PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase compon 100.0
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 99.96
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 99.95
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 99.94
KOG0540|consensus 536 99.94
PRK05654 292 acetyl-CoA carboxylase subunit beta; Validated 99.63
PRK05724 319 acetyl-CoA carboxylase carboxyltransferase subunit 99.58
TIGR00515 285 accD acetyl-CoA carboxylase, carboxyl transferase, 99.58
TIGR00513 316 accA acetyl-CoA carboxylase, carboxyl transferase, 99.56
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 99.54
PRK12319 256 acetyl-CoA carboxylase subunit alpha; Provisional 99.45
TIGR03133 274 malonate_beta malonate decarboxylase, beta subunit 99.42
PRK07189 301 malonate decarboxylase subunit beta; Reviewed 99.35
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 99.35
CHL00174 296 accD acetyl-CoA carboxylase beta subunit; Reviewed 99.34
PLN03230 431 acetyl-coenzyme A carboxylase carboxyl transferase 99.32
CHL00198 322 accA acetyl-CoA carboxylase carboxyltransferase al 99.31
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 99.26
TIGR03134 238 malonate_gamma malonate decarboxylase, gamma subun 99.25
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase compon 99.23
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 99.12
KOG0368|consensus 2196 98.97
COG0777 294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 98.79
KOG0540|consensus 536 98.76
PF03255145 ACCA: Acetyl co-enzyme A carboxylase carboxyltrans 98.2
COG0825 317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 97.16
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=8.1e-34  Score=247.47  Aligned_cols=124  Identities=31%  Similarity=0.481  Sum_probs=116.8

Q ss_pred             hhhHHhhhhccc--chhccccee-----cCCCCCCcccCCCCCCCCcccccccccCCCCCCCCHHHHHhhcccCCceEEe
Q psy5157           5 LATCIDVLNSDA--KFNQNRSRQ-----SRGIAEQTNSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEI   77 (129)
Q Consensus         5 ~~~~~d~~~~~~--~~~~~r~~~-----~~~~~~p~~~~~d~~~~~~~~L~~ivP~~~~~~yD~revI~~l~D~~sF~El   77 (129)
                      .|++.|+++.||  +++.+|+++     +....+|..++.++|.+++++|++++|.+++++|||||+|.+|+|.++|+|+
T Consensus       227 ~sGva~~~a~dd~~Ai~~vr~~lsylp~~~~~~~p~~~~~~~~~~~~~~l~~ivP~d~~~pYDvrevI~rl~D~~~F~E~  306 (526)
T COG4799         227 KSGVADLLAEDDEDAIELVRRLLSYLPSNNREPPPVVPTPDEPDRDDEELDSIVPDDPRKPYDVREVIARLVDDGEFLEF  306 (526)
T ss_pred             cccceeeeecCHHHHHHHHHHHHHhcCccCCCCCCcCCCCCCcccChhhhcccCCCCCCccccHHHHHHHhcCCccHHHH
Confidence            479999999999  899999998     3356667667889999999999999999999999999999999999999999


Q ss_pred             ccCCCCeEEEEEEEECCEEEEEEeeCCCccCcccChhhhhHHHHHHHhhcC
Q psy5157          78 QPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIHSFHPTSIALIYST  128 (129)
Q Consensus        78 ~~~yG~~vvtG~arI~G~~VGvvAnd~~~~gG~l~~~~a~K~arfv~l~~~  128 (129)
                      ++.||+++|||||||+|+|||||||||+++||+|+.++|+|++||++||+.
T Consensus       307 ~~~~a~~iV~GfaRi~G~pVGiIANqp~~~~G~l~~~sa~KaArFI~~cd~  357 (526)
T COG4799         307 KAGYAKNIVTGFARIDGRPVGIIANQPRHLGGVLDIDSADKAARFIRLCDA  357 (526)
T ss_pred             HhhhCcceEEEEEEECCEEEEEEecCccccccccchHHHHHHHHHHHhhhc
Confidence            999999999999999999999999999999999999999999999999963

