Psyllid ID: psy5230
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 258 | 2.2.26 [Sep-21-2011] | |||||||
| Q1H4Y0 | 308 | Methionyl-tRNA formyltran | yes | N/A | 0.922 | 0.772 | 0.297 | 1e-29 | |
| B2VK94 | 315 | Methionyl-tRNA formyltran | yes | N/A | 0.922 | 0.755 | 0.307 | 3e-27 | |
| B2T1K6 | 328 | Methionyl-tRNA formyltran | yes | N/A | 0.934 | 0.734 | 0.269 | 6e-26 | |
| A6SU87 | 316 | Methionyl-tRNA formyltran | yes | N/A | 0.612 | 0.5 | 0.366 | 1e-25 | |
| A3NQ23 | 327 | Methionyl-tRNA formyltran | yes | N/A | 0.930 | 0.733 | 0.249 | 1e-24 | |
| Q6LLJ2 | 314 | Methionyl-tRNA formyltran | yes | N/A | 0.899 | 0.738 | 0.278 | 2e-24 | |
| Q2T2B1 | 328 | Methionyl-tRNA formyltran | yes | N/A | 0.569 | 0.448 | 0.344 | 2e-24 | |
| Q62MT4 | 327 | Methionyl-tRNA formyltran | yes | N/A | 0.930 | 0.733 | 0.252 | 3e-24 | |
| Q63YR6 | 327 | Methionyl-tRNA formyltran | yes | N/A | 0.930 | 0.733 | 0.252 | 3e-24 | |
| Q3JXE1 | 327 | Methionyl-tRNA formyltran | yes | N/A | 0.930 | 0.733 | 0.249 | 3e-24 |
| >sp|Q1H4Y0|FMT_METFK Methionyl-tRNA formyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=fmt PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 130 bits (326), Expect = 1e-29, Method: Compositional matrix adjust.
Identities = 91/306 (29%), Positives = 142/306 (46%), Gaps = 68/306 (22%)
Query: 1 MKIIFAGTSISAAAILDTLYNSEHNIVLILTKPDLHSGRGMKLNFSPVKKYALKHSIKII 60
MKII+AGT A L L S H + L+LT+PD +GRG+KL SPVK AL+H I ++
Sbjct: 1 MKIIYAGTPDFAVPALRALIQSSHEVSLVLTQPDRPAGRGLKLKPSPVKSLALEHGIPLL 60
Query: 61 QPISLKLNGKYHKIANETHKLLNKIEFDIMIVMGILP----------------------- 97
QP +LK +IA E L + ++I +L
Sbjct: 61 QPETLKDEAVQARIAAEHADALVVAAYGLIIPATVLSMPRYGCYNIHASLLPRWRGAAPI 120
Query: 98 --------EDTSLTLQNKLEKL--SKILIIDTIKKIEYDMT------------------- 128
++T +T+ + L +++ T+ E+D
Sbjct: 121 QRALLAGDKETGVTIMEVVPALDAGAMILRGTLPITEHDTAQTLHDGLAEIGAELMLQAM 180
Query: 129 -------KLFFKPQSNIGESYAPLIKKNEAVLDWSLSAKTIMRKINAFNPFPGAKTYYIS 181
+L +PQ +YA ++K EAV+DW +A + R++ AFNPFP A +
Sbjct: 181 DKLEREGRLEAEPQDESLVTYAQKLQKAEAVIDWRKNADELSRQVRAFNPFPVAHSTL-- 238
Query: 182 YQNKKKFLKIWKAHALSIESTKKPGTILNVNFHNGILVVCGKNVIKLLELQKNNKKKISA 241
K + +IW A A+S T +PG I +V+ NGILV CG+ ++++ ELQ K++ A
Sbjct: 239 ---KGETCRIWMAQAVS--GTAEPGMIASVD--NGILVGCGRGLLRIDELQLPGGKRLQA 291
Query: 242 TEFING 247
+F+ G
Sbjct: 292 KDFLAG 297
|
Modifies the free amino group of the aminoacyl moiety of methionyl-tRNA(fMet). The formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by: (I) promoting its recognition by IF2 and (II) impairing its binding to EFTu-GTP. Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) (taxid: 265072) EC: 2EC: .EC: 1EC: .EC: 2EC: .EC: 9 |
| >sp|B2VK94|FMT_ERWT9 Methionyl-tRNA formyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fmt PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B2T1K6|FMT_BURPP Methionyl-tRNA formyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=fmt PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A6SU87|FMT_JANMA Methionyl-tRNA formyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=fmt PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A3NQ23|FMT_BURP0 Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=fmt PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q6LLJ2|FMT_PHOPR Methionyl-tRNA formyltransferase OS=Photobacterium profundum GN=fmt PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q2T2B1|FMT_BURTA Methionyl-tRNA formyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fmt PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q62MT4|FMT_BURMA Methionyl-tRNA formyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=fmt PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q63YR6|FMT_BURPS Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=fmt PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q3JXE1|FMT_BURP1 Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=fmt PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 258 | ||||||
| 300313635 | 317 | methionyl-tRNA formyltransferase [Herbas | 0.937 | 0.763 | 0.345 | 1e-42 | |
| 415945715 | 317 | Methionyl-tRNA formyltransferase [Herbas | 0.937 | 0.763 | 0.338 | 3e-42 | |
| 409408140 | 317 | methionyl-tRNA formyltransferase [Herbas | 0.937 | 0.763 | 0.335 | 1e-41 | |
| 399021097 | 317 | methionyl-tRNA formyltransferase [Herbas | 0.937 | 0.763 | 0.348 | 5e-41 | |
| 323524424 | 328 | methionyl-tRNA formyltransferase [Burkho | 0.937 | 0.737 | 0.302 | 2e-35 | |
| 340789289 | 339 | methionyl-tRNA formyltransferase [Collim | 0.930 | 0.707 | 0.318 | 7e-35 | |
| 383756316 | 313 | methionyl-tRNA formyltransferase Fmt [Ru | 0.926 | 0.763 | 0.282 | 7e-33 | |
| 445494840 | 318 | methionyl-tRNA formyltransferase Fmt [Ja | 0.937 | 0.761 | 0.321 | 7e-33 | |
| 350544371 | 329 | Methionyl-tRNA formyltransferase [Candid | 0.957 | 0.750 | 0.304 | 1e-31 | |
| 307728143 | 328 | methionyl-tRNA formyltransferase [Burkho | 0.937 | 0.737 | 0.296 | 2e-30 |
| >gi|300313635|ref|YP_003777727.1| methionyl-tRNA formyltransferase [Herbaspirillum seropedicae SmR1] gi|300076420|gb|ADJ65819.1| methionyl-tRNA formyltransferase protein [Herbaspirillum seropedicae SmR1] | Back alignment and taxonomy information |
|---|
Score = 179 bits (453), Expect = 1e-42, Method: Compositional matrix adjust.
Identities = 108/313 (34%), Positives = 153/313 (48%), Gaps = 71/313 (22%)
Query: 1 MKIIFAGTSISAAAILDTLYNSEHNIVLILTKPDLHSGRGMKLNFSPVKKYALKHSIKII 60
MKIIFAGT AA L+ LY + H I L+LT+PD +GRGM+L SPVK+ ALKH +
Sbjct: 1 MKIIFAGTPEFAAVALEALYAAGHEITLVLTQPDRPAGRGMQLQASPVKQCALKHGTPVA 60
Query: 61 QPISLKLNGKYHKIANETHKLLNKIEFDIMIVMG---ILPE------------------- 98
QP+SL+L+GKY ++A E H LL D+MIV ILP
Sbjct: 61 QPVSLRLDGKYPEVAQEAHALLRSTPHDVMIVAAYGLILPRSVLDIPRYGCINIHGSLLP 120
Query: 99 -----------------DTSLTLQNKLEKL--SKILIIDTIKKIEYDMTK---------- 129
+T +T+ E L +++I+++ + D T
Sbjct: 121 RWRGAAPIHRAIEAGDAETGITIMQMEEGLDTGPMMLIESLPISDEDTTGSLHDKLAALG 180
Query: 130 ---------------LFFKPQSNIGESYAPLIKKNEAVLDWSLSAKTIMRKINAFNPFPG 174
L PQ G +YA I K EA LD+S SA+ + R+I AFNPFPG
Sbjct: 181 AKMIVEAMEKLEQGTLPATPQPEQGANYAAKIAKEEAALDFSQSAEQLARRIRAFNPFPG 240
Query: 175 AKTYYISYQNKKKFLKIWKAHALSIESTKKPGTILNVNFHNGILVVCGKNVIKLLELQKN 234
A + +K+WKA A+++ +PG +L+ + GI+V CG+ + L ELQK
Sbjct: 241 ATGRF-----GDTVVKLWKARAVTVAQQGEPGQVLSADAQGGIVVACGEGALLLTELQKP 295
Query: 235 NKKKISATEFING 247
K++ A EF+ G
Sbjct: 296 GGKRLPAAEFLKG 308
|
Source: Herbaspirillum seropedicae SmR1 Species: Herbaspirillum seropedicae Genus: Herbaspirillum Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|415945715|ref|ZP_11556427.1| Methionyl-tRNA formyltransferase [Herbaspirillum frisingense GSF30] gi|407758270|gb|EKF68118.1| Methionyl-tRNA formyltransferase [Herbaspirillum frisingense GSF30] | Back alignment and taxonomy information |
|---|
| >gi|409408140|ref|ZP_11256584.1| methionyl-tRNA formyltransferase [Herbaspirillum sp. GW103] gi|386432596|gb|EIJ45423.1| methionyl-tRNA formyltransferase [Herbaspirillum sp. GW103] | Back alignment and taxonomy information |
|---|
| >gi|399021097|ref|ZP_10723216.1| methionyl-tRNA formyltransferase [Herbaspirillum sp. CF444] gi|398093081|gb|EJL83471.1| methionyl-tRNA formyltransferase [Herbaspirillum sp. CF444] | Back alignment and taxonomy information |
|---|
| >gi|323524424|ref|YP_004226577.1| methionyl-tRNA formyltransferase [Burkholderia sp. CCGE1001] gi|323381426|gb|ADX53517.1| methionyl-tRNA formyltransferase [Burkholderia sp. CCGE1001] | Back alignment and taxonomy information |
|---|
| >gi|340789289|ref|YP_004754754.1| methionyl-tRNA formyltransferase [Collimonas fungivorans Ter331] gi|340554556|gb|AEK63931.1| Methionyl-tRNA formyltransferase [Collimonas fungivorans Ter331] | Back alignment and taxonomy information |
|---|
| >gi|383756316|ref|YP_005435301.1| methionyl-tRNA formyltransferase Fmt [Rubrivivax gelatinosus IL144] gi|381376985|dbj|BAL93802.1| methionyl-tRNA formyltransferase Fmt [Rubrivivax gelatinosus IL144] | Back alignment and taxonomy information |
|---|
| >gi|445494840|ref|ZP_21461884.1| methionyl-tRNA formyltransferase Fmt [Janthinobacterium sp. HH01] gi|444791001|gb|ELX12548.1| methionyl-tRNA formyltransferase Fmt [Janthinobacterium sp. HH01] | Back alignment and taxonomy information |
|---|
| >gi|350544371|ref|ZP_08913990.1| Methionyl-tRNA formyltransferase [Candidatus Burkholderia kirkii UZHbot1] gi|350527836|emb|CCD37198.1| Methionyl-tRNA formyltransferase [Candidatus Burkholderia kirkii UZHbot1] | Back alignment and taxonomy information |
|---|
| >gi|307728143|ref|YP_003905367.1| methionyl-tRNA formyltransferase [Burkholderia sp. CCGE1003] gi|307582678|gb|ADN56076.1| methionyl-tRNA formyltransferase [Burkholderia sp. CCGE1003] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 258 | ||||||
| UNIPROTKB|P23882 | 315 | fmt "10-formyltetrahydrofolate | 0.558 | 0.457 | 0.322 | 1.9e-29 | |
| TIGR_CMR|CBU_1997 | 314 | CBU_1997 "methionyl-tRNA formy | 0.558 | 0.458 | 0.296 | 3.8e-28 | |
| TIGR_CMR|SO_0031 | 318 | SO_0031 "methionyl-tRNA formyl | 0.348 | 0.283 | 0.445 | 1e-25 | |
| TIGR_CMR|CHY_1483 | 308 | CHY_1483 "methionyl-tRNA formy | 0.565 | 0.474 | 0.326 | 1.6e-23 | |
| UNIPROTKB|Q9KVU4 | 315 | fmt "Methionyl-tRNA formyltran | 0.341 | 0.279 | 0.377 | 9.3e-22 | |
| TIGR_CMR|VC_0045 | 315 | VC_0045 "methionyl-tRNA formyl | 0.341 | 0.279 | 0.377 | 9.3e-22 | |
| TIGR_CMR|CPS_0019 | 327 | CPS_0019 "methionyl-tRNA formy | 0.348 | 0.275 | 0.425 | 1.2e-20 | |
| TIGR_CMR|GSU_0130 | 317 | GSU_0130 "methionyl-tRNA formy | 0.546 | 0.444 | 0.284 | 1e-17 | |
| TIGR_CMR|SPO_3216 | 301 | SPO_3216 "methionyl-tRNA formy | 0.534 | 0.458 | 0.281 | 2.7e-12 | |
| TIGR_CMR|BA_4004 | 314 | BA_4004 "methionyl-tRNA formyl | 0.286 | 0.235 | 0.310 | 7.5e-11 |
| UNIPROTKB|P23882 fmt "10-formyltetrahydrofolate:L-methionyl-tRNAfMet N-formyltransferase" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
Score = 185 (70.2 bits), Expect = 1.9e-29, Sum P(2) = 1.9e-29
Identities = 49/152 (32%), Positives = 78/152 (51%)
Query: 95 ILPEDTSLTLQNKLEKLSKILIIDTIKKIEYDMTKLFFKPQSNIGESYAPLIKKNEAVLD 154
I EDTS TL +KL +L +I T+K++ K + ++ + +YA + K EA +D
Sbjct: 159 ITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLV--TYAEKLSKEEARID 216
Query: 155 WSLSAKTIMRKINAFNPFPGAKTYYISYQNKKKFLKIWKAHALSIESTKKPGTILNVNFH 214
WSLSA + R I AFNP+P + ++ + + +K+WKA + + PGTIL N
Sbjct: 217 WSLSAAQLERCIRAFNPWPMS---WLEIEGQP--VKVWKASVIDTATNAAPGTILEAN-K 270
Query: 215 NGILVVCGKNVIXXXXXXXXXXXXISATEFIN 246
GI V G ++ +SA + +N
Sbjct: 271 QGIQVATGDGILNLLSLQPAGKKAMSAQDLLN 302
|
|
| TIGR_CMR|CBU_1997 CBU_1997 "methionyl-tRNA formyltransferase" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_0031 SO_0031 "methionyl-tRNA formyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1483 CHY_1483 "methionyl-tRNA formyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KVU4 fmt "Methionyl-tRNA formyltransferase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0045 VC_0045 "methionyl-tRNA formyltransferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0019 CPS_0019 "methionyl-tRNA formyltransferase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0130 GSU_0130 "methionyl-tRNA formyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_3216 SPO_3216 "methionyl-tRNA formyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4004 BA_4004 "methionyl-tRNA formyltransferase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| B2VK94 | FMT_ERWT9 | 2, ., 1, ., 2, ., 9 | 0.3071 | 0.9224 | 0.7555 | yes | N/A |
| Q3AC19 | FMT_CARHZ | 2, ., 1, ., 2, ., 9 | 0.3009 | 0.9108 | 0.7629 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.1.2 | 0.766 |
| 4th Layer | 2.1.2.9 | 0.824 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 258 | |||
| PRK00005 | 309 | PRK00005, fmt, methionyl-tRNA formyltransferase; R | 1e-40 | |
| COG0223 | 307 | COG0223, Fmt, Methionyl-tRNA formyltransferase [Tr | 3e-37 | |
| pfam02911 | 100 | pfam02911, Formyl_trans_C, Formyl transferase, C-t | 5e-26 | |
| TIGR00460 | 313 | TIGR00460, fmt, methionyl-tRNA formyltransferase | 2e-25 | |
| cd08704 | 87 | cd08704, Met_tRNA_FMT_C, C-terminal domain of Form | 5e-25 | |
| cd08646 | 204 | cd08646, FMT_core_Met-tRNA-FMT_N, Methionyl-tRNA f | 2e-24 | |
| PRK00005 | 309 | PRK00005, fmt, methionyl-tRNA formyltransferase; R | 3e-24 | |
| COG0223 | 307 | COG0223, Fmt, Methionyl-tRNA formyltransferase [Tr | 2e-21 | |
| PRK08125 | 660 | PRK08125, PRK08125, bifunctional UDP-glucuronic ac | 3e-12 | |
| cd08702 | 92 | cd08702, Arna_FMT_C, C-terminal subdomain of the f | 6e-12 | |
| TIGR00460 | 313 | TIGR00460, fmt, methionyl-tRNA formyltransferase | 1e-11 | |
| PLN02285 | 334 | PLN02285, PLN02285, methionyl-tRNA formyltransfera | 1e-08 | |
| cd08700 | 100 | cd08700, FMT_C_OzmH_like, C-terminal subdomain of | 6e-08 | |
| cd08646 | 204 | cd08646, FMT_core_Met-tRNA-FMT_N, Methionyl-tRNA f | 6e-06 | |
| PLN02285 | 334 | PLN02285, PLN02285, methionyl-tRNA formyltransfera | 3e-05 | |
| cd08651 | 180 | cd08651, FMT_core_like_4, Formyl transferase catal | 3e-04 | |
| cd08370 | 73 | cd08370, FMT_C_like, Carboxy-terminal domain of Fo | 0.002 |
| >gnl|CDD|234567 PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed | Back alignment and domain information |
|---|
Score = 141 bits (359), Expect = 1e-40
Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 8/153 (5%)
Query: 95 ILPEDTSLTLQNKLEKLSKILIIDTIKKIEYDMTKLFFKPQSNIGESYAPLIKKNEAVLD 154
I P DT+ L +KL +L L+++T+K +E L PQ G +YAP I K EA +D
Sbjct: 155 ITPTDTAGELHDKLAELGADLLVETLKGLE--DGTLTPIPQDEEGVTYAPKISKEEARID 212
Query: 155 WSLSAKTIMRKINAFNPFPGAKTYYISYQNKKKFLKIWKAHALSIESTKKPGTILNVNFH 214
WS A + I FNP+PGA + ++ LKI +A + + PGTIL ++
Sbjct: 213 WSKPAAELENHIRGFNPWPGA---WTELDGQR--LKILEAELVEASGSGAPGTILAID-K 266
Query: 215 NGILVVCGKNVIKLLELQKNNKKKISATEFING 247
+GI+V G+ ++L +LQ KK +SA +F+NG
Sbjct: 267 DGIVVATGEGALRLTQLQPPGKKPMSAADFLNG 299
|
Length = 309 |
| >gnl|CDD|223301 COG0223, Fmt, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|217282 pfam02911, Formyl_trans_C, Formyl transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|232983 TIGR00460, fmt, methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|187732 cd08704, Met_tRNA_FMT_C, C-terminal domain of Formyltransferase and other enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|187715 cd08646, FMT_core_Met-tRNA-FMT_N, Methionyl-tRNA formyltransferase, N-terminal hydrolase domain | Back alignment and domain information |
|---|
| >gnl|CDD|234567 PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223301 COG0223, Fmt, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|236156 PRK08125, PRK08125, bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187730 cd08702, Arna_FMT_C, C-terminal subdomain of the formyltransferase domain on ArnA, which modifies lipid A with 4-amino-4-deoxy-l-arabinose | Back alignment and domain information |
|---|
| >gnl|CDD|232983 TIGR00460, fmt, methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215159 PLN02285, PLN02285, methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|187728 cd08700, FMT_C_OzmH_like, C-terminal subdomain of the Formyltransferase-like domain found in OzmH-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|187715 cd08646, FMT_core_Met-tRNA-FMT_N, Methionyl-tRNA formyltransferase, N-terminal hydrolase domain | Back alignment and domain information |
|---|
| >gnl|CDD|215159 PLN02285, PLN02285, methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|187720 cd08651, FMT_core_like_4, Formyl transferase catalytic core domain found in a group of proteins with unknown functions | Back alignment and domain information |
|---|
| >gnl|CDD|187727 cd08370, FMT_C_like, Carboxy-terminal domain of Formyltransferase and similar domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 258 | |||
| COG0223 | 307 | Fmt Methionyl-tRNA formyltransferase [Translation, | 100.0 | |
| TIGR00460 | 313 | fmt methionyl-tRNA formyltransferase. The top-scor | 100.0 | |
| PRK00005 | 309 | fmt methionyl-tRNA formyltransferase; Reviewed | 100.0 | |
| PLN02285 | 334 | methionyl-tRNA formyltransferase | 100.0 | |
| PRK06988 | 312 | putative formyltransferase; Provisional | 100.0 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 100.0 | |
| KOG2452|consensus | 881 | 99.96 | ||
| PF02911 | 100 | Formyl_trans_C: Formyl transferase, C-terminal dom | 99.96 | |
| PRK07579 | 245 | hypothetical protein; Provisional | 99.92 | |
| KOG3082|consensus | 338 | 99.82 | ||
| PF00551 | 181 | Formyl_trans_N: Formyl transferase; InterPro: IPR0 | 99.5 | |
| PRK05647 | 200 | purN phosphoribosylglycinamide formyltransferase; | 99.39 | |
| TIGR00639 | 190 | PurN phosphoribosylglycinamide formyltransferase, | 99.39 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 99.14 | |
| PLN02331 | 207 | phosphoribosylglycinamide formyltransferase | 99.1 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 99.09 | |
| PLN02828 | 268 | formyltetrahydrofolate deformylase | 98.9 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 98.82 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 98.77 | |
| COG0299 | 200 | PurN Folate-dependent phosphoribosylglycinamide fo | 98.58 | |
| KOG3076|consensus | 206 | 97.6 | ||
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 96.81 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 95.7 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 95.06 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 94.95 | |
| TIGR01761 | 343 | thiaz-red thiazolinyl imide reductase. This reduct | 94.7 | |
| TIGR00715 | 256 | precor6x_red precorrin-6x reductase. This enzyme w | 93.97 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 92.32 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 92.31 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 92.13 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 92.1 | |
| KOG2741|consensus | 351 | 91.58 | ||
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 91.34 | |
| PF00289 | 110 | CPSase_L_chain: Carbamoyl-phosphate synthase L cha | 91.04 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 90.54 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 90.12 | |
| CHL00073 | 457 | chlN photochlorophyllide reductase subunit N | 89.91 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 89.85 | |
| PF10686 | 71 | DUF2493: Protein of unknown function (DUF2493); In | 89.31 | |
| TIGR00290 | 223 | MJ0570_dom MJ0570-related uncharacterized domain. | 88.93 | |
| PRK08300 | 302 | acetaldehyde dehydrogenase; Validated | 88.88 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 88.65 | |
| TIGR03215 | 285 | ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati | 88.56 | |
| PRK09288 | 395 | purT phosphoribosylglycinamide formyltransferase 2 | 88.52 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 88.15 | |
| TIGR03023 | 451 | WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp | 88.12 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 88.05 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 88.02 | |
| COG0673 | 342 | MviM Predicted dehydrogenases and related proteins | 87.73 | |
| TIGR00289 | 222 | conserved hypothetical protein TIGR00289. Homologo | 87.71 | |
| PRK08462 | 445 | biotin carboxylase; Validated | 87.46 | |
| PRK00726 | 357 | murG undecaprenyldiphospho-muramoylpentapeptide be | 87.22 | |
| cd01974 | 435 | Nitrogenase_MoFe_beta Nitrogenase_MoFe_beta: Nitro | 87.21 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 87.07 | |
| ), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844 | 100 | GARS_N: Phosphoribosylglycinamide synthetase, N do | 87.03 | |
| PRK02910 | 519 | light-independent protochlorophyllide reductase su | 86.64 | |
| COG0345 | 266 | ProC Pyrroline-5-carboxylate reductase [Amino acid | 86.49 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 86.12 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 85.95 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 85.89 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 85.85 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 85.49 | |
| COG3804 | 350 | Uncharacterized conserved protein related to dihyd | 85.29 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 84.55 | |
| TIGR03025 | 445 | EPS_sugtrans exopolysaccharide biosynthesis polypr | 84.53 | |
| PRK07178 | 472 | pyruvate carboxylase subunit A; Validated | 84.49 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 84.35 | |
| TIGR01278 | 511 | DPOR_BchB light-independent protochlorophyllide re | 84.27 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 84.21 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 84.21 | |
| COG4693 | 361 | PchG Oxidoreductase (NAD-binding), involved in sid | 84.18 | |
| PRK06270 | 341 | homoserine dehydrogenase; Provisional | 84.16 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 84.11 | |
| TIGR03022 | 456 | WbaP_sugtrans Undecaprenyl-phosphate galactose pho | 83.7 | |
| TIGR01133 | 348 | murG undecaprenyldiphospho-muramoylpentapeptide be | 83.33 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 83.22 | |
| cd03466 | 429 | Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup | 82.99 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 82.65 | |
| cd01965 | 428 | Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_l | 82.64 | |
| PRK06111 | 450 | acetyl-CoA carboxylase biotin carboxylase subunit; | 82.62 | |
| cd01994 | 194 | Alpha_ANH_like_IV This is a subfamily of Adenine n | 82.21 | |
| KOG0780|consensus | 483 | 82.07 | ||
| PF01902 | 218 | ATP_bind_4: ATP-binding region; InterPro: IPR00276 | 81.88 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 81.76 | |
| PF04007 | 335 | DUF354: Protein of unknown function (DUF354); Inte | 81.56 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 81.26 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 81.22 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 81.2 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 80.85 | |
| PRK08463 | 478 | acetyl-CoA carboxylase subunit A; Validated | 80.77 |
| >COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-64 Score=440.12 Aligned_cols=238 Identities=40% Similarity=0.621 Sum_probs=230.4
Q ss_pred CeEEEEcCCHHHHHHHHHHHhCCCcEEEEEcCCCCCCCCCCccCCcHHHHHHHHCCCcEEccCCCCCCcccccchHHHHH
Q psy5230 1 MKIIFAGTSISAAAILDTLYNSEHNIVLILTKPDLHSGRGMKLNFSPVKKYALKHSIKIIQPISLKLNGKYHKIANETHK 80 (258)
Q Consensus 1 mrI~f~Gs~~fa~~~L~~L~~~~~~i~~Vvt~pd~~~gr~~~~~~~~v~~~A~~~gIpv~~~~~~~~~~~~~~~~~~~~~ 80 (258)
|||+||||++||+++|++|++++|+|++|+|+||++.|||+++.+|||+++|.++|||+|+|++++++ ++++
T Consensus 2 mkivF~GTp~fa~~~L~~L~~~~~eivaV~Tqpdkp~gR~~~l~~spVk~~A~~~~ipv~qP~~l~~~--------e~~~ 73 (307)
T COG0223 2 MRIVFFGTPEFAVPSLEALIEAGHEIVAVVTQPDKPAGRGKKLTPSPVKRLALELGIPVFQPEKLNDP--------EFLE 73 (307)
T ss_pred cEEEEEcCchhhHHHHHHHHhCCCceEEEEeCCCCccCCCCcCCCChHHHHHHHcCCceeccccCCcH--------HHHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999987 9999
Q ss_pred HHhcCCCcEEEEE-------------------------------------------------------------------
Q psy5230 81 LLNKIEFDIMIVM------------------------------------------------------------------- 93 (258)
Q Consensus 81 ~l~~~~~Dl~vv~------------------------------------------------------------------- 93 (258)
.+++++||++||+
T Consensus 74 ~l~~l~~D~ivvvayG~ilp~~iL~~~~~G~iNvH~SLLPr~RGaAPIq~aI~~Gd~~TGvTim~M~~~lDaG~Il~q~~ 153 (307)
T COG0223 74 ELAALDPDLIVVVAYGQILPKEILDLPPYGCINLHPSLLPRYRGAAPIQWAILNGDTETGVTIMQMDEGLDAGDILAQRE 153 (307)
T ss_pred HHhccCCCEEEEEehhhhCCHHHHhcCcCCeEEecCccCccccCccHHHHHHHcCCcccceEEEEccccCCCcceeeeEE
Confidence 9999999999999
Q ss_pred -eeCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCccccCCCCCCCCcCCCCCcccccccccccHHHHHHHHhhcCCC
Q psy5230 94 -GILPEDTSLTLQNKLEKLSKILIIDTIKKIEYDMTKLFFKPQSNIGESYAPLIKKNEAVLDWSLSAKTIMRKINAFNPF 172 (258)
Q Consensus 94 -~I~~~dt~~~L~~kl~~~g~~ll~~~l~~l~~~~g~~~~~~Q~~~~atya~k~~~~d~~IdW~~~a~~I~~~iRA~~p~ 172 (258)
+|.++||+.+|++||+..|++||+++|..+.. |++.+.+|+++++|||+|++++|+.|||+++|.+|+|+|||++||
T Consensus 154 ~~I~~~dta~~L~~kLa~~ga~lL~~~L~~i~~--g~~~~~~Q~e~~~tya~ki~ked~~Idw~~~a~~i~n~IRa~~P~ 231 (307)
T COG0223 154 VPIEPDDTAGSLHDKLAELGAELLLETLPQLEA--GTLTPIPQDEEEATYAPKITKEDGRIDWSKPAAQILNKIRAFNPW 231 (307)
T ss_pred eccCCcccHHHHHHHHHHHHHHHHHHHHHHHhc--CCCCCCCCCcccCccccCCCHHHcccCCccCHHHHHHHHhccCCC
Confidence 99999999999999999999999999999999 999999999999999999999999999999999999999999999
Q ss_pred CceEEEEEeccCCCceEEEEEEEEccCCCCCCCcEEEEEeeCCcEEEEecCcEEEEEEEecCCCCccCHHHHhccccCCC
Q psy5230 173 PGAKTYYISYQNKKKFLKIWKAHALSIESTKKPGTILNVNFHNGILVVCGKNVIKLLELQKNNKKKISATEFINGCIKNI 252 (258)
Q Consensus 173 pga~~~~~~~~~~g~~i~i~~a~~~~~~~~~~pG~i~~~~~~~~l~V~c~dg~l~i~~lq~~gkk~~~a~~f~~g~~~~~ 252 (258)
||||+.+ + ++++||+++++.+......||+|+..+ +++++|+|++|.|+|.++|++|||.|++.+|+||.++..
T Consensus 232 Pga~~~~---~--~~~iki~~a~~~~~~~~~~pG~i~~~~-~~~l~Va~~~g~l~l~~lQ~~gkk~~~~~~~l~g~~~~~ 305 (307)
T COG0223 232 PGAWTEL---G--GKRIKIWEARVLEGASNGKPGEILAAD-KKGLLVACGDGALRLTELQPAGKKAMSAADFLNGRRLVK 305 (307)
T ss_pred CceEEEE---C--CeEEEEEEEEEccccccCCCcceEEec-CCcEEEEeCCceEEEEeeccCCCCCCCHHHHhccccccc
Confidence 9999999 8 999999999998765457999999988 789999999999999999999999999999999999877
Q ss_pred cc
Q psy5230 253 KY 254 (258)
Q Consensus 253 g~ 254 (258)
|.
T Consensus 306 g~ 307 (307)
T COG0223 306 GA 307 (307)
T ss_pred CC
Confidence 63
|
|
| >TIGR00460 fmt methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02285 methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >PRK06988 putative formyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG2452|consensus | Back alignment and domain information |
|---|
| >PF02911 Formyl_trans_C: Formyl transferase, C-terminal domain; InterPro: IPR005793 Methionyl-tRNA formyltransferase (2 | Back alignment and domain information |
|---|
| >PRK07579 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3082|consensus | Back alignment and domain information |
|---|
| >PF00551 Formyl_trans_N: Formyl transferase; InterPro: IPR002376 A number of formyl transferases belong to this group | Back alignment and domain information |
|---|
| >PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00639 PurN phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PLN02331 phosphoribosylglycinamide formyltransferase | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PLN02828 formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3076|consensus | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >TIGR01761 thiaz-red thiazolinyl imide reductase | Back alignment and domain information |
|---|
| >TIGR00715 precor6x_red precorrin-6x reductase | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >KOG2741|consensus | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >CHL00073 chlN photochlorophyllide reductase subunit N | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PF10686 DUF2493: Protein of unknown function (DUF2493); InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61 | Back alignment and domain information |
|---|
| >TIGR00290 MJ0570_dom MJ0570-related uncharacterized domain | Back alignment and domain information |
|---|
| >PRK08300 acetaldehyde dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) | Back alignment and domain information |
|---|
| >PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00289 conserved hypothetical protein TIGR00289 | Back alignment and domain information |
|---|
| >PRK08462 biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd01974 Nitrogenase_MoFe_beta Nitrogenase_MoFe_beta: Nitrogenase MoFe protein, beta subunit | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 | Back alignment and domain information |
|---|
| >PRK02910 light-independent protochlorophyllide reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >PRK07178 pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >TIGR01278 DPOR_BchB light-independent protochlorophyllide reductase, B subunit | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >COG4693 PchG Oxidoreductase (NAD-binding), involved in siderophore biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK06270 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03022 WbaP_sugtrans Undecaprenyl-phosphate galactose phosphotransferase, WbaP | Back alignment and domain information |
|---|
| >TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd03466 Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd01965 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: Nitrogenase MoFe protein, beta subunit_like | Back alignment and domain information |
|---|
| >PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily | Back alignment and domain information |
|---|
| >KOG0780|consensus | Back alignment and domain information |
|---|
| >PF01902 ATP_bind_4: ATP-binding region; InterPro: IPR002761 This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N-terminal | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PRK08463 acetyl-CoA carboxylase subunit A; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 258 | ||||
| 3q0i_A | 318 | Methionyl-Trna Formyltransferase From Vibrio Choler | 4e-17 | ||
| 3r8x_A | 318 | Crystal Structure Of Methionyl-Trna Formyltransfera | 2e-16 | ||
| 1fmt_A | 314 | Methionyl-Trnafmet Formyltransferase From Escherich | 1e-14 | ||
| 3tqq_A | 314 | Structure Of The Methionyl-Trna Formyltransferase ( | 3e-14 | ||
| 4iqf_A | 317 | Crystal Structure Of Methyionyl-trna Formyltransfer | 4e-11 | ||
| 1yrw_A | 302 | Crystal Structure Of E.Coli Arna Transformylase Dom | 3e-05 | ||
| 2bln_A | 305 | N-Terminal Formyltransferase Domain Of Arna In Comp | 3e-05 | ||
| 1z7e_A | 660 | Crystal Structure Of Full Length Arna Length = 660 | 5e-05 |
| >pdb|3Q0I|A Chain A, Methionyl-Trna Formyltransferase From Vibrio Cholerae Length = 318 | Back alignment and structure |
|
| >pdb|3R8X|A Chain A, Crystal Structure Of Methionyl-Trna Formyltransferase From Yersinia Pestis Complexed With L-Methionine Length = 318 | Back alignment and structure |
| >pdb|1FMT|A Chain A, Methionyl-Trnafmet Formyltransferase From Escherichia Coli Length = 314 | Back alignment and structure |
| >pdb|3TQQ|A Chain A, Structure Of The Methionyl-Trna Formyltransferase (Fmt) From Coxiella Burnetii Length = 314 | Back alignment and structure |
| >pdb|4IQF|A Chain A, Crystal Structure Of Methyionyl-trna Formyltransferase From Bacillus Anthracis Length = 317 | Back alignment and structure |
| >pdb|1YRW|A Chain A, Crystal Structure Of E.Coli Arna Transformylase Domain Length = 302 | Back alignment and structure |
| >pdb|2BLN|A Chain A, N-Terminal Formyltransferase Domain Of Arna In Complex With N-5-Formyltetrahydrofolate And Ump Length = 305 | Back alignment and structure |
| >pdb|1Z7E|A Chain A, Crystal Structure Of Full Length Arna Length = 660 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3q0i_A Methionyl-tRNA formyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 1.89A {Vibrio cholerae} Length = 318 | Back alignment and structure |
|---|
Score = 158 bits (401), Expect = 5e-47
Identities = 44/159 (27%), Positives = 76/159 (47%), Gaps = 8/159 (5%)
Query: 95 ILPEDTSLTLQNKLEKLSKILIIDTIKKIEYDMTKLFFKPQSNIGESYAPLIKKNEAVLD 154
I DTS ++ +KL +L +++ ++ I Q + +YA + K EA ++
Sbjct: 162 IEASDTSASMYDKLAELGPQALLECLQDIA--QGTAVAVKQDDGLANYAHKLSKEEARIN 219
Query: 155 WSLSAKTIMRKINAFNPFPGAKTYYISYQNKKKFLKIWKAHALSIESTKKPGTILNVNFH 214
WS +A I R I AFNP+P + + +K+W+A + T+ PGTI+ +
Sbjct: 220 WSDAATHIERCIRAFNPWPMSHFEV-----AENSIKVWQARVETRAVTQTPGTIIQAD-K 273
Query: 215 NGILVVCGKNVIKLLELQKNNKKKISATEFINGCIKNIK 253
+GI V G++V+ L LQ KK + + +N
Sbjct: 274 SGIYVATGQDVLVLESLQIPGKKALPVQDILNARADWFS 312
|
| >3q0i_A Methionyl-tRNA formyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 1.89A {Vibrio cholerae} Length = 318 | Back alignment and structure |
|---|
| >3tqq_A Methionyl-tRNA formyltransferase; protein synthesis; 2.00A {Coxiella burnetii} Length = 314 | Back alignment and structure |
|---|
| >3tqq_A Methionyl-tRNA formyltransferase; protein synthesis; 2.00A {Coxiella burnetii} Length = 314 | Back alignment and structure |
|---|
| >1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* 3r8x_A Length = 314 | Back alignment and structure |
|---|
| >1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* 3r8x_A Length = 314 | Back alignment and structure |
|---|
| >2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Length = 305 | Back alignment and structure |
|---|
| >2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Length = 305 | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 | Back alignment and structure |
|---|
| >2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Length = 329 | Back alignment and structure |
|---|
| >2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Length = 329 | Back alignment and structure |
|---|
| >1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory FO structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum} SCOP: b.46.1.1 c.65.1.1 Length = 260 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 258 | |||
| 3tqq_A | 314 | Methionyl-tRNA formyltransferase; protein synthesi | 100.0 | |
| 3rfo_A | 317 | Methionyl-tRNA formyltransferase; structural genom | 100.0 | |
| 3q0i_A | 318 | Methionyl-tRNA formyltransferase; structural genom | 100.0 | |
| 1fmt_A | 314 | Methionyl-tRNA FMet formyltransferase; initiator t | 100.0 | |
| 2bln_A | 305 | Protein YFBG; transferase, formyltransferase, L-AR | 100.0 | |
| 2bw0_A | 329 | 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase | 100.0 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 100.0 | |
| 1zgh_A | 260 | Methionyl-tRNA formyltransferase; southeast collab | 99.9 | |
| 2ywr_A | 216 | Phosphoribosylglycinamide formyltransferase; rossm | 99.76 | |
| 3av3_A | 212 | Phosphoribosylglycinamide formyltransferase; struc | 99.7 | |
| 3auf_A | 229 | Glycinamide ribonucleotide transformylase 1; struc | 99.66 | |
| 1jkx_A | 212 | GART;, phosphoribosylglycinamide formyltransferase | 99.56 | |
| 1meo_A | 209 | Phosophoribosylglycinamide formyltransferase; puri | 99.56 | |
| 3da8_A | 215 | Probable 5'-phosphoribosylglycinamide formyltransf | 99.53 | |
| 3tqr_A | 215 | Phosphoribosylglycinamide formyltransferase; purin | 99.44 | |
| 3p9x_A | 211 | Phosphoribosylglycinamide formyltransferase; struc | 99.43 | |
| 3kcq_A | 215 | Phosphoribosylglycinamide formyltransferase; struc | 99.39 | |
| 4ds3_A | 209 | Phosphoribosylglycinamide formyltransferase; struc | 99.34 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 99.11 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 99.1 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 99.05 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 98.89 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 98.88 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 95.89 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.22 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 94.98 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 94.81 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 94.73 | |
| 4had_A | 350 | Probable oxidoreductase protein; structural genomi | 94.63 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 94.57 | |
| 2glx_A | 332 | 1,5-anhydro-D-fructose reductase; NADP(H) dependen | 94.56 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 94.49 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 94.38 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 94.17 | |
| 3ohs_X | 334 | Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d | 93.94 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 93.83 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 93.74 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 93.64 | |
| 3nkl_A | 141 | UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo | 93.53 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 93.53 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 93.44 | |
| 3moi_A | 387 | Probable dehydrogenase; structural genomics, PSI2, | 93.41 | |
| 2p2s_A | 336 | Putative oxidoreductase; YP_050235.1, structural g | 93.4 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 93.05 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 93.05 | |
| 4gqa_A | 412 | NAD binding oxidoreductase; structural genomics, P | 92.5 | |
| 4egs_A | 180 | Ribose 5-phosphate isomerase RPIB; tyrosine phosph | 92.38 | |
| 2nvw_A | 479 | Galactose/lactose metabolism regulatory protein GA | 92.28 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 92.22 | |
| 1zh8_A | 340 | Oxidoreductase; TM0312, structural genomics, JO ce | 92.19 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 92.08 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 91.81 | |
| 4gmf_A | 372 | Yersiniabactin biosynthetic protein YBTU; rossmann | 91.76 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 91.65 | |
| 3btv_A | 438 | Galactose/lactose metabolism regulatory protein GA | 91.6 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 91.58 | |
| 1ydw_A | 362 | AX110P-like protein; structural genomics, protein | 91.54 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 91.43 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 91.29 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 91.28 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 91.22 | |
| 3u3x_A | 361 | Oxidoreductase; structural genomics, PSI-biology, | 91.09 | |
| 4fb5_A | 393 | Probable oxidoreductase protein; PSI-biology, nysg | 90.55 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 90.53 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 89.91 | |
| 4fzr_A | 398 | SSFS6; structural genomics, PSI-biology, protein s | 89.76 | |
| 3otg_A | 412 | CALG1; calicheamicin, TDP, structural genomics, PS | 89.71 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 89.71 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 89.62 | |
| 3m2t_A | 359 | Probable dehydrogenase; PSI, SGXNY, structural gen | 89.41 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 89.09 | |
| 3tsa_A | 391 | SPNG, NDP-rhamnosyltransferase; glycosyltransferas | 89.08 | |
| 1h6d_A | 433 | Precursor form of glucose-fructose oxidoreductase; | 88.93 | |
| 3rsc_A | 415 | CALG2; TDP, enediyne, structural genomics, PSI-2, | 88.75 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 88.65 | |
| 3ia7_A | 402 | CALG4; glycosysltransferase, calicheamicin, enediy | 88.64 | |
| 3ip3_A | 337 | Oxidoreductase, putative; structural genomics, PSI | 88.31 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 88.26 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 88.03 | |
| 3keo_A | 212 | Redox-sensing transcriptional repressor REX; DNA b | 87.73 | |
| 3dty_A | 398 | Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram | 87.51 | |
| 3oti_A | 398 | CALG3; calicheamicin, TDP, structural genomics, PS | 87.41 | |
| 3v5n_A | 417 | Oxidoreductase; structural genomics, PSI-biology, | 87.15 | |
| 3i23_A | 349 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 86.97 | |
| 1xea_A | 323 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 86.74 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 86.57 | |
| 3kux_A | 352 | Putative oxidoreductase; oxidoreductase family, cs | 86.56 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 86.4 | |
| 4h3v_A | 390 | Oxidoreductase domain protein; structural genomics | 86.35 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 85.91 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 85.68 | |
| 2xdq_B | 511 | Light-independent protochlorophyllide reductase S; | 85.45 | |
| 2ixa_A | 444 | Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver | 85.43 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 84.8 | |
| 3gdo_A | 358 | Uncharacterized oxidoreductase YVAA; structural ge | 84.65 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 84.57 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 84.49 | |
| 2dwc_A | 433 | PH0318, 433AA long hypothetical phosphoribosylglyc | 84.31 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 84.19 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 83.67 | |
| 3rjz_A | 237 | N-type ATP pyrophosphatase superfamily; structural | 83.56 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 82.94 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 82.9 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 82.76 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 82.61 | |
| 1nvm_B | 312 | Acetaldehyde dehydrogenase (acylating), 4-hydroxy- | 82.52 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 82.37 | |
| 1qgu_B | 519 | Protein (nitrogenase molybdenum iron protein); bio | 82.36 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 82.12 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 82.02 | |
| 3f4l_A | 345 | Putative oxidoreductase YHHX; structural genomics, | 82.01 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 81.98 | |
| 1mio_B | 458 | Nitrogenase molybdenum iron protein (beta chain); | 81.92 | |
| 4ew6_A | 330 | D-galactose-1-dehydrogenase protein; nysgrc, PSI-b | 81.42 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 81.39 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 81.05 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 80.83 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 80.56 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 80.55 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 80.53 | |
| 3oqb_A | 383 | Oxidoreductase; structural genomics, protein struc | 80.22 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 80.18 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 80.01 |
| >3tqq_A Methionyl-tRNA formyltransferase; protein synthesis; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-62 Score=433.28 Aligned_cols=241 Identities=34% Similarity=0.551 Sum_probs=222.2
Q ss_pred CeEEEEcCCHHHHHHHHHHHhCCCcEEEEEcCCCCCCCCCCccCCcHHHHHHHHCCCcEEccCCCCCCcccccchHHHHH
Q psy5230 1 MKIIFAGTSISAAAILDTLYNSEHNIVLILTKPDLHSGRGMKLNFSPVKKYALKHSIKIIQPISLKLNGKYHKIANETHK 80 (258)
Q Consensus 1 mrI~f~Gs~~fa~~~L~~L~~~~~~i~~Vvt~pd~~~gr~~~~~~~~v~~~A~~~gIpv~~~~~~~~~~~~~~~~~~~~~ 80 (258)
|||+||||++||+++|++|++++|+|++|||+||++.|||+++.++||+++|+++|||++++.+++++ ++++
T Consensus 3 mrivf~Gtp~fa~~~L~~L~~~~~~v~~Vvt~pd~~~grg~~l~~~~v~~~A~~~gIpv~~~~~~~~~--------~~~~ 74 (314)
T 3tqq_A 3 LKIVFAGTPQFAVPTLRALIDSSHRVLAVYTQPDRPSGRGQKIMESPVKEIARQNEIPIIQPFSLRDE--------VEQE 74 (314)
T ss_dssp CEEEEEECSGGGHHHHHHHHHSSSEEEEEECCCC----------CCHHHHHHHHTTCCEECCSCSSSH--------HHHH
T ss_pred cEEEEECCCHHHHHHHHHHHHCCCeEEEEEeCCCCccccCCccCCCHHHHHHHHcCCCEECcccCCCH--------HHHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999877 8999
Q ss_pred HHhcCCCcEEEEE-------------------------------------------------------------------
Q psy5230 81 LLNKIEFDIMIVM------------------------------------------------------------------- 93 (258)
Q Consensus 81 ~l~~~~~Dl~vv~------------------------------------------------------------------- 93 (258)
.|++++||++|++
T Consensus 75 ~l~~~~~Dliv~~~~~~ilp~~il~~~~~g~iNiHpSlLP~yRG~~pi~~Ai~~G~~~tGvTih~~~~~~D~G~Ii~q~~ 154 (314)
T 3tqq_A 75 KLIAMNADVMVVVAYGLILPKKALNAFRLGCVNVHASLLPRWRGAAPIQRAILAGDRETGISIMQMNEGLDTGDVLAKSA 154 (314)
T ss_dssp HHHTTCCSEEEEESCCSCCCHHHHTSSTTCEEEEESSCTTTTBSSCHHHHHHHHTCSEEEEEEEECCSSSSCSCEEEEEE
T ss_pred HHHhcCCCEEEEcCcccccCHHHHhhCcCCEEEecCccccCCCCccHHHHHHHcCCCeeEEEEEeeecCCCCCCEEEEEE
Confidence 9999999999999
Q ss_pred -eeCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCccccCCCCCCCCcCCCCCcccccccccccHHHHHHHHhhcCCC
Q psy5230 94 -GILPEDTSLTLQNKLEKLSKILIIDTIKKIEYDMTKLFFKPQSNIGESYAPLIKKNEAVLDWSLSAKTIMRKINAFNPF 172 (258)
Q Consensus 94 -~I~~~dt~~~L~~kl~~~g~~ll~~~l~~l~~~~g~~~~~~Q~~~~atya~k~~~~d~~IdW~~~a~~I~~~iRA~~p~ 172 (258)
+|.++||+.+|++|++.++++++.++|+++.+ |.+.+.||++..+||+||++++|+.|||+++|++|+|+|||++||
T Consensus 155 ~~I~~~dt~~~L~~rl~~~~~~ll~~~l~~l~~--g~~~~~~Q~~~~~tya~ki~~~d~~Idw~~~a~~I~~~iRa~~P~ 232 (314)
T 3tqq_A 155 CVISSEDTAADLHDRLSLIGADLLLESLAKLEK--GDIKLEKQDEASATYASKIQKQEALIDWRKSAVEIARQVRAFNPT 232 (314)
T ss_dssp EECCTTCCHHHHHHHHHHHHHHHHHHHHHHHHH--TCCCCBCCCGGGCCBCCCCCGGGGBCCTTSBHHHHHHHHHHTTTT
T ss_pred EeeCCCCCHHHHHHHHHHHHHHHHHHHHHHHHc--CCCCcCcCCCccccCCCCCCHHHheecccCCHHHHHHHHhccCCC
Confidence 99999999999999999999999999999999 999999999999999999999999999999999999999999999
Q ss_pred CceEEEEEeccCCCceEEEEEEEEccCCCCCCCcEEEEEeeCCcEEEEecCcEEEEEEEecCCCCccCHHHHhcccc--C
Q psy5230 173 PGAKTYYISYQNKKKFLKIWKAHALSIESTKKPGTILNVNFHNGILVVCGKNVIKLLELQKNNKKKISATEFINGCI--K 250 (258)
Q Consensus 173 pga~~~~~~~~~~g~~i~i~~a~~~~~~~~~~pG~i~~~~~~~~l~V~c~dg~l~i~~lq~~gkk~~~a~~f~~g~~--~ 250 (258)
||||+++ + |++++|++++..+......||+|+..+ +++++|+|+||.|+|.++|++|||.|++.+|+||++ +
T Consensus 233 Pga~~~~---~--g~~~ki~~a~~~~~~~~~~pG~v~~~~-~~~l~V~~~dg~l~i~~lq~~gkk~m~~~~f~~g~~~~~ 306 (314)
T 3tqq_A 233 PIAFTYF---E--GQPMRIWRATVVDEKTDFEPGVLVDAD-KKGISIAAGSGILRLHQLQLPGKRVCSAGDFINAHGDKL 306 (314)
T ss_dssp TCCEEEE---T--TEEEEEEEEEEECCCCSSCTTCEEEEE-TTEEEEECSBSEEEEEEEECTTSCCEEHHHHHHHHGGGC
T ss_pred CceEEEE---C--CEEEEEEEEEEecCCCCCCCcEEEEec-CCEEEEEECCCEEEEeEEEcCCCCccCHHHHhccCcccC
Confidence 9999999 8 999999999987665567899999887 899999999999999999999999999999999999 9
Q ss_pred CCccccc
Q psy5230 251 NIKYFIS 257 (258)
Q Consensus 251 ~~g~~~~ 257 (258)
..|+.+.
T Consensus 307 ~~g~~~~ 313 (314)
T 3tqq_A 307 IPGKTVF 313 (314)
T ss_dssp CTTTCCC
T ss_pred CCCCEec
Confidence 9998763
|
| >3q0i_A Methionyl-tRNA formyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 1.89A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* 3r8x_A | Back alignment and structure |
|---|
| >2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A | Back alignment and structure |
|---|
| >2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory FO structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum} SCOP: b.46.1.1 c.65.1.1 | Back alignment and structure |
|---|
| >2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} | Back alignment and structure |
|---|
| >1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* | Back alignment and structure |
|---|
| >1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* | Back alignment and structure |
|---|
| >3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* | Back alignment and structure |
|---|
| >3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 | Back alignment and structure |
|---|
| >3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 | Back alignment and structure |
|---|
| >4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >4egs_A Ribose 5-phosphate isomerase RPIB; tyrosine phosphatase, dephosphorylation, hydrolase; 2.30A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* | Back alignment and structure |
|---|
| >3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* | Back alignment and structure |
|---|
| >3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* | Back alignment and structure |
|---|
| >1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* | Back alignment and structure |
|---|
| >3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* | Back alignment and structure |
|---|
| >3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* | Back alignment and structure |
|---|
| >3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A | Back alignment and structure |
|---|
| >1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xdq_B Light-independent protochlorophyllide reductase S; oxidoreductase, DPOR, (bacterio)chlorophyll biosynthesis, photosynthesis; 2.40A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1qgu_B Protein (nitrogenase molybdenum iron protein); biological nitrogen fixation, nitrogen metabolism, molybdoenzymes, electron transfer; HET: HCA CFM CLF; 1.60A {Klebsiella pneumoniae} SCOP: c.92.2.3 PDB: 1h1l_B* 1qh1_B* 1qh8_B* | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1mio_B Nitrogenase molybdenum iron protein (beta chain); HET: HCA CFM CLP; 3.00A {Clostridium pasteurianum} SCOP: c.92.2.3 | Back alignment and structure |
|---|
| >4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 258 | ||||
| d1fmta1 | 108 | b.46.1.1 (A:207-314) Methionyl-tRNAfmet formyltran | 3e-17 | |
| d2bw0a1 | 104 | b.46.1.1 (A:204-307) 10-formyltetrahydrofolate deh | 3e-15 | |
| d2blna1 | 101 | b.46.1.1 (A:204-304) Polymyxin resistance protein | 1e-14 | |
| d2blna2 | 203 | c.65.1.1 (A:1-203) Polymyxin resistance protein Ar | 9e-11 | |
| d1fmta2 | 206 | c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransf | 4e-10 | |
| d2bw0a2 | 203 | c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehyd | 2e-08 |
| >d1fmta1 b.46.1.1 (A:207-314) Methionyl-tRNAfmet formyltransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
class: All beta proteins fold: FMT C-terminal domain-like superfamily: FMT C-terminal domain-like family: Post formyltransferase domain domain: Methionyl-tRNAfmet formyltransferase, C-terminal domain species: Escherichia coli [TaxId: 562]
Score = 73.2 bits (179), Expect = 3e-17
Identities = 39/102 (38%), Positives = 52/102 (50%), Gaps = 6/102 (5%)
Query: 146 IKKNEAVLDWSLSAKTIMRKINAFNPFPGAKTYYISYQNKKKFLKIWKAHALSIESTKKP 205
+ K EA +DWSLSA + R I AFNP+P + K+WKA + + P
Sbjct: 1 LSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPV-----KVWKASVIDTATNAAP 55
Query: 206 GTILNVNFHNGILVVCGKNVIKLLELQKNNKKKISATEFING 247
GTIL N GI V G ++ LL LQ KK +SA + +N
Sbjct: 56 GTILEAN-KQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNS 96
|
| >d2bw0a1 b.46.1.1 (A:204-307) 10-formyltetrahydrofolate dehydrogenase domain 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2blna1 b.46.1.1 (A:204-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]} Length = 101 | Back information, alignment and structure |
|---|
| >d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 203 | Back information, alignment and structure |
|---|
| >d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
| >d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 203 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 258 | |||
| d1fmta1 | 108 | Methionyl-tRNAfmet formyltransferase, C-terminal d | 99.97 | |
| d2blna1 | 101 | Polymyxin resistance protein ArnA, domain 2 {Esche | 99.95 | |
| d2blna2 | 203 | Polymyxin resistance protein ArnA, N-terminal doma | 99.93 | |
| d2bw0a1 | 104 | 10-formyltetrahydrofolate dehydrogenase domain 2 { | 99.93 | |
| d1fmta2 | 206 | Methionyl-tRNAfmet formyltransferase {Escherichia | 99.92 | |
| d2bw0a2 | 203 | 10-formyltetrahydrofolate dehydrogenase domain 1 { | 99.92 | |
| d1jkxa_ | 209 | Glycinamide ribonucleotide transformylase, GART {E | 99.39 | |
| d1meoa_ | 205 | Glycinamide ribonucleotide transformylase, GART {H | 99.11 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 97.3 | |
| d1zgha1 | 62 | Methionyl-tRNAfmet formyltransferase, C-terminal d | 97.16 | |
| d1zgha2 | 164 | Methionyl-tRNAfmet formyltransferase {Clostridium | 97.09 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 96.19 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 96.12 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 95.66 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 94.86 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 94.37 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 93.98 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 93.85 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 93.6 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 93.29 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 92.59 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 91.96 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 91.86 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 91.76 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 91.32 | |
| d2py6a1 | 395 | Methyltransferase FkbM {Methylobacillus flagellatu | 91.05 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 90.59 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 89.67 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 89.59 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 89.4 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 89.36 | |
| d1iira_ | 401 | UDP-glucosyltransferase GtfB {Amycolatopsis orient | 89.33 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 89.19 | |
| d2nvwa1 | 237 | Galactose/lactose metabolism regulatory protein GA | 88.79 | |
| d1gsoa2 | 105 | Glycinamide ribonucleotide synthetase (GAR-syn), N | 88.7 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 88.29 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 88.24 | |
| d2d13a1 | 226 | Hypothetical protein PH1257 {Archaeon Pyrococcus h | 88.16 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 87.72 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 86.9 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 86.59 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 86.37 | |
| d1pn3a_ | 391 | TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi | 86.32 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 86.18 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 85.47 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 85.33 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 84.6 | |
| d1p8aa_ | 146 | Tyrosine phosphatase {Tritrichomonas foetus [TaxId | 84.14 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 83.64 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 83.29 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 83.03 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 83.01 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 82.89 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 82.86 | |
| d1rrva_ | 401 | TDP-vancosaminyltransferase GftD {Amycolatopsis or | 82.77 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 82.76 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 82.06 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 81.72 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 81.57 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 80.94 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 80.86 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 80.83 |
| >d1fmta1 b.46.1.1 (A:207-314) Methionyl-tRNAfmet formyltransferase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: FMT C-terminal domain-like superfamily: FMT C-terminal domain-like family: Post formyltransferase domain domain: Methionyl-tRNAfmet formyltransferase, C-terminal domain species: Escherichia coli [TaxId: 562]
Probab=99.97 E-value=5.7e-31 Score=195.97 Aligned_cols=105 Identities=37% Similarity=0.579 Sum_probs=99.5
Q ss_pred CCcccccccccccHHHHHHHHhhcCCCCceEEEEEeccCCCceEEEEEEEEccCCCCCCCcEEEEEeeCCcEEEEecCcE
Q psy5230 146 IKKNEAVLDWSLSAKTIMRKINAFNPFPGAKTYYISYQNKKKFLKIWKAHALSIESTKKPGTILNVNFHNGILVVCGKNV 225 (258)
Q Consensus 146 ~~~~d~~IdW~~~a~~I~~~iRA~~p~pga~~~~~~~~~~g~~i~i~~a~~~~~~~~~~pG~i~~~~~~~~l~V~c~dg~ 225 (258)
++++|++|||+++|.+|+|+|||++|||||||++ + |++++|++++..+......||+|+..+ +++++|+|+||+
T Consensus 1 i~k~d~~Idw~~~a~~I~~~IRa~~p~Pga~~~~---~--~~~iki~~a~~~~~~~~~~pG~v~~~~-~~~i~v~~~dg~ 74 (108)
T d1fmta1 1 LSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEI---E--GQPVKVWKASVIDTATNAAPGTILEAN-KQGIQVATGDGI 74 (108)
T ss_dssp CCHHHHBCCTTSBHHHHHHHHHHTTTTTCEEEEE---T--TEEEEEEEEEEECCCCCSCTTBEEEEE-TTEEEEECSBSE
T ss_pred CChHHeEECCCCCHHHHHhhheeCCChhhhhhhc---c--ccceEEEEEEEeeeccccccceEEEEC-CCcEEEEeCCce
Confidence 5789999999999999999999999999999999 9 999999999988776678899999988 889999999999
Q ss_pred EEEEEEecCCCCccCHHHHhcccc--CCCcccc
Q psy5230 226 IKLLELQKNNKKKISATEFINGCI--KNIKYFI 256 (258)
Q Consensus 226 l~i~~lq~~gkk~~~a~~f~~g~~--~~~g~~~ 256 (258)
|.|+++|++||++|++.+|+||++ +..|++|
T Consensus 75 l~I~~vq~~gkk~m~~~df~~G~~~~~~~g~~l 107 (108)
T d1fmta1 75 LNLLSLQPAGKKAMSAQDLLNSRREWFVPGNRL 107 (108)
T ss_dssp EEEEEEEETTSCCEEHHHHHHHSGGGSCTTCBC
T ss_pred EEEEEEEcCCCCcccHHHHHcCCccCCCCcCEe
Confidence 999999999999999999999998 8899876
|
| >d2blna1 b.46.1.1 (A:204-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bw0a1 b.46.1.1 (A:204-307) 10-formyltetrahydrofolate dehydrogenase domain 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zgha1 b.46.1.1 (A:165-226) Methionyl-tRNAfmet formyltransferase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1p8aa_ c.44.1.1 (A:) Tyrosine phosphatase {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|