Psyllid ID: psy5201
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 244 | ||||||
| 291226784 | 241 | PREDICTED: heat shock 40kD protein 2-lik | 0.75 | 0.759 | 0.293 | 3e-14 | |
| 157128319 | 206 | hypothetical protein AaeL_AAEL011082 [Ae | 0.688 | 0.815 | 0.321 | 3e-14 | |
| 157128317 | 214 | hypothetical protein AaeL_AAEL011082 [Ae | 0.639 | 0.728 | 0.324 | 8e-14 | |
| 158284554 | 210 | Anopheles gambiae str. PEST AGAP012747-P | 0.700 | 0.814 | 0.314 | 1e-13 | |
| 157110135 | 214 | hypothetical protein AaeL_AAEL015218 [Ae | 0.639 | 0.728 | 0.319 | 2e-13 | |
| 300813384 | 310 | DnaJ domain protein [Peptoniphilus sp. o | 0.5 | 0.393 | 0.344 | 3e-13 | |
| 357617592 | 214 | DnaJ-like protein 13 [Danaus plexippus] | 0.762 | 0.869 | 0.295 | 5e-13 | |
| 47225277 | 234 | unnamed protein product [Tetraodon nigro | 0.782 | 0.816 | 0.254 | 5e-13 | |
| 282881947 | 310 | chaperone protein DnaJ [Peptoniphilus la | 0.5 | 0.393 | 0.336 | 6e-13 | |
| 326428328 | 683 | molecular chaperone DnaJ [Salpingoeca sp | 0.278 | 0.099 | 0.514 | 2e-12 |
| >gi|291226784|ref|XP_002733359.1| PREDICTED: heat shock 40kD protein 2-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
Score = 84.7 bits (208), Expect = 3e-14, Method: Compositional matrix adjust.
Identities = 59/201 (29%), Positives = 104/201 (51%), Gaps = 18/201 (8%)
Query: 42 HYEILELERNCSPKEIRSAFIRLSKQFHPDKNPSNPALHDKFVKLNEAYSILNDMDRRRN 101
HY++L + +N S I+ A+ + SK HPD PS+P+ H KF++L AYS+L+ RR+
Sbjct: 36 HYDVLGISKNSSRDIIKEAYFKKSKLLHPDAKPSDPSQHQKFIELTNAYSVLSKPLSRRD 95
Query: 102 YDASLNLQTVRQNMF---VHKTRARSSYSDSGERPENWKDYYDFAAQMKRNESIHVPKFL 158
YD L LQ VR + + VH+T + +GE + DYY F+ N +H
Sbjct: 96 YD--LELQGVRVSPYRVHVHRTSTSHPFGSTGEYASH--DYYGFSNDP--NVGVH----Y 145
Query: 159 HKFETLSKATLVMLLIG----VATGALGLQILAVQYSKTFPRNVVNSREMEISQNLMNAR 214
+ + + K + + ++IG + ALG IL + Y F ++ R+ +IS+ +
Sbjct: 146 YGIKGIRKVSNMTIMIGCVILLVVSALGHFIL-LHYGAQFTARQLDERDRKISKIYSEVK 204
Query: 215 NDAKKYDLQENIDRFAKRYQE 235
A++ ++ ++ + Y+E
Sbjct: 205 RRARENGPKKQMELLRQNYEE 225
|
Source: Saccoglossus kowalevskii Species: Saccoglossus kowalevskii Genus: Saccoglossus Family: Harrimaniidae Order: Class: Enteropneusta Phylum: Hemichordata Superkingdom: Eukaryota |
| >gi|157128319|ref|XP_001661399.1| hypothetical protein AaeL_AAEL011082 [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157128317|ref|XP_001661398.1| hypothetical protein AaeL_AAEL011082 [Aedes aegypti] gi|108872643|gb|EAT36868.1| AAEL011082-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|158284554|ref|XP_307339.3| Anopheles gambiae str. PEST AGAP012747-PA [Anopheles gambiae str. PEST] gi|158299180|ref|XP_319298.3| AGAP010141-PA [Anopheles gambiae str. PEST] gi|157014242|gb|EAA14004.3| AGAP010141-PA [Anopheles gambiae str. PEST] gi|157021014|gb|EAA03148.3| AGAP012747-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|157110135|ref|XP_001650966.1| hypothetical protein AaeL_AAEL015218 [Aedes aegypti] gi|108868387|gb|EAT32612.1| AAEL015218-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|300813384|ref|ZP_07093735.1| DnaJ domain protein [Peptoniphilus sp. oral taxon 836 str. F0141] gi|300512527|gb|EFK39676.1| DnaJ domain protein [Peptoniphilus sp. oral taxon 836 str. F0141] | Back alignment and taxonomy information |
|---|
| >gi|357617592|gb|EHJ70876.1| DnaJ-like protein 13 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|47225277|emb|CAG09777.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|282881947|ref|ZP_06290592.1| chaperone protein DnaJ [Peptoniphilus lacrimalis 315-B] gi|281298222|gb|EFA90673.1| chaperone protein DnaJ [Peptoniphilus lacrimalis 315-B] | Back alignment and taxonomy information |
|---|
| >gi|326428328|gb|EGD73898.1| molecular chaperone DnaJ [Salpingoeca sp. ATCC 50818] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 244 | ||||||
| UNIPROTKB|F1PC60 | 238 | DNAJC4 "Uncharacterized protei | 0.762 | 0.781 | 0.297 | 9.5e-18 | |
| UNIPROTKB|F1MMI8 | 241 | DNAJC4 "Uncharacterized protei | 0.770 | 0.780 | 0.298 | 1.4e-16 | |
| UNIPROTKB|Q9NNZ3 | 241 | DNAJC4 "DnaJ homolog subfamily | 0.844 | 0.854 | 0.274 | 3.7e-16 | |
| UNIPROTKB|F1RQ04 | 240 | DNAJC4 "Uncharacterized protei | 0.721 | 0.733 | 0.304 | 1.6e-15 | |
| MGI|MGI:1927346 | 244 | Dnajc4 "DnaJ (Hsp40) homolog, | 0.799 | 0.799 | 0.268 | 1.6e-15 | |
| RGD|1308693 | 238 | Dnajc4 "DnaJ (Hsp40) homolog, | 0.766 | 0.785 | 0.278 | 3.3e-15 | |
| FB|FBgn0260775 | 217 | DnaJ-60 "DnaJ-like-60" [Drosop | 0.762 | 0.857 | 0.280 | 2.3e-14 | |
| CGD|CAL0004972 | 384 | orf19.3438 [Candida albicans ( | 0.25 | 0.158 | 0.508 | 7.3e-14 | |
| UNIPROTKB|E7EP04 | 275 | DNAJC10 "DnaJ homolog subfamil | 0.274 | 0.243 | 0.462 | 5.4e-13 | |
| ZFIN|ZDB-GENE-070327-1 | 791 | dnajc10 "DnaJ (Hsp40) homolog, | 0.356 | 0.109 | 0.417 | 1e-12 |
| UNIPROTKB|F1PC60 DNAJC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Score = 216 (81.1 bits), Expect = 9.5e-18, P = 9.5e-18
Identities = 60/202 (29%), Positives = 98/202 (48%)
Query: 33 RYSSGQDHTHYEILELERNCSPKEIRSAFIRLSKQFHPDKNPSNPALHDKFVKLNEAYSI 92
R SG +YE+L + S +E++ AF SK+ HPD++P NPALH +FV+L+EAY +
Sbjct: 28 RQRSGP-RNYYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPALHSRFVELSEAYQV 86
Query: 93 LNDMDRRRNYDASLNLQTVRQN--MFVHKTRARSSYSDSGERP--ENWKDYYDFAAQMKR 148
L+ RR+YD L+ T ++ VH A ++S S P + W ++ Q
Sbjct: 87 LSHEHSRRSYDHQLSSTTPPKSPGTTVHPRAAHQAHSSSWAPPNAQYWAQFHGVRPQGPE 146
Query: 149 NESIHVPKFLHKFETLSKATLVMLLIGVATGALGLQILAVQYSKTFPRNVVNSREMEISQ 208
+ + H L L+ML +GL +A + + R+ ++ ++ I+
Sbjct: 147 SRQ---QQHRHNQRVLGYCLLIML------AGMGLHYVAFRKLEQMHRSFMDEKDRIITA 197
Query: 209 --NLMNARNDAKKYDLQENIDR 228
N AR A + LQE + R
Sbjct: 198 IYNDTRARARANRAKLQEQLQR 219
|
|
| UNIPROTKB|F1MMI8 DNAJC4 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NNZ3 DNAJC4 "DnaJ homolog subfamily C member 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQ04 DNAJC4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1927346 Dnajc4 "DnaJ (Hsp40) homolog, subfamily C, member 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308693 Dnajc4 "DnaJ (Hsp40) homolog, subfamily C, member 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0260775 DnaJ-60 "DnaJ-like-60" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0004972 orf19.3438 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EP04 DNAJC10 "DnaJ homolog subfamily C member 10" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070327-1 dnajc10 "DnaJ (Hsp40) homolog, subfamily C, member 10" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 244 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 7e-25 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 9e-21 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 9e-20 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 4e-19 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 9e-19 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 7e-18 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 5e-17 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 3e-15 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 1e-14 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 1e-14 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 2e-14 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 6e-14 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 9e-14 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 1e-13 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 2e-13 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 3e-13 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 9e-13 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 1e-12 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 2e-12 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 3e-12 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 5e-12 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 5e-12 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 5e-12 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 5e-12 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 9e-12 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 9e-12 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 1e-11 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 2e-11 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 6e-11 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 6e-10 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 2e-09 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 2e-09 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 3e-09 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 2e-08 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 7e-08 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 8e-08 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-07 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 2e-06 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 93.0 bits (232), Expect = 7e-25
Identities = 29/63 (46%), Positives = 47/63 (74%)
Query: 41 THYEILELERNCSPKEIRSAFIRLSKQFHPDKNPSNPALHDKFVKLNEAYSILNDMDRRR 100
+YEIL + R+ S +EI+ A+ +L+ ++HPDKNP +PA +KF ++NEAY +L+D ++R
Sbjct: 1 DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60
Query: 101 NYD 103
YD
Sbjct: 61 IYD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 244 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.91 | |
| KOG0713|consensus | 336 | 99.89 | ||
| KOG0717|consensus | 508 | 99.88 | ||
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.83 | |
| KOG0712|consensus | 337 | 99.81 | ||
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.8 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.8 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.8 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.79 | |
| KOG0716|consensus | 279 | 99.77 | ||
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.77 | |
| KOG0691|consensus | 296 | 99.77 | ||
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.76 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.76 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.74 | |
| KOG0715|consensus | 288 | 99.74 | ||
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.72 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.72 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.72 | |
| KOG0721|consensus | 230 | 99.71 | ||
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.7 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.7 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.7 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.7 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.7 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.7 | |
| KOG0719|consensus | 264 | 99.7 | ||
| KOG0718|consensus | 546 | 99.68 | ||
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.68 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.62 | |
| KOG0722|consensus | 329 | 99.61 | ||
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.58 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.55 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.55 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.52 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.52 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.52 | |
| KOG0624|consensus | 504 | 99.49 | ||
| KOG0720|consensus | 490 | 99.43 | ||
| KOG0550|consensus | 486 | 99.36 | ||
| KOG0714|consensus | 306 | 99.28 | ||
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.28 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.27 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.27 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.23 | |
| KOG1150|consensus | 250 | 99.22 | ||
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.17 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 99.06 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 99.03 | |
| KOG0568|consensus | 342 | 98.49 | ||
| KOG1789|consensus | 2235 | 98.2 | ||
| KOG3192|consensus | 168 | 97.72 | ||
| KOG0723|consensus | 112 | 97.69 | ||
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.48 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.34 | |
| KOG0431|consensus | 453 | 95.67 | ||
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 92.81 | |
| TIGR02209 | 85 | ftsL_broad cell division protein FtsL. This model | 86.14 | |
| PF12732 | 74 | YtxH: YtxH-like protein; InterPro: IPR024623 This | 85.2 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 84.67 | |
| PF14687 | 112 | DUF4460: Domain of unknown function (DUF4460) | 81.53 | |
| PF04999 | 97 | FtsL: Cell division protein FtsL; InterPro: IPR007 | 80.02 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.91 E-value=6.2e-25 Score=198.48 Aligned_cols=74 Identities=35% Similarity=0.662 Sum_probs=70.3
Q ss_pred CccCcccccccCCCCCHHHHHHHHHHHHHhhCCCCCCCChHHHHHHHHHHHHHHHcCChhHHHHHHhccccccc
Q psy5201 38 QDHTHYEILELERNCSPKEIRSAFIRLSKQFHPDKNPSNPALHDKFVKLNEAYSILNDMDRRRNYDASLNLQTV 111 (244)
Q Consensus 38 ~~~~~Y~iLgv~~~a~~~eIk~ay~~l~~~~HPD~~~~~~~~~~~f~~i~~Ay~vL~dp~~R~~YD~~~~~~~~ 111 (244)
...|||+||||+++||.+|||+|||+||++||||+|+++++|+++|++|++||+|||||++|+.||++++....
T Consensus 2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~ 75 (371)
T COG0484 2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFK 75 (371)
T ss_pred CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccc
Confidence 36799999999999999999999999999999999998999999999999999999999999999999988544
|
|
| >KOG0713|consensus | Back alignment and domain information |
|---|
| >KOG0717|consensus | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712|consensus | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0716|consensus | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0691|consensus | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715|consensus | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0721|consensus | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0719|consensus | Back alignment and domain information |
|---|
| >KOG0718|consensus | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0722|consensus | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0624|consensus | Back alignment and domain information |
|---|
| >KOG0720|consensus | Back alignment and domain information |
|---|
| >KOG0550|consensus | Back alignment and domain information |
|---|
| >KOG0714|consensus | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >KOG1150|consensus | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568|consensus | Back alignment and domain information |
|---|
| >KOG1789|consensus | Back alignment and domain information |
|---|
| >KOG3192|consensus | Back alignment and domain information |
|---|
| >KOG0723|consensus | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431|consensus | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >TIGR02209 ftsL_broad cell division protein FtsL | Back alignment and domain information |
|---|
| >PF12732 YtxH: YtxH-like protein; InterPro: IPR024623 This family of uncharacterised proteins is found in bacteria | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
| >PF14687 DUF4460: Domain of unknown function (DUF4460) | Back alignment and domain information |
|---|
| >PF04999 FtsL: Cell division protein FtsL; InterPro: IPR007082 In Escherichia coli, nine gene products are known to be essential for assembly of the division septum | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 244 | ||||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 8e-13 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 3e-12 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 5e-12 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 2e-11 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 2e-09 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 3e-09 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 4e-09 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 6e-09 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 1e-08 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 2e-08 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 2e-08 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 1e-07 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 1e-07 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 6e-07 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 3e-06 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 9e-06 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 1e-05 | ||
| 2yua_A | 99 | Solution Structure Of The Dnaj Domain From Human Wi | 2e-05 | ||
| 2ctq_A | 112 | Solution Structure Of J-Domain From Human Dnaj Subf | 6e-04 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 9e-04 |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
|
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 | Back alignment and structure |
| >pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 244 | |||
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 2e-21 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 1e-20 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 6e-20 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 6e-20 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 9e-20 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 1e-19 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 7e-19 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 5e-18 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 5e-18 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 1e-17 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 2e-17 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 2e-17 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 2e-17 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 2e-17 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 3e-17 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 3e-17 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 6e-17 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 6e-17 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 1e-16 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 1e-15 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 2e-15 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 8e-15 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 3e-14 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 8e-13 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 3e-12 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 3e-12 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 2e-11 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 2e-10 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-09 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 8e-09 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 9e-09 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 4e-08 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 7e-06 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 1e-05 |
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
Score = 88.0 bits (218), Expect = 2e-21
Identities = 29/61 (47%), Positives = 41/61 (67%)
Query: 43 YEILELERNCSPKEIRSAFIRLSKQFHPDKNPSNPALHDKFVKLNEAYSILNDMDRRRNY 102
Y +L + + S +EIR AF +L+ + HPDKNP+NP H F+K+N AY +L D D R+ Y
Sbjct: 5 YSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKY 64
Query: 103 D 103
D
Sbjct: 65 D 65
|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 244 | |||
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.87 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.86 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.86 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.86 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.86 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.84 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.84 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.84 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.84 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.84 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.84 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.83 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.83 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.82 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.82 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.81 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.78 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.78 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.77 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.76 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.76 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.75 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.72 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.7 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.68 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.68 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.68 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.65 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.64 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.63 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.6 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.59 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.57 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.98 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.71 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 90.85 |
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.87 E-value=2.7e-22 Score=144.21 Aligned_cols=74 Identities=43% Similarity=0.719 Sum_probs=69.3
Q ss_pred CCCCccCcccccccCCCCCHHHHHHHHHHHHHhhCCCCCCCChHHHHHHHHHHHHHHHcCChhHHHHHHhcccc
Q psy5201 35 SSGQDHTHYEILELERNCSPKEIRSAFIRLSKQFHPDKNPSNPALHDKFVKLNEAYSILNDMDRRRNYDASLNL 108 (244)
Q Consensus 35 ~~~~~~~~Y~iLgv~~~a~~~eIk~ay~~l~~~~HPD~~~~~~~~~~~f~~i~~Ay~vL~dp~~R~~YD~~~~~ 108 (244)
+++...|||+||||+++++.++||++|++|++++|||++++++.+.+.|+.|++||++|+||.+|..||..+..
T Consensus 2 s~~~~~~~y~iLgv~~~a~~~~Ik~ayr~l~~~~HPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~g~~ 75 (79)
T 2dn9_A 2 SSGSSGDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSG 75 (79)
T ss_dssp CSSCCSCHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCSSCTTHHHHHHHHHHHHHHHHSHHHHHHHHHSCCC
T ss_pred CCCCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHhccCc
Confidence 34567899999999999999999999999999999999987788999999999999999999999999998865
|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 244 | ||||
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 1e-14 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 3e-14 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 3e-13 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 1e-11 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 1e-11 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 4e-10 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 2e-07 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-06 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Score = 64.6 bits (157), Expect = 1e-14
Identities = 24/62 (38%), Positives = 38/62 (61%)
Query: 42 HYEILELERNCSPKEIRSAFIRLSKQFHPDKNPSNPALHDKFVKLNEAYSILNDMDRRRN 101
+YEIL + + +EIR A+ RL+ ++HPD+N + KF ++ EAY +L D +R
Sbjct: 5 YYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAA 64
Query: 102 YD 103
YD
Sbjct: 65 YD 66
|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 244 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.9 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.85 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.8 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.75 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.71 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.63 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.62 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.90 E-value=4.3e-24 Score=150.65 Aligned_cols=70 Identities=34% Similarity=0.648 Sum_probs=66.6
Q ss_pred ccCcccccccCCCCCHHHHHHHHHHHHHhhCCCCCCCChHHHHHHHHHHHHHHHcCChhHHHHHHhcccc
Q psy5201 39 DHTHYEILELERNCSPKEIRSAFIRLSKQFHPDKNPSNPALHDKFVKLNEAYSILNDMDRRRNYDASLNL 108 (244)
Q Consensus 39 ~~~~Y~iLgv~~~a~~~eIk~ay~~l~~~~HPD~~~~~~~~~~~f~~i~~Ay~vL~dp~~R~~YD~~~~~ 108 (244)
..|||+||||+++||.++||+||+++++++|||++++++.+.+.|..|++||+||+||.+|..||.+|..
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~ 71 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA 71 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence 4799999999999999999999999999999999997788999999999999999999999999998855
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|