>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>KOG0540|consensus Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>KOG0540|consensus Back     alignment and domain information
>PF03255 ACCA: Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit; InterPro: IPR001095 This entry contains the alpha subunit the acetyl coenzyme A carboxylase complex (6 Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
3n6r_B 531 Crystal Structure Of The Holoenzyme Of Propionyl-co 1e-17
3ib9_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422l Lengt 1e-16
3iav_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422v Lengt 1e-16
3ibb_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422a Lengt 1e-16
1xnw_A 530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 1e-16
1xnv_A 530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 1e-16
3mfm_C 530 Crystal Structures And Mutational Analyses Of Acyl- 1e-16
2bzr_A 548 Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Ca 7e-16
2a7s_A 548 Crystal Structure Of The Acyl-Coa Carboxylase, Accd 7e-16
1vrg_A 527 Crystal Structure Of Propionyl-coa Carboxylase, Bet 8e-16
1x0u_A 522 Crystal Structure Of The Carboxyl Transferase Subun 2e-15
1on3_A 523 Transcarboxylase 12s Crystal Structure: Hexamer Ass 9e-13
3gf3_A 588 Glutaconyl-Coa Decarboxylase A Subunit From Clostri 2e-07
3u9r_B 555 Crystal Structure Of P. Aeruginosa 3-methylcrotonyl 6e-07
1pix_A 587 Crystal Structure Of The Carboxyltransferase Subuni 1e-05
>pdb|3N6R|B Chain B, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 531 Back     alignment and structure 
Iteration: 1

 Score = 84.3 bits (207), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%)
Query: 45  PVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQP 104
           P LD +VP +  TPYDM ++I+ + DE +F+EIQ ++AKNII GF R+ G +VG+VANQP
Sbjct: 288 PSLDTLVPDNPNTPYDMKELIHKLADEGDFYEIQEEFAKNIITGFIRLEGRTVGVVANQP 347
Query: 105 KVAAG 109
            V AG
Sbjct: 348 LVLAG 352
>pdb|3IB9|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422l Length = 530 Back     alignment and structure
>pdb|3IAV|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422v Length = 530 Back     alignment and structure
>pdb|3IBB|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422a Length = 530 Back     alignment and structure
>pdb|1XNW|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #2, Mutant D422i Length = 530 Back     alignment and structure
>pdb|1XNV|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #1 Length = 530 Back     alignment and structure
>pdb|3MFM|C Chain C, Crystal Structures And Mutational Analyses Of Acyl-Coa Carboxylase Subunit Of Streptomyces Coelicolor Length = 530 Back     alignment and structure
>pdb|2BZR|A Chain A, Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Carboxylase Beta-Subunit From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>pdb|2A7S|A Chain A, Crystal Structure Of The Acyl-Coa Carboxylase, Accd5, From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>pdb|1VRG|A Chain A, Crystal Structure Of Propionyl-coa Carboxylase, Beta Subunit (tm0716) From Thermotoga Maritima At 2.30 A Resolution Length = 527 Back     alignment and structure
>pdb|1X0U|A Chain A, Crystal Structure Of The Carboxyl Transferase Subunit Of Putative Pcc Of Sulfolobus Tokodaii Length = 522 Back     alignment and structure
>pdb|1ON3|A Chain A, Transcarboxylase 12s Crystal Structure: Hexamer Assembly And Substrate Binding To A Multienzyme Core (With Methylmalonyl-Coenzyme A And Methylmalonic Acid Bound) Length = 523 Back     alignment and structure
>pdb|3GF3|A Chain A, Glutaconyl-Coa Decarboxylase A Subunit From Clostridium Symbiosum Co-Crystallized With Glutaconyl-Coa Length = 588 Back     alignment and structure
>pdb|3U9R|B Chain B, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc), Beta Subunit Length = 555 Back     alignment and structure
>pdb|1PIX|A Chain A, Crystal Structure Of The Carboxyltransferase Subunit Of The Bacterial Ion Pump Glutaconyl-Coenzyme A Decarboxylase Length = 587 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 1e-36
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 8e-36
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 1e-35
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 1e-35
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 3e-35
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 9e-35
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 1e-26
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 1e-26
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 4e-26
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 1e-23
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 1e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Length = 530 Back     alignment and structure
 Score =  129 bits (327), Expect = 1e-36
 Identities = 37/69 (53%), Positives = 45/69 (65%)

Query: 41  TQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIV 100
           T +   LD IVP     PYDMH +I +V+D+ EFFE QP +A NI+ GF R+ G  VGIV
Sbjct: 278 TDEDAELDTIVPDSANQPYDMHSVIEHVLDDAEFFETQPLFAPNILTGFGRVEGRPVGIV 337

Query: 101 ANQPKVAAG 109
           ANQP   AG
Sbjct: 338 ANQPMQFAG 346
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Length = 522 Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Length = 531 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Length = 523 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Length = 548 Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Length = 527 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Length = 587 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Length = 588 Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Length = 793 Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Length = 555 Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Length = 758 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 99.96
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 99.95
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 99.95
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 99.95
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 99.94
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 99.94
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 99.93
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 99.93
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 99.93
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 99.91
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 99.9
2f9i_B 285 Acetyl-coenzyme A carboxylase carboxyl transferase 99.79
2f9i_A 327 Acetyl-coenzyme A carboxylase carboxyl transferase 99.63
2f9y_B 304 Acetyl-coenzyme A carboxylase carboxyl transferas 99.61
2f9y_A 339 Acetyl-COA carboxylase, carboxyltransferase alpha; 99.61
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 99.48
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 99.48
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 99.37
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 99.37
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 99.37
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 99.35
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 99.34
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 99.32
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 99.3
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 98.33
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 97.36
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
Probab=99.96  E-value=1.2e-29  Score=220.98  Aligned_cols=124  Identities=31%  Similarity=0.480  Sum_probs=115.2

Q ss_pred             hhhhHHhhhhccc--chhccccee---c--CCCCCCcccCCCCCCCCcccccccccCCCCCCCCHHHHHhhcccCCceEE
Q psy5157           4 LLATCIDVLNSDA--KFNQNRSRQ---S--RGIAEQTNSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFE   76 (129)
Q Consensus         4 ~~~~~~d~~~~~~--~~~~~r~~~---~--~~~~~p~~~~~d~~~~~~~~L~~ivP~~~~~~yD~revI~~l~D~~sF~E   76 (129)
                      ..++++|+++.+|  |++++|++|   |  +...||..++.|+|.++.++|++++|.+.+++||+|++|++|+|+++|+|
T Consensus       240 ~~sG~~d~v~~~e~~a~~~~r~lls~Lp~~~~~~~p~~~~~d~~~~~~~~l~~ivp~~~~~pyd~r~vI~~l~D~~~f~E  319 (531)
T 3n6r_B          240 RKSSVADAAFENDVEALAEVRRLVDFLPLNNREKPPVRPFFDDPDRIEPSLDTLVPDNPNTPYDMKELIHKLADEGDFYE  319 (531)
T ss_dssp             HTTSCCSEEESSHHHHHHHHHHHHTTSCSSSSSCCCBCCCCSCTTCCCGGGGGTSCSSTTCCCCHHHHHHHHSTTSCCEE
T ss_pred             hccCcceEEeCCHHHHHHHHHHHHHhccccCCCCCCCCCCCCCcccChHHHHhhCCCCcCCCcCHHHHHHhccCCcceEE
Confidence            3689999999997  899999988   2  23456777778889999999999999999999999999999999999999


Q ss_pred             eccCCCCeEEEEEEEECCEEEEEEeeCCCccCcccChhhhhHHHHHHHhhc
Q psy5157          77 IQPKYAKNIIVGFARINGHSVGIVANQPKVAAGKWTFIHSFHPTSIALIYS  127 (129)
Q Consensus        77 l~~~yG~~vvtG~arI~G~~VGvvAnd~~~~gG~l~~~~a~K~arfv~l~~  127 (129)
                      +++.||+++|||||||+|++|||||||+.+++|++++++++|++||+++|+
T Consensus       320 ~~~~~~~~iV~G~arl~G~~Vgvian~~~~~~G~l~~~~a~Kaarfi~lcd  370 (531)
T 3n6r_B          320 IQEEFAKNIITGFIRLEGRTVGVVANQPLVLAGCLDIDSSRKAARFVRFCD  370 (531)
T ss_dssp             ESTTSSTTEEEEEEEETTEEEEEEEECTTTGGGCBCHHHHHHHHHHHHHHH
T ss_pred             ecccCCCcEEEEEEEECCEEEEEEEecccccCCCCCHHHHHHHHHHHHHhh
Confidence            999999999999999999999999999999999999999999999999996
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1uyra2 404 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxyla 5e-21
d1pixa3 299 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase 3e-20
d1xnya2 263 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase com 2e-17
d2a7sa2 271 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase com 7e-17
d1on3a2 264 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltra 1e-16
d1vrga2 264 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase com 2e-13
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 404 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Biotin dependent carboxylase carboxyltransferase domain
domain: Acetyl-coenzyme A carboxylase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 84.6 bits (209), Expect = 5e-21
 Identities = 17/76 (22%), Positives = 31/76 (40%), Gaps = 11/76 (14%)

Query: 47  LDNIVPYDTTTPYDMHQII----------YNVIDEREFFEIQPKYAKNIIVGFARINGHS 96
             +  P      YD+  +I          Y + D+  FFE    +AK ++VG AR+ G  
Sbjct: 16  PVDFTP-TNDETYDVRWMIEGRETESGFEYGLFDKGSFFETLSGWAKGVVVGRARLGGIP 74

Query: 97  VGIVANQPKVAAGKWT 112
           +G++  + +       
Sbjct: 75  LGVIGVETRTVENLIP 90
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Length = 299 Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Length = 263 Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 271 Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Length = 264 Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1vrga2 264 Propionyl-CoA carboxylase complex B subunit, PccB 99.96
d1on3a2 264 Methylmalonyl-CoA carboxyltransferase (transcarbox 99.96
d2a7sa2 271 Propionyl-CoA carboxylase complex B subunit, PccB 99.95
d1pixa3 299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 99.95
d1xnya2 263 Propionyl-CoA carboxylase complex B subunit, PccB 99.95
d1uyra2 404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 99.89
d1pixa2 287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 99.69
d1vrga1 251 Propionyl-CoA carboxylase complex B subunit, PccB 99.56
d1xnya1 258 Propionyl-CoA carboxylase complex B subunit, PccB 99.55
d1on3a1 253 Methylmalonyl-CoA carboxyltransferase (transcarbox 99.5
d2a7sa1 258 Propionyl-CoA carboxylase complex B subunit, PccB 99.48
d2f9yb1 263 Acetyl-coenzyme A carboxylase carboxyl transferase 99.42
d2f9ya1 316 Acetyl-coenzyme A carboxylase carboxyl transferase 98.85
d1uyra1 333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 98.15
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Biotin dependent carboxylase carboxyltransferase domain
domain: Propionyl-CoA carboxylase complex B subunit, PccB
species: Thermotoga maritima [TaxId: 2336]

Probab=99.96  E-value=3.1e-30  Score=205.78  Aligned_cols=99  Identities=35%  Similarity=0.556  Sum_probs=92.8

Q ss_pred             CCCCcccCCCCCCCCcccccccccCCCCCCCCHHHHHhhcccCCceEEeccCCCCeEEEEEEEECCEEEEEEeeCCCccC
Q psy5157          29 IAEQTNSHLNLMTQDVPVLDNIVPYDTTTPYDMHQIIYNVIDEREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAA  108 (129)
Q Consensus        29 ~~~p~~~~~d~~~~~~~~L~~ivP~~~~~~yD~revI~~l~D~~sF~El~~~yG~~vvtG~arI~G~~VGvvAnd~~~~g  108 (129)
                      +.||..+ .++|.+..++|++++|.+.+++||||++|++|+|+++|+|+++.||+++|||||||+|++|||||||+.++|
T Consensus         2 e~pp~~~-~~~p~~~~~~l~~~iP~~~~~~yd~r~~i~~i~D~~~~~E~~~~~~~~~v~g~~r~~G~~vgvian~~~~~~   80 (264)
T d1vrga2           2 EEPPVED-PDTSLETPEDILDILPDNPNKGYDVRDVIKRVVDHGEFFEVQPYFAKNIVIGFARIQGKTVGIVANQPSVLA   80 (264)
T ss_dssp             SCCCBCS-CCCCCCCCGGGGGSSCSSTTSCCCTHHHHHHHSGGGCCEEESTTSSTTEEEEEEEETTEEEEEEEECTTSGG
T ss_pred             CCCCCCC-CCCcccChHHHhccCCCCCCCCCcHHHHHHHhCcCceeeeecCCCCCCeEEEEEEecCceEEEEeccccccc
Confidence            4577644 566778889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccChhhhhHHHHHHHhhcC
Q psy5157         109 GKWTFIHSFHPTSIALIYST  128 (129)
Q Consensus       109 G~l~~~~a~K~arfv~l~~~  128 (129)
                      |+|+.++++|++||++||+.
T Consensus        81 G~~~~~~a~Kaa~fi~lc~~  100 (264)
T d1vrga2          81 GVLDIDSSDKAARFIRFLDA  100 (264)
T ss_dssp             GCBCHHHHHHHHHHHHHHHH
T ss_pred             cchhhhhHHHHHHHHHHHHH
Confidence            99999999999999999963
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure