Psyllid ID: psy5220

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQKKSI
ccccccccccccccccccccccccccccEEcccccccccHHHHHHcccccccccccccccHHHHHHHHccccccEEccccccccccccccccccHHHHHHHHHHHcccccEEEEEEEEEccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHccccccccccccHHHHHcccccccccHHHHHHHHcccccEEEccHHHHHHHHHHHHHHHcccc
ccHHHHHccccccccccccccccccccEEEcccccEEEEHHHHHHHcccccccccccEEcHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEEEEcccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHccEEEEccccEEEccccHHHHHHHHHHccccHHHHHHHHHccccccEcccHHHHHHHHHHHHHHccccc
mnwlknysfpnlqknnafvkksipkglwikclscktilykndlkfnqqvctkcdyhmQIKARDRLNnfldknnfheigenilpvdtlnfkdnIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEfmggsmgsvvgERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSkkkipfisvltnptmggvsaSFAFMGDiviaepgaligfagprvIKNTvkeklpdgfqssEFLLKKGALDMIIDRRKLRFKIANLLALLQKKSI
mnwlknysfpnlqknnafvKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIgenilpvdtlnfKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVkeklpdgfqssefllkKGALDMIIDRRKLRFKIANLLALLQKKSI
MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQKKSI
***LKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALL*****
MNWLK*********************LWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAK**TNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQK***
MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQKKSI
**W*****************KSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQKKSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
B2JQF1290 Acetyl-coenzyme A carboxy yes N/A 0.993 0.979 0.651 1e-112
B4EFK3290 Acetyl-coenzyme A carboxy yes N/A 0.993 0.979 0.647 1e-112
Q1BM67290 Acetyl-coenzyme A carboxy yes N/A 0.993 0.979 0.647 1e-112
A9AMA4290 Acetyl-coenzyme A carboxy yes N/A 0.993 0.979 0.647 1e-112
B3R112290 Acetyl-coenzyme A carboxy yes N/A 0.947 0.934 0.642 1e-109
Q47HQ3289 Acetyl-coenzyme A carboxy yes N/A 0.989 0.979 0.605 1e-104
Q604P5324 Acetyl-coenzyme A carboxy yes N/A 0.986 0.870 0.611 1e-101
Q1H0M3289 Acetyl-coenzyme A carboxy yes N/A 0.972 0.961 0.582 1e-100
Q0A9A0311 Acetyl-coenzyme A carboxy yes N/A 0.993 0.913 0.542 6e-97
Q47XK5285 Acetyl-coenzyme A carboxy yes N/A 0.961 0.964 0.569 1e-95
>sp|B2JQF1|ACCD_BURP8 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=accD PE=3 SV=1 Back     alignment and function desciption
 Score =  405 bits (1041), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 234/284 (82%)

Query: 1   MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIK 60
           M+WL     P +++ +   +K IP+GLWIKC SC+ +LY+ND++ N  VC KCD+HM+I 
Sbjct: 1   MSWLDKLLPPKIKQTDPKSRKGIPEGLWIKCPSCEAVLYRNDVEANLHVCPKCDHHMRIG 60

Query: 61  ARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIM 120
           AR+RL+  LD    +EIG+ ILPVD L FKD+ KY +RLK A   T+ETDA++V+ G+I 
Sbjct: 61  ARERLDGLLDPEGRYEIGQEILPVDALKFKDSRKYPDRLKEAMDETDETDAMVVMGGAIH 120

Query: 121 NLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQ 180
            LP+VVA FEF FMGGSMGSVVGERF +GAQ +LEQ +PF+C TA+GGARMQE LLSLMQ
Sbjct: 121 TLPVVVACFEFAFMGGSMGSVVGERFARGAQNALEQNVPFICFTASGGARMQESLLSLMQ 180

Query: 181 MAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNT 240
           MAKTTA+LTKLS+ K+PFISVLT+PTMGGVSASFAF+GD+VIAEP ALIGFAGPRVI+ T
Sbjct: 181 MAKTTAMLTKLSEAKLPFISVLTDPTMGGVSASFAFLGDVVIAEPKALIGFAGPRVIEQT 240

Query: 241 VKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQKK 284
           V+EKLP+GFQ +EFLL+KGA+DMI+DRRKLR ++A L+ALL ++
Sbjct: 241 VREKLPEGFQRAEFLLQKGAIDMIVDRRKLREELAQLMALLTRQ 284
Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.
Burkholderia phymatum (strain DSM 17167 / STM815) (taxid: 391038)
EC: 6EC: .EC: 4EC: .EC: 1EC: .EC: 2
>sp|B4EFK3|ACCD_BURCJ Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=accD PE=3 SV=1 Back     alignment and function description
>sp|Q1BM67|ACCD_BURCA Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Burkholderia cenocepacia (strain AU 1054) GN=accD PE=3 SV=1 Back     alignment and function description
>sp|A9AMA4|ACCD_BURM1 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=accD PE=3 SV=1 Back     alignment and function description
>sp|B3R112|ACCD_CUPTR Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=accD PE=3 SV=1 Back     alignment and function description
>sp|Q47HQ3|ACCD_DECAR Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Dechloromonas aromatica (strain RCB) GN=accD PE=3 SV=1 Back     alignment and function description
>sp|Q604P5|ACCD_METCA Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=accD PE=3 SV=1 Back     alignment and function description
>sp|Q1H0M3|ACCD_METFK Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=accD PE=3 SV=1 Back     alignment and function description
>sp|Q0A9A0|ACCD_ALHEH Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Alkalilimnicola ehrlichei (strain MLHE-1) GN=accD PE=3 SV=1 Back     alignment and function description
>sp|Q47XK5|ACCD_COLP3 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=accD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
395763390290 acetyl-CoA carboxylase subunit beta [Jan 1.0 0.986 0.688 1e-121
340787065290 acetyl-coenzyme A carboxyl transferase s 1.0 0.986 0.681 1e-119
152980197290 acetyl-CoA carboxylase subunit beta [Jan 0.996 0.982 0.687 1e-119
445498536290 acetyl-coenzyme A carboxylase carboxyl t 1.0 0.986 0.678 1e-119
427401326290 acetyl-coenzyme A carboxylase carboxyl t 0.996 0.982 0.687 1e-119
161485637290 acetyl-CoA carboxylase subunit beta [Her 0.996 0.982 0.687 1e-119
399021678290 acetyl-CoA carboxylase, carboxyl transfe 0.996 0.982 0.680 1e-118
398832519290 acetyl-CoA carboxylase, carboxyl transfe 0.996 0.982 0.673 1e-117
300312587289 acetyl-coenzyme A carboxylase carboxyl t 0.993 0.982 0.677 1e-116
409407075289 acetyl-coenzyme A carboxylase carboxyl t 0.993 0.982 0.677 1e-116
>gi|395763390|ref|ZP_10444059.1| acetyl-CoA carboxylase subunit beta [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 197/286 (68%), Positives = 251/286 (87%)

Query: 1   MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIK 60
           M+WL+    P +Q+++A  +K++P+GLW+KC SC+ +LY+ DL+ N  VC KCD+HM+I+
Sbjct: 1   MSWLEKLLPPRIQRSDAAARKTMPEGLWVKCPSCEAVLYRTDLESNLHVCPKCDHHMRIR 60

Query: 61  ARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIM 120
           AR+RL++ LD    +EIG+ ILPVDTL FKD+ KY +RLK A + T ETDA++V+ G+IM
Sbjct: 61  ARERLDSLLDAGGRYEIGQEILPVDTLKFKDSKKYPDRLKSAMEATGETDAMVVMGGAIM 120

Query: 121 NLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQ 180
           +LP+VVA FEFEFMGGSMGSVVGERF++GAQI+LEQK+PF+CITATGGARMQEGLLSLMQ
Sbjct: 121 SLPVVVACFEFEFMGGSMGSVVGERFVRGAQIALEQKVPFICITATGGARMQEGLLSLMQ 180

Query: 181 MAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNT 240
           MAKTTA+LTKLS+KK+PFISVLT+PTMGGVSASFAFMGD+VIAEP ALIGFAGPRVI+NT
Sbjct: 181 MAKTTAMLTKLSEKKLPFISVLTDPTMGGVSASFAFMGDVVIAEPKALIGFAGPRVIENT 240

Query: 241 VKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQKKSI 286
           V+EKLP+GFQ +EFL+ KGA+DMI+DRRK+R +IA LLALLQ +++
Sbjct: 241 VREKLPEGFQRAEFLVTKGAVDMIVDRRKMREEIARLLALLQNQAV 286

Source: Janthinobacterium lividum PAMC 25724

Species: Janthinobacterium lividum

Genus: Janthinobacterium

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|340787065|ref|YP_004752530.1| acetyl-coenzyme A carboxyl transferase subunit beta [Collimonas fungivorans Ter331] gi|340552332|gb|AEK61707.1| Acetyl-coenzyme A carboxyl transferase beta chain [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|152980197|ref|YP_001353852.1| acetyl-CoA carboxylase subunit beta [Janthinobacterium sp. Marseille] gi|151280274|gb|ABR88684.1| acetyl-CoA carboxylase carboxyl transferase subunit beta [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|445498536|ref|ZP_21465391.1| acetyl-coenzyme A carboxylase carboxyl transferase subunit beta [Janthinobacterium sp. HH01] gi|444788531|gb|ELX10079.1| acetyl-coenzyme A carboxylase carboxyl transferase subunit beta [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|427401326|ref|ZP_18892398.1| acetyl-coenzyme A carboxylase carboxyl transferase subunit beta [Massilia timonae CCUG 45783] gi|425719749|gb|EKU82679.1| acetyl-coenzyme A carboxylase carboxyl transferase subunit beta [Massilia timonae CCUG 45783] Back     alignment and taxonomy information
>gi|161485637|ref|YP_001099528.2| acetyl-CoA carboxylase subunit beta [Herminiimonas arsenicoxydans] gi|193222281|emb|CAL61401.2| Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase beta chain) [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|399021678|ref|ZP_10723770.1| acetyl-CoA carboxylase, carboxyl transferase, beta subunit [Herbaspirillum sp. CF444] gi|398090684|gb|EJL81148.1| acetyl-CoA carboxylase, carboxyl transferase, beta subunit [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|398832519|ref|ZP_10590678.1| acetyl-CoA carboxylase, carboxyl transferase, beta subunit [Herbaspirillum sp. YR522] gi|398223295|gb|EJN09645.1| acetyl-CoA carboxylase, carboxyl transferase, beta subunit [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|300312587|ref|YP_003776679.1| acetyl-coenzyme A carboxylase carboxyl transferase subunit beta [Herbaspirillum seropedicae SmR1] gi|300075372|gb|ADJ64771.1| acetyl-coenzyme A carboxylase carboxyl transferase (subunit beta) protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|409407075|ref|ZP_11255526.1| acetyl-coenzyme A carboxylase carboxyl transferase subunit beta [Herbaspirillum sp. GW103] gi|386432826|gb|EIJ45652.1| acetyl-coenzyme A carboxylase carboxyl transferase subunit beta [Herbaspirillum sp. GW103] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
TIGR_CMR|CPS_3802285 CPS_3802 "acetyl-CoA carboxyla 0.958 0.961 0.571 3.4e-84
UNIPROTKB|P0A9Q5304 accD [Escherichia coli K-12 (t 0.968 0.911 0.548 1.5e-81
UNIPROTKB|Q9KTA3308 accD "Acetyl-coenzyme A carbox 0.961 0.892 0.558 5.2e-81
TIGR_CMR|VC_1000308 VC_1000 "acetyl-CoA carboxylas 0.961 0.892 0.558 5.2e-81
TIGR_CMR|CBU_0893291 CBU_0893 "acetyl-CoA carboxyla 0.968 0.951 0.533 8.5e-81
TIGR_CMR|GSU_2370280 GSU_2370 "acetyl-CoA carboxyla 0.975 0.996 0.473 3.1e-67
TIGR_CMR|SPO_3817314 SPO_3817 "acetyl-CoA carboxyla 0.972 0.885 0.478 1.2e-65
UNIPROTKB|Q0PC10280 accD "Acetyl-coenzyme A carbox 0.958 0.978 0.434 1.3e-59
TIGR_CMR|CJE_0122280 CJE_0122 "acetyl-CoA carboxyla 0.958 0.978 0.434 1.3e-59
TIGR_CMR|CHY_1141280 CHY_1141 "acetyl-CoA carboxyla 0.916 0.935 0.456 3.5e-59
TIGR_CMR|CPS_3802 CPS_3802 "acetyl-CoA carboxylase, carboxyl transferase, beta subunit" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
 Score = 843 (301.8 bits), Expect = 3.4e-84, P = 3.4e-84
 Identities = 159/278 (57%), Positives = 210/278 (75%)

Query:     1 MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIK 60
             M+W++      L K     K SIP+G+W KC SC  +LYK +L+    VC KCD+HM+I 
Sbjct:     1 MSWIEKI----LPKAKTTQKSSIPEGVWSKCSSCNAVLYKAELERQISVCPKCDHHMRIS 56

Query:    61 ARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIM 120
             AR R+++FLD +N  E+GE     D L FKD+ +Y +RL  A+KNT E DAL+V+KG + 
Sbjct:    57 ARKRIDSFLDHDNRMELGEEFEAQDILKFKDSKRYKDRLSAAQKNTGEKDALVVMKGELH 116

Query:   121 NLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQ 180
              +P+VVA FEF F+GGSM SVVG RF++G +  LE  +PF+C +A+GGARMQE L SLMQ
Sbjct:   117 GMPVVVAAFEFAFLGGSMASVVGARFVKGVEYCLEHNLPFICFSASGGARMQEALFSLMQ 176

Query:   181 MAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNT 240
             MAKT+A L K+S+K +P++SVLT+PTMGGVSAS A +GDI +AEP ALIGFAGPRVI+ T
Sbjct:   177 MAKTSAALAKMSEKGLPYVSVLTDPTMGGVSASLAMLGDINVAEPKALIGFAGPRVIEQT 236

Query:   241 VKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLL 278
             V+EKLP+GFQ SEFLL+KGA+DMIIDRR+++  +A +L
Sbjct:   237 VREKLPEGFQRSEFLLEKGAIDMIIDRREMKITLARML 274
GO:0003989 "acetyl-CoA carboxylase activity" evidence=ISS
GO:0006633 "fatty acid biosynthetic process" evidence=ISS
GO:0009317 "acetyl-CoA carboxylase complex" evidence=ISS
UNIPROTKB|P0A9Q5 accD [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KTA3 accD "Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1000 VC_1000 "acetyl-CoA carboxylase, carboxyl transferase beta subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0893 CBU_0893 "acetyl-CoA carboxylase, carboxyl transferase, beta subunit" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2370 GSU_2370 "acetyl-CoA carboxylase, carboxyl transferase, beta subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3817 SPO_3817 "acetyl-CoA carboxylase, carboxyl transferase, beta subunit" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q0PC10 accD "Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta" [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 (taxid:192222)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0122 CJE_0122 "acetyl-CoA carboxylase, carboxyl transferase, beta subunit" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1141 CHY_1141 "acetyl-CoA carboxylase, carboxyl transferase, beta subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8FFH5ACCD_ECOL66, ., 4, ., 1, ., 20.57630.91600.8618yesN/A
B5BCI0ACCD_SALPK6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
A4XVV4ACCD_PSEMY6, ., 4, ., 1, ., 20.55470.98600.9591yesN/A
Q0A9A0ACCD_ALHEH6, ., 4, ., 1, ., 20.54220.99300.9131yesN/A
Q0TFD0ACCD_ECOL56, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
Q57LY8ACCD_SALCH6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
B4EFK3ACCD_BURCJ6, ., 4, ., 1, ., 20.64780.99300.9793yesN/A
B2VJ00ACCD_ERWT96, ., 4, ., 1, ., 20.55190.96850.9172yesN/A
A5F2T5ACCD_VIBC36, ., 4, ., 1, ., 20.55870.96150.8928yesN/A
Q3YZP5ACCD_SHISS6, ., 4, ., 1, ., 20.57630.91600.8618yesN/A
Q02PS5ACCD_PSEAB6, ., 4, ., 1, ., 20.54310.96850.9551yesN/A
Q47HQ3ACCD_DECAR6, ., 4, ., 1, ., 20.60560.98950.9792yesN/A
Q8D2P4ACCD_WIGBR6, ., 4, ., 1, ., 20.57390.97900.9790yesN/A
Q9HZA7ACCD_PSEAE6, ., 4, ., 1, ., 20.54310.96850.9551yesN/A
Q4KEZ8ACCD_PSEF56, ., 4, ., 1, ., 20.54640.97550.9117yesN/A
B3R112ACCD_CUPTR6, ., 4, ., 1, ., 20.64200.94750.9344yesN/A
Q1BM67ACCD_BURCA6, ., 4, ., 1, ., 20.64780.99300.9793yesN/A
B5FPL0ACCD_SALDC6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
A6V2W2ACCD_PSEA76, ., 4, ., 1, ., 20.54310.96850.9551yesN/A
B4TBN5ACCD_SALHS6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
A6TC02ACCD_KLEP76, ., 4, ., 1, ., 20.57630.91600.8562yesN/A
B5R347ACCD_SALEP6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
A7MH52ACCD_CROS86, ., 4, ., 1, ., 20.55120.96850.9052yesN/A
Q5PCV4ACCD_SALPA6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
B0KF95ACCD_PSEPG6, ., 4, ., 1, ., 20.55030.96850.9326yesN/A
B4RUR0ACCD_ALTMD6, ., 4, ., 1, ., 20.55280.97900.9964yesN/A
Q1ICS2ACCD_PSEE46, ., 4, ., 1, ., 20.55390.96850.9326yesN/A
Q5E456ACCD_VIBF16, ., 4, ., 1, ., 20.56070.96500.9387yesN/A
Q4ZVW0ACCD_PSEU26, ., 4, ., 1, ., 20.55390.96850.9052yesN/A
B5EZQ0ACCD_SALA46, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
B2JQF1ACCD_BURP86, ., 4, ., 1, ., 20.65140.99300.9793yesN/A
Q48L24ACCD_PSE146, ., 4, ., 1, ., 20.55030.96850.9052yesN/A
Q88LD9ACCD_PSEPK6, ., 4, ., 1, ., 20.55030.96850.9326yesN/A
B4TQA2ACCD_SALSV6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
Q604P5ACCD_METCA6, ., 4, ., 1, ., 20.61130.98600.8703yesN/A
Q8XFJ5ACCD_SALTI6, ., 4, ., 1, ., 20.58010.91600.8618N/AN/A
A5W6X9ACCD_PSEP16, ., 4, ., 1, ., 20.55030.96850.9326yesN/A
A9N478ACCD_SALPB6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
Q47XK5ACCD_COLP36, ., 4, ., 1, ., 20.56980.96150.9649yesN/A
A4VKF5ACCD_PSEU56, ., 4, ., 1, ., 20.54600.98250.9461yesN/A
Q1H0M3ACCD_METFK6, ., 4, ., 1, ., 20.58270.97200.9619yesN/A
A9MJ59ACCD_SALAR6, ., 4, ., 1, ., 20.57630.91600.8618N/AN/A
B4SZN8ACCD_SALNS6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
B5FFN5ACCD_VIBFM6, ., 4, ., 1, ., 20.56070.96500.9387yesN/A
A9AMA4ACCD_BURM16, ., 4, ., 1, ., 20.64780.99300.9793yesN/A
B5RCJ1ACCD_SALG26, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
Q9KTA3ACCD_VIBCH6, ., 4, ., 1, ., 20.55870.96150.8928yesN/A
Q7CQ41ACCD_SALTY6, ., 4, ., 1, ., 20.58010.91600.8618yesN/A
A8ADR3ACCD_CITK86, ., 4, ., 1, ., 20.57630.91600.8618yesN/A
Q3KF15ACCD_PSEPF6, ., 4, ., 1, ., 20.54770.98600.9215yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer6.4.1.20.991
3rd Layer6.4.10.976

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
PRK05654292 PRK05654, PRK05654, acetyl-CoA carboxylase subunit 1e-168
COG0777294 COG0777, AccD, Acetyl-CoA carboxylase beta subunit 1e-149
TIGR00515285 TIGR00515, accD, acetyl-CoA carboxylase, carboxyl 1e-134
CHL00174296 CHL00174, accD, acetyl-CoA carboxylase beta subuni 1e-94
TIGR03133274 TIGR03133, malonate_beta, malonate decarboxylase, 9e-14
pfam01039 487 pfam01039, Carboxyl_trans, Carboxyl transferase do 8e-13
COG4799 526 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyl 8e-11
TIGR01117 512 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase a 1e-10
PRK07189301 PRK07189, PRK07189, malonate decarboxylase subunit 3e-10
>gnl|CDD|235547 PRK05654, PRK05654, acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information 
 Score =  466 bits (1201), Expect = e-168
 Identities = 154/284 (54%), Positives = 212/284 (74%), Gaps = 1/284 (0%)

Query: 1   MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIK 60
           M+W   +    ++ +    K  +P+GLW KC SC  +LY+ +L+ N  VC KC +HM+I 
Sbjct: 1   MSWFDKFLPKKIKSSLP-RKAEVPEGLWTKCPSCGQVLYRKELEANLNVCPKCGHHMRIS 59

Query: 61  ARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIM 120
           AR+RL+  LD+ +F E+   + P D L F+D+ KY +RLK A+K T   DA++  KG+I 
Sbjct: 60  ARERLDLLLDEGSFVELDAELEPKDPLKFRDSKKYKDRLKAAQKKTGLKDAVVTGKGTIE 119

Query: 121 NLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQ 180
            +P+V+AV +F FMGGSMGSVVGE+ ++  + ++E+K P V  +A+GGARMQEGLLSLMQ
Sbjct: 120 GMPVVLAVMDFSFMGGSMGSVVGEKIVRAVERAIEEKCPLVIFSASGGARMQEGLLSLMQ 179

Query: 181 MAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNT 240
           MAKT+A L +LS+  +P+ISVLT+PT GGVSASFA +GDI+IAEP ALIGFAGPRVI+ T
Sbjct: 180 MAKTSAALKRLSEAGLPYISVLTDPTTGGVSASFAMLGDIIIAEPKALIGFAGPRVIEQT 239

Query: 241 VKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQKK 284
           V+EKLP+GFQ +EFLL+ GA+DMI+ RR+LR  +A+LLAL  K+
Sbjct: 240 VREKLPEGFQRAEFLLEHGAIDMIVHRRELRDTLASLLALHTKQ 283

Length = 292
>gnl|CDD|223848 COG0777, AccD, Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|129606 TIGR00515, accD, acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>gnl|CDD|214384 CHL00174, accD, acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>gnl|CDD|188285 TIGR03133, malonate_beta, malonate decarboxylase, beta subunit Back     alignment and domain information
>gnl|CDD|216259 pfam01039, Carboxyl_trans, Carboxyl transferase domain Back     alignment and domain information
>gnl|CDD|227136 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|130187 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|235954 PRK07189, PRK07189, malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 100.0
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 100.0
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 100.0
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 100.0
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 100.0
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 100.0
PRK07189301 malonate decarboxylase subunit beta; Reviewed 100.0
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 100.0
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase compon 100.0
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 100.0
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 100.0
KOG0540|consensus536 100.0
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase compon 100.0
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 100.0
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 100.0
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 100.0
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 100.0
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 100.0
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 100.0
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 100.0
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 99.97
KOG0540|consensus 536 99.97
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 99.97
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 99.95
PRK08150255 enoyl-CoA hydratase; Provisional 99.56
PF06833234 MdcE: Malonate decarboxylase gamma subunit (MdcE); 99.53
PRK06143256 enoyl-CoA hydratase; Provisional 99.53
PRK08139266 enoyl-CoA hydratase; Validated 99.53
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 99.53
PRK05995262 enoyl-CoA hydratase; Provisional 99.53
PRK05862257 enoyl-CoA hydratase; Provisional 99.53
PRK08140262 enoyl-CoA hydratase; Provisional 99.52
PRK08258277 enoyl-CoA hydratase; Provisional 99.52
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 99.52
PRK06023251 enoyl-CoA hydratase; Provisional 99.52
PRK07938249 enoyl-CoA hydratase; Provisional 99.52
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 99.51
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 99.51
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 99.51
PRK06190258 enoyl-CoA hydratase; Provisional 99.51
PRK07327268 enoyl-CoA hydratase; Provisional 99.51
PRK08138261 enoyl-CoA hydratase; Provisional 99.51
PRK09076258 enoyl-CoA hydratase; Provisional 99.51
PLN02600251 enoyl-CoA hydratase 99.51
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 99.5
PRK05981266 enoyl-CoA hydratase; Provisional 99.5
PRK07468262 enoyl-CoA hydratase; Provisional 99.5
PRK05869222 enoyl-CoA hydratase; Validated 99.5
PRK06495257 enoyl-CoA hydratase; Provisional 99.5
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 99.5
PRK06144262 enoyl-CoA hydratase; Provisional 99.5
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 99.5
PRK06142272 enoyl-CoA hydratase; Provisional 99.5
PRK07659260 enoyl-CoA hydratase; Provisional 99.49
PRK07260255 enoyl-CoA hydratase; Provisional 99.49
PRK05980260 enoyl-CoA hydratase; Provisional 99.49
PRK05864276 enoyl-CoA hydratase; Provisional 99.49
PRK06494259 enoyl-CoA hydratase; Provisional 99.49
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 99.49
PRK06127269 enoyl-CoA hydratase; Provisional 99.49
PRK07657260 enoyl-CoA hydratase; Provisional 99.48
PRK06563255 enoyl-CoA hydratase; Provisional 99.48
KOG1680|consensus290 99.48
PRK08252254 enoyl-CoA hydratase; Provisional 99.48
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 99.48
PRK06688259 enoyl-CoA hydratase; Provisional 99.48
PRK06210272 enoyl-CoA hydratase; Provisional 99.48
PLN02888265 enoyl-CoA hydratase 99.48
PRK03580261 carnitinyl-CoA dehydratase; Provisional 99.48
PRK08272302 enoyl-CoA hydratase; Provisional 99.48
PLN02921327 naphthoate synthase 99.48
PRK09245266 enoyl-CoA hydratase; Provisional 99.48
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 99.48
PRK07511260 enoyl-CoA hydratase; Provisional 99.47
PRK07799263 enoyl-CoA hydratase; Provisional 99.47
PRK07658257 enoyl-CoA hydratase; Provisional 99.47
PRK08290288 enoyl-CoA hydratase; Provisional 99.47
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 99.47
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 99.47
PRK06213229 enoyl-CoA hydratase; Provisional 99.47
PRK08260296 enoyl-CoA hydratase; Provisional 99.46
PRK05870249 enoyl-CoA hydratase; Provisional 99.46
PRK07854243 enoyl-CoA hydratase; Provisional 99.45
PRK12478298 enoyl-CoA hydratase; Provisional 99.45
PRK08259254 enoyl-CoA hydratase; Provisional 99.44
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 99.43
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 99.43
PRK08321302 naphthoate synthase; Validated 99.42
PRK08788287 enoyl-CoA hydratase; Validated 99.42
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 99.39
TIGR03200 360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 99.36
PRK07827260 enoyl-CoA hydratase; Provisional 99.36
PRK05617 342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 99.35
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 99.35
PRK07509262 enoyl-CoA hydratase; Provisional 99.33
PRK06072248 enoyl-CoA hydratase; Provisional 99.32
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 99.31
PRK11730 715 fadB multifunctional fatty acid oxidation complex 99.3
PLN02874 379 3-hydroxyisobutyryl-CoA hydrolase-like protein 99.29
PLN02267239 enoyl-CoA hydratase/isomerase family protein 99.28
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.27
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 99.25
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 99.24
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 99.21
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 99.17
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 99.17
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.17
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 99.16
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 99.16
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 99.15
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 99.14
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 99.07
PF03255145 ACCA: Acetyl co-enzyme A carboxylase carboxyltrans 99.05
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.05
KOG0368|consensus 2196 98.98
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 98.96
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 98.79
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 98.75
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 98.72
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 98.7
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 98.61
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 98.61
KOG0016|consensus266 98.57
KOG1682|consensus287 98.55
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 98.54
KOG1679|consensus291 98.52
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 98.4
KOG1681|consensus292 98.38
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 98.32
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 98.28
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 98.26
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 98.25
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 98.21
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 98.17
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 98.15
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 98.13
PRK11778330 putative inner membrane peptidase; Provisional 98.07
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 98.07
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 98.07
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 98.04
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 98.02
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 98.01
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 97.94
KOG0368|consensus 2196 97.91
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 97.82
PRK10949 618 protease 4; Provisional 97.78
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 97.61
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 97.24
smart0066152 RPOL9 RNA polymerase subunit 9. 97.16
PRK10949 618 protease 4; Provisional 96.87
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 96.84
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 96.8
KOG0840|consensus275 96.67
KOG1684|consensus 401 96.13
PHA0062659 hypothetical protein 94.26
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 94.19
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 93.99
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 93.13
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 92.7
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 92.39
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 92.09
TIGR00375374 conserved hypothetical protein TIGR00375. The memb 91.42
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 89.88
PF1324023 zinc_ribbon_2: zinc-ribbon domain 89.66
PF1324826 zf-ribbon_3: zinc-ribbon domain 89.5
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 87.97
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 87.19
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 87.11
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 86.53
COG1379403 PHP family phosphoesterase with a Zn ribbon [Gener 86.51
TIGR00686109 phnA alkylphosphonate utilization operon protein P 86.32
COG1645131 Uncharacterized Zn-finger containing protein [Gene 85.28
PRK07218423 replication factor A; Provisional 84.73
PRK10220111 hypothetical protein; Provisional 83.27
COG4530129 Uncharacterized protein conserved in bacteria [Fun 83.02
PRK00420112 hypothetical protein; Validated 82.58
PF14353128 CpXC: CpXC protein 81.98
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 81.42
PF1345341 zf-TFIIB: Transcription factor zinc-finger 80.84
smart00531147 TFIIE Transcription initiation factor IIE. 80.32
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-85  Score=580.36  Aligned_cols=285  Identities=53%  Similarity=0.912  Sum_probs=271.4

Q ss_pred             CCccccccCCCCCCCcccccCCCCchhhhcccccccccchhhccccccccccccCCCCCCHHHHHHhhcCCCceEEecCC
Q psy5220           1 MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGEN   80 (286)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~l~~~~~vc~~~~~~~~~~ar~ri~~L~D~gsf~E~~~~   80 (286)
                      |+||+++.++..++.....+...|+++|+|||+|++.+|++||+.|++|||+|+||++++|++||+.|+|+|||.||+.+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~e~lw~KCp~c~~~~y~~eL~~n~~vcp~c~~h~ri~A~~Ri~~llD~gsf~el~~~   80 (294)
T COG0777           1 MSWFSRIKKKIQPNKSDSRKASRPEGLWTKCPSCGEMLYRKELESNLKVCPKCGHHMRISARERLEALLDEGSFEELDSP   80 (294)
T ss_pred             CchhhhcccccCCCcchhhcccCCCCceeECCCccceeeHHHHHhhhhcccccCcccccCHHHHHHHhhCCCcceecccC
Confidence            89999874331222222356667899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCCCCCCCCccchHHHHHHHhhcCCCCCcEEEEEEEEcCeeEEEEEEcCcccccCCChHHHHHHHHHHHHHHhCCCcE
Q psy5220          81 ILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPF  160 (286)
Q Consensus        81 ~~~~d~l~f~~~~~y~~~l~~~~~~~~~~~~vvtG~g~i~G~~v~v~a~d~~~~gGs~~~~~~~K~~r~~~~A~~~~iPl  160 (286)
                      +.+.|||+|+|+|.|.+||++++++|+..++||||.|+|+|.||+++++||+|+|||||++.++||+|++|.|.+.++|+
T Consensus        81 l~~~dPL~F~d~k~Y~~rL~~a~~~tg~~davvtg~g~i~G~pvv~av~df~FmgGSmGsVvGeki~ra~E~A~e~k~P~  160 (294)
T COG0777          81 LEPKDPLKFPDSKKYKDRLEAARKKTGLDDAVVTGEGTINGLPVVLAVMDFAFMGGSMGSVVGEKITRAIERAIEDKLPL  160 (294)
T ss_pred             CCcCCcccCCcchhhHHHHHHHHhhcCCCcceEEEeeEECCeEEEEEEEeccccccchhHHHHHHHHHHHHHHHHhCCCE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeCCCcchhhchHhHHHHHHHHHHHHHHhcCCCCEEEEEcCCcchhhhhhccccccEEEEcCCcEEEeeChhhhhhh
Q psy5220         161 VCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNT  240 (286)
Q Consensus       161 V~l~dsgGa~i~Eg~~~l~~~~~~~~a~~~l~~~~vP~Isvv~g~~~GGg~~s~a~~~d~via~~~A~i~~~gp~vi~~~  240 (286)
                      |++..|||+|||||+.+|+||+++..++.++++++.|+|+|+++|++||+++|+||++|++||+|.|.|||+|||||+++
T Consensus       161 v~f~aSGGARMQEg~lSLMQMaktsaAl~~l~ea~lpyIsVLt~PTtGGVsASfA~lGDi~iAEP~AlIGFAGpRVIEQT  240 (294)
T COG0777         161 VLFSASGGARMQEGILSLMQMAKTSAALKRLSEAGLPYISVLTDPTTGGVSASFAMLGDIIIAEPGALIGFAGPRVIEQT  240 (294)
T ss_pred             EEEecCcchhHhHHHHHHHHHHHHHHHHHHHHhcCCceEEEecCCCccchhHhHHhccCeeecCcccccccCcchhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCCCCCCCHHHHHHcCccceEeCchhHHHHHHHHHHHHhcCC
Q psy5220         241 VKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQKKS  285 (286)
Q Consensus       241 ~g~~l~~~~~~A~~~~~~G~vD~Vv~~~e~~~~l~~~L~~l~~~~  285 (286)
                      +++++|++||+||+++++|+||.||++.|++.+|..+|..+...+
T Consensus       241 ire~LPegfQ~aEfLlehG~iD~iv~R~elr~tla~ll~~~~~~~  285 (294)
T COG0777         241 IREKLPEGFQTAEFLLEHGMIDMIVHRDELRTTLASLLAKLTPQP  285 (294)
T ss_pred             hcccCCcchhhHHHHHHcCCceeeecHHHHHHHHHHHHHHhCCCC
Confidence            999999999999999999999999999999999999999887643

>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>KOG0540|consensus Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>KOG0540|consensus Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF06833 MdcE: Malonate decarboxylase gamma subunit (MdcE); InterPro: IPR009648 This family consists of several bacterial malonate decarboxylase gamma subunit proteins Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680|consensus Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PF03255 ACCA: Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit; InterPro: IPR001095 This entry contains the alpha subunit the acetyl coenzyme A carboxylase complex (6 Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>KOG0016|consensus Back     alignment and domain information
>KOG1682|consensus Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>KOG1679|consensus Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>KOG1681|consensus Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>KOG0840|consensus Back     alignment and domain information
>KOG1684|consensus Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>TIGR00375 conserved hypothetical protein TIGR00375 Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only] Back     alignment and domain information
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PRK07218 replication factor A; Provisional Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13453 zf-TFIIB: Transcription factor zinc-finger Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2f9y_B304 The Crystal Structure Of The Carboxyltransferase Su 9e-94
2f9i_B285 Crystal Structure Of The Carboxyltransferase Subuni 4e-57
1on3_A 523 Transcarboxylase 12s Crystal Structure: Hexamer Ass 9e-17
1xnv_A 530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 1e-11
3ib9_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422l Lengt 1e-11
3mfm_C 530 Crystal Structures And Mutational Analyses Of Acyl- 1e-11
1xnw_A 530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 1e-11
3ibb_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422a Lengt 1e-11
3iav_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422v Lengt 1e-11
1vrg_A 527 Crystal Structure Of Propionyl-coa Carboxylase, Bet 8e-10
2bzr_A 548 Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Ca 1e-08
2a7s_A 548 Crystal Structure Of The Acyl-Coa Carboxylase, Accd 1e-08
1x0u_A 522 Crystal Structure Of The Carboxyl Transferase Subun 2e-08
3n6r_B 531 Crystal Structure Of The Holoenzyme Of Propionyl-co 9e-07
>pdb|2F9Y|B Chain B, The Crystal Structure Of The Carboxyltransferase Subunit Of Acc From Escherichia Coli Length = 304 Back     alignment and structure 
Iteration: 1

 Score =  339 bits (870), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 151/262 (57%), Positives = 206/262 (78%)
Query: 20  KKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGE 79
           K SIP+G+W KC SC  +LY+ +L+ N +VC KCD+HM++ AR+RL++ LD+ +  E+G 
Sbjct: 16  KASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGS 75
Query: 80  NILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMG 139
            + P D L F+D+ KY +RL  A+K T E DAL+V+KG++  +P+V A FEF FMGGSMG
Sbjct: 76  ELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMG 135
Query: 140 SVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFI 199
           SVVG RF++  + +LE   P +C +A+GGARMQE L+SLMQMAKT+A L K+ ++ +P+I
Sbjct: 136 SVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYI 195
Query: 200 SVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKG 259
           SVLT+PTMGGVSASFA +GD+ IAEP ALIGFAGPRVI+ TV+EKLP GFQ SEFL++KG
Sbjct: 196 SVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKG 255
Query: 260 ALDMIIDRRKLRFKIANLLALL 281
           A+DMI+ R ++R K+A++LA L
Sbjct: 256 AIDMIVRRPEMRLKLASILAKL 277
>pdb|2F9I|B Chain B, Crystal Structure Of The Carboxyltransferase Subunit Of Acc From Staphylococcus Aureus Length = 285 Back     alignment and structure
>pdb|1ON3|A Chain A, Transcarboxylase 12s Crystal Structure: Hexamer Assembly And Substrate Binding To A Multienzyme Core (With Methylmalonyl-Coenzyme A And Methylmalonic Acid Bound) Length = 523 Back     alignment and structure
>pdb|1XNV|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #1 Length = 530 Back     alignment and structure
>pdb|3IB9|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422l Length = 530 Back     alignment and structure
>pdb|3MFM|C Chain C, Crystal Structures And Mutational Analyses Of Acyl-Coa Carboxylase Subunit Of Streptomyces Coelicolor Length = 530 Back     alignment and structure
>pdb|1XNW|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #2, Mutant D422i Length = 530 Back     alignment and structure
>pdb|3IBB|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422a Length = 530 Back     alignment and structure
>pdb|3IAV|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422v Length = 530 Back     alignment and structure
>pdb|1VRG|A Chain A, Crystal Structure Of Propionyl-coa Carboxylase, Beta Subunit (tm0716) From Thermotoga Maritima At 2.30 A Resolution Length = 527 Back     alignment and structure
>pdb|2BZR|A Chain A, Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Carboxylase Beta-Subunit From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>pdb|2A7S|A Chain A, Crystal Structure Of The Acyl-Coa Carboxylase, Accd5, From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>pdb|1X0U|A Chain A, Crystal Structure Of The Carboxyl Transferase Subunit Of Putative Pcc Of Sulfolobus Tokodaii Length = 522 Back     alignment and structure
>pdb|3N6R|B Chain B, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 531 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 1e-175
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 1e-169
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 2e-17
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 9e-17
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 2e-16
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 1e-15
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 5e-15
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 1e-14
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 7e-09
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 8e-09
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 4e-08
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 3e-05
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 6e-05
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Length = 304 Back     alignment and structure
 Score =  484 bits (1248), Expect = e-175
 Identities = 154/284 (54%), Positives = 213/284 (75%), Gaps = 4/284 (1%)

Query: 1   MNWLKNYSFPNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIK 60
           M+W++     N+       K SIP+G+W KC SC  +LY+ +L+ N +VC KCD+HM++ 
Sbjct: 1   MSWIERIK-SNITPTR---KASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMT 56

Query: 61  ARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIM 120
           AR+RL++ LD+ +  E+G  + P D L F+D+ KY +RL  A+K T E DAL+V+KG++ 
Sbjct: 57  ARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLY 116

Query: 121 NLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQ 180
            +P+V A FEF FMGGSMGSVVG RF++  + +LE   P +C +A+GGARMQE L+SLMQ
Sbjct: 117 GMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQ 176

Query: 181 MAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNT 240
           MAKT+A L K+ ++ +P+ISVLT+PTMGGVSASFA +GD+ IAEP ALIGFAGPRVI+ T
Sbjct: 177 MAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQT 236

Query: 241 VKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQKK 284
           V+EKLP GFQ SEFL++KGA+DMI+ R ++R K+A++LA L   
Sbjct: 237 VREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNL 280
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Length = 285 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Length = 523 Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Length = 530 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Length = 548 Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Length = 527 Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Length = 531 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Length = 522 Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Length = 793 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Length = 587 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Length = 588 Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Length = 758 Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Length = 555 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 100.0
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 100.0
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 100.0
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 100.0
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 100.0
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 100.0
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 100.0
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 100.0
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 100.0
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 100.0
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 100.0
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 100.0
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 100.0
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 100.0
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 100.0
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 100.0
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 100.0
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 100.0
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 100.0
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 100.0
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 100.0
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 100.0
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 99.98
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 99.97
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 99.96
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 99.94
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 99.62
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 99.6
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 99.6
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 99.57
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 99.57
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 99.57
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 99.56
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 99.56
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 99.56
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 99.56
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 99.56
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 99.55
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 99.55
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 99.55
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 99.54
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 99.54
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 99.54
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 99.54
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 99.54
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 99.54
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 99.53
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 99.53
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 99.53
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 99.53
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 99.53
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 99.52
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 99.52
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 99.52
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 99.52
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 99.52
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 99.51
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 99.51
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 99.51
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 99.5
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 99.5
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 99.5
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 99.5
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 99.5
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 99.49
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 99.49
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 99.49
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 99.49
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 99.49
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 99.48
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 99.48
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 99.48
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 99.48
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 99.48
4hdt_A 353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 99.48
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 99.48
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 99.48
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 99.47
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 99.47
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 99.46
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 99.46
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 99.46
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 99.46
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 99.44
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 99.43
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 99.43
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 99.43
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 99.43
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 99.43
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 99.43
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 99.42
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 99.42
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 99.41
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 99.41
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 99.4
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 99.39
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 99.34
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 99.34
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 99.32
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 99.29
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.29
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 99.28
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.27
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.15
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.01
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.0
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 98.84
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 98.68
2f6i_A215 ATP-dependent CLP protease, putative; structural g 98.45
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 98.44
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 98.41
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 98.41
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 98.38
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 98.13
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 97.65
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 87.52
3v2d_560 50S ribosomal protein L32; ribosome associated inh 85.31
2akl_A138 PHNA-like protein PA0128; two domains, Zn binding 84.79
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 80.56
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
Probab=100.00  E-value=9.1e-75  Score=528.59  Aligned_cols=276  Identities=39%  Similarity=0.695  Sum_probs=251.6

Q ss_pred             CccccccC---CCCCCCcccccCCCCchhhhcccccccccchhhccccccccccccCCCCCCHHHHHHhhcCCCceEEec
Q psy5220           2 NWLKNYSF---PNLQKNNAFVKKSIPKGLWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIG   78 (286)
Q Consensus         2 ~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~l~~~~~vc~~~~~~~~~~ar~ri~~L~D~gsf~E~~   78 (286)
                      |||++..+   +++..   ..++++|+++|+|||+|++++|.++|+.|+++||.|+||+++++|+||+.|+|+|||.|++
T Consensus         4 ~~~~~~~~~~~~~~~~---~~~~~~~~~l~~kc~~~~~~~y~~~l~~~~~v~p~~~~~~r~~arerI~~L~D~gsF~El~   80 (285)
T 2f9i_B            4 DFFNRTKKKKYLTVQD---SKNNDVPAGIMTKCPKCKKIMYTKELAENLNVCFNCDHHIALTAYKRIEAISDEGSFTEFD   80 (285)
T ss_dssp             -------------------------CCSSEEECTTTCCEEEHHHHHHTTTBCTTTCCBCCCCHHHHHHHTSCTTCCEEES
T ss_pred             hhhhhhhhcccccccc---ccccCCChHHHHhhHhhCCccchhhhHHhcCcCCCCCCCCCCCHHHHHHHHccCCCcEEEC
Confidence            89987532   23332   2567899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcCCCCCCCCccchHHHHHHHhhcCCCCCcEEEEEEEEcCeeEEEEEEcCcccccCCChHHHHHHHHHHHHHHhCCC
Q psy5220          79 ENILPVDTLNFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKI  158 (286)
Q Consensus        79 ~~~~~~d~l~f~~~~~y~~~l~~~~~~~~~~~~vvtG~g~i~G~~v~v~a~d~~~~gGs~~~~~~~K~~r~~~~A~~~~i  158 (286)
                      .+..+.||++|+   .|++||++++++++++++||||+|+|+|++|+|++||++|+|||+++++++|++|++++|.++++
T Consensus        81 ~~~~~~~~l~f~---~y~~~l~~~~~~t~~~~avVtG~g~I~G~~V~v~a~d~~~~gGs~g~~~~~K~~r~ie~A~~~~l  157 (285)
T 2f9i_B           81 KGMTSANPLDFP---SYLEKIEKDQQKTGLKEAVVTGTAQLDGMKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRL  157 (285)
T ss_dssp             TTCEECCTTCCT---THHHHHHHHHHHHCCSSSEEEEEEEETTEEEEEEEECTTTGGGCCCHHHHHHHHHHHHHHHHTTC
T ss_pred             CCcCcCCccccc---chhHHHHHHhhccCCCCeEEEEEEEECCEEEEEEEEccccccCcCCHHHHHHHHHHHHHHHHcCC
Confidence            999999999996   49999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEEEeCCCcchhhchHhHHHHHHHHHHHHHHhcCCCCEEEEEcCCcchhhhhhccccccEEEEcCCcEEEeeChhhhh
Q psy5220         159 PFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIK  238 (286)
Q Consensus       159 PlV~l~dsgGa~i~Eg~~~l~~~~~~~~a~~~l~~~~vP~Isvv~g~~~GGg~~s~a~~~d~via~~~A~i~~~gp~vi~  238 (286)
                      |+|+|+||||+|+|||+.+++||+++++++.+++++++|+|+||+|+|+||+++++++++|+++|||+|.|+|+||++++
T Consensus       158 PlI~l~dsgGar~qEGi~sl~q~aki~~~l~~~s~~~vP~Isvv~g~~~GG~~as~a~~~D~i~a~p~A~i~~aGP~vi~  237 (285)
T 2f9i_B          158 PFILFSASGGARMQEGIISLMQMGKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIE  237 (285)
T ss_dssp             CEEEEEEECSCCGGGHHHHHHHHHHHHHHHHHHHHTTCCEEEEEEEEEEHHHHTTGGGCCSEEEECTTCBEESSCHHHHH
T ss_pred             CEEEEEeCCCcchhhhhhhHhHHHHHHHHHHHHHcCCCCEEEEEeCCccHHHHHHhhhCCCEEEEeCCcEEEEcCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhccCCCCCCCHHHHHHcCccceEeCchhHHHHHHHHHHHHhc
Q psy5220         239 NTVKEKLPDGFQSSEFLLKKGALDMIIDRRKLRFKIANLLALLQK  283 (286)
Q Consensus       239 ~~~g~~l~~~~~~A~~~~~~G~vD~Vv~~~e~~~~l~~~L~~l~~  283 (286)
                      +++++++++++++|++|+++|+||.||+++|+++.|+++|+++..
T Consensus       238 ~~~~~~~~e~~~~Ae~~~~~G~iD~Iv~~~e~r~~l~~~L~~l~~  282 (285)
T 2f9i_B          238 QTINEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQE  282 (285)
T ss_dssp             HHHTSCCCTTTTBHHHHHHTTCCSEECCGGGHHHHHHHHHHHTCC
T ss_pred             HHhcccchHhHhhHHHHHhcCCccEEeChHHHHHHHHHHHHHhhc
Confidence            999999999999999999999999999999999999999999853
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3v2d_5 50S ribosomal protein L32; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_4 2hgj_4 2hgu_4 2j03_5 2jl6_5 2jl8_5 2v47_5 2v49_5 2wdi_5 2wdj_5 2wdl_5 2wdn_5 2wh2_5 2wh4_5 2wrj_5 2wrl_5 2wro_5 2wrr_5 2x9s_5 2x9u_5 ... Back     alignment and structure
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d2f9yb1263 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase 7e-89
d1vrga1251 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase compl 9e-37
d1xnya1258 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase comp 5e-33
d2a7sa1258 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase comp 7e-32
d1on3a1253 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltrans 4e-30
d1pixa2287 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A 4e-15
d2a7sa2271 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase com 2e-14
d1vrga2264 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase com 5e-10
d1uyra1333 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxyla 1e-08
d1uyra1333 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxyla 2e-08
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Biotin dependent carboxylase carboxyltransferase domain
domain: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD
species: Escherichia coli [TaxId: 562]

 Score =  263 bits (673), Expect = 7e-89
 Identities = 146/257 (56%), Positives = 199/257 (77%)

Query: 28  WIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGENILPVDTL 87
           W KC SC  +LY+ +L+ N +VC KCD+HM++ AR+RL++ LD+ +  E+G  + P D L
Sbjct: 2   WTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGSELEPKDVL 61

Query: 88  NFKDNIKYSERLKLAKKNTNETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFI 147
            F+D+ KY +RL  A+K T E DAL+V+KG++  +P+V A FEF FMGGSMGSVVG RF+
Sbjct: 62  KFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFV 121

Query: 148 QGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTAILTKLSKKKIPFISVLTNPTM 207
           +  + +LE   P +C +A+GGARMQE L+SLMQMAKT+A L K+ ++ +P+ISVLT+PTM
Sbjct: 122 RAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTM 181

Query: 208 GGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKGALDMIIDR 267
           GGVSASFA +GD+ IAEP ALIGFAGPRVI+ TV+EKLP GFQ SEFL++KGA+DMI+ R
Sbjct: 182 GGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRR 241

Query: 268 RKLRFKIANLLALLQKK 284
            ++R K+A++LA L   
Sbjct: 242 PEMRLKLASILAKLMNL 258
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Length = 258 Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 258 Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Length = 253 Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Length = 287 Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 271 Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Length = 264 Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 333 Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 100.0
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 100.0
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 100.0
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 100.0
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 100.0
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 100.0
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 100.0
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 100.0
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 100.0
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 100.0
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 100.0
d1uyra1333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 99.97
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 99.97
d1uyra2404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 99.94
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 99.56
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 99.55
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 99.54
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 99.51
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 99.51
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 99.49
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 99.48
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 99.47
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 99.47
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 99.47
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 99.4
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 99.37
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 99.35
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 99.31
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 98.06
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 98.02
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 97.98
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 97.93
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 97.91
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 92.91
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 85.15
d2zjrz158 Ribosomal protein L32p {Deinococcus radiodurans [T 80.97
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Biotin dependent carboxylase carboxyltransferase domain
domain: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.6e-70  Score=493.08  Aligned_cols=258  Identities=57%  Similarity=1.003  Sum_probs=245.5

Q ss_pred             hhhcccccccccchhhccccccccccccCCCCCCHHHHHHhhcCCCceEEecCCCCcCCCCCCCCccchHHHHHHHhhcC
Q psy5220          27 LWIKCLSCKTILYKNDLKFNQQVCTKCDYHMQIKARDRLNNFLDKNNFHEIGENILPVDTLNFKDNIKYSERLKLAKKNT  106 (286)
Q Consensus        27 ~~~~c~~c~~~~~~~~l~~~~~vc~~~~~~~~~~ar~ri~~L~D~gsf~E~~~~~~~~d~l~f~~~~~y~~~l~~~~~~~  106 (286)
                      +|+|||+|++++|++||+.|++|||+|+||+||++||||+.|+|+|||+|++.+..+.|||+|.|.+.|.+++++++++|
T Consensus         1 ~W~~C~~C~~~~~~~~l~~~~~vC~~C~~h~~ltaReRi~~L~D~gsf~Ei~~~~~~~d~l~~~d~~~y~~~~~~~~~~t   80 (263)
T d2f9yb1           1 VWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKET   80 (263)
T ss_dssp             CEECCTTTCCCEETTHHHHTTTBCTTTCCBCCCCHHHHHHHHSCSSCCEECSCSCCCCCSSCCSSGGGTC------CCSS
T ss_pred             CcCcCCCCcceeeHHHHHHhCCCCcCCCCCCCcCHHHHHHHHccCCceEEeCCCcccCCchhcccccccccchhhhcccc
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcEEEEEEEEcCeeEEEEEEcCcccccCCChHHHHHHHHHHHHHHhCCCcEEEEEeCCCcchhhchHhHHHHHHHHH
Q psy5220         107 NETDALIVIKGSIMNLPLVVAVFEFEFMGGSMGSVVGERFIQGAQISLEQKIPFVCITATGGARMQEGLLSLMQMAKTTA  186 (286)
Q Consensus       107 ~~~~~vvtG~g~i~G~~v~v~a~d~~~~gGs~~~~~~~K~~r~~~~A~~~~iPlV~l~dsgGa~i~Eg~~~l~~~~~~~~  186 (286)
                      +.++++|||+|+|+|++|+|+++||+|+|||+|..+++|+.+++++|.+.++|+|.|.+|||+||||+..++++|.++..
T Consensus        81 g~~d~vv~g~G~i~G~~v~v~a~Dftv~gGS~g~~~~~Ki~~a~e~A~~~~lPlI~~~~sgG~r~~e~~~sl~~~~~~~~  160 (263)
T d2f9yb1          81 GEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSA  160 (263)
T ss_dssp             CCSSSEEEEECEETTEECBEEEECTTSTTTCBCTHHHHHHHHHHHHHHHHTCCEEEEEEESSBCGGGTHHHHHHHHHHHH
T ss_pred             CCCCceEEEEEEECCEEEEEEeeeehhhccccccchhhHHhHHHHHHHHcCCCeEEEecCCCcccccccchhhcchhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             HHHHHhcCCCCEEEEEcCCcchhhhhhccccccEEEEcCCcEEEeeChhhhhhhhhccCCCCCCCHHHHHHcCccceEeC
Q psy5220         187 ILTKLSKKKIPFISVLTNPTMGGVSASFAFMGDIVIAEPGALIGFAGPRVIKNTVKEKLPDGFQSSEFLLKKGALDMIID  266 (286)
Q Consensus       187 a~~~l~~~~vP~Isvv~g~~~GGg~~s~a~~~d~via~~~A~i~~~gp~vi~~~~g~~l~~~~~~A~~~~~~G~vD~Vv~  266 (286)
                      ++..++..++|+|+|++|+|+||+++++++++|++|+++++.|+++||++|++++|+++++++++++.|.++|+||.|++
T Consensus       161 ~~~~~~~~~vP~I~v~~g~~~GG~aa~~~~~~d~i~~~~~s~i~~aGP~vve~~~ge~~~e~~g~a~~~~~~G~iD~vv~  240 (263)
T d2f9yb1         161 ALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVR  240 (263)
T ss_dssp             HHHHHHHTTCCEEEEEEEEEEHHHHTTGGGCCSEEEECTTCBEESSCHHHHHHHHTSCCCTTTTBHHHHGGGTCCSEECC
T ss_pred             HHHHHHhCCCceEEEecCCcchHHHhhhhhcCceEeeecceeeeccCHHHHhhhcCCcCChhhccHHHHHhCCCCCEEEC
Confidence            88888889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhHHHHHHHHHHHHhcC
Q psy5220         267 RRKLRFKIANLLALLQKK  284 (286)
Q Consensus       267 ~~e~~~~l~~~L~~l~~~  284 (286)
                      ++|.++.|.++|++|...
T Consensus       241 ~ee~~~~l~~~l~~L~~~  258 (263)
T d2f9yb1         241 RPEMRLKLASILAKLMNL  258 (263)
T ss_dssp             HHHHHHHHHHHHHHHTTC
T ss_pred             CHHHHHHHHHHHHHHhhC
Confidence            999999999999999754
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure