Psyllid ID: psy5261

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MGFPVISVDASVQNEDGSRTLTLSQTKFSADGSTGKAMISTYQTSLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVIHNYGHGGYGVTTAPGTSRYAVQLVKQALDPTSSLKSKL
ccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHccccccccccccccccccccEEEEEEEEEEcHHHHHHHHHHHHHHcccEEEEEEEcccccccccccEEEEccccccccccccccccEEEEEEEEEEcccEEEEEEcccEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHccccccccEEEEEcccccccccEEEEcccccccccccHHHHHHHHHHHHHHccccccccccc
cccccccccccHHHHHHHHHHHHHHHHccccccccEEEEcccccccccccHHHHHccccccccHHHHHHcccccccEEEEEEEEEccHHHHHHHHHHHHHcccEEEEEEEccHHHHcccccEEEEccHHHHHHHccccccEEEEEEEEEEEccccccEEEcccccEEEcccccEEEEEcccccccccccccHHHHHHHHHHHHHHcHHHHcccHHHHHcccccccccEEEEccccccccEEcHHHHHHHHHHHHHHHHHcccccccc
mgfpvisvdasvqnedgsrtltlsqtkfsadgstgKAMISTYQTSLlknasienlvpvyrdaqpdelvvgnktykygsysetlviensdflPWAMKRVSkqggkfrrgtvssfsglesefdfvfncaglgaqalcrdrkltpirgQVIKVWapwlshfyyldydvyviphsngavtlggcrhydsysrdisrHDTASILERCYSllprleeapvlyewcglrphrslvihnyghggygvttapgtsRYAVQLVKQaldptsslkskl
MGFPVISvdasvqnedgsrtltlsqtkfsadgstgKAMISTYQTSLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVskqggkfrrGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVIHNYGHGGYGVTTAPGTSRYAVQLVkqaldptsslkskl
MGFPVISVDASVQNEDGSRTLTLSQTKFSADGSTGKAMISTYQTSLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVIHNYGHGGYGVTTAPGTSRYAVQLVKQALDPTSSLKSKL
*************************************MISTYQTSLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVIHNYGHGGYGVTTAPGTSRYAVQLVK*************
MGFPVISVDASVQNEDGSRTLTLSQTKFSADGSTGKAMISTYQTSLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVIHNYGHGGYGVTTAPGTSRYAVQLVKQA***********
MGFPVISVDASVQNEDGSRTLTLSQTKFSADGSTGKAMISTYQTSLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVIHNYGHGGYGVTTAPGTSRYAVQLVKQAL**********
MGFPVISVDASVQNEDGSRTLTLSQTKFSADGSTGKAMISTYQTSLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVIHNYGHGGYGVTTAPGTSRYAVQLVKQALDPT*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFPVISVDASVQNEDGSRTLTLSQTKFSADGSTGKAMISTYQTSLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVIHNYGHGGYGVTTAPGTSRYAVQLVKQALDPTSSLKSKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query267 2.2.26 [Sep-21-2011]
P22942347 D-amino-acid oxidase OS=O yes N/A 0.958 0.737 0.328 9e-28
O35078346 D-amino-acid oxidase OS=R yes N/A 0.827 0.638 0.342 7e-27
P14920347 D-amino-acid oxidase OS=H yes N/A 0.943 0.726 0.326 8e-27
P18894345 D-amino-acid oxidase OS=M yes N/A 0.827 0.640 0.336 1e-26
Q9Z302346 D-amino-acid oxidase OS=C yes N/A 0.756 0.583 0.347 2e-26
Q9Z1M5347 D-amino-acid oxidase OS=C yes N/A 0.827 0.636 0.342 3e-26
A2V9Y8347 D-amino-acid oxidase OS=M N/A N/A 0.831 0.639 0.332 1e-25
P31228341 D-aspartate oxidase OS=Bo no N/A 0.779 0.609 0.348 2e-25
P00371347 D-amino-acid oxidase OS=S yes N/A 0.797 0.613 0.323 4e-25
Q99489341 D-aspartate oxidase OS=Ho no N/A 0.689 0.539 0.34 7e-25
>sp|P22942|OXDA_RABIT D-amino-acid oxidase OS=Oryctolagus cuniculus GN=DAO PE=2 SV=1 Back     alignment and function desciption
 Score =  124 bits (310), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 141/289 (48%), Gaps = 33/289 (11%)

Query: 4   PVISVDASVQNEDGSRTL---TLSQTKFSADGSTGKAMISTYQT--SLLKNASIENLVPV 58
           P +S  ++ Q  D SR      LS     +    G A+IS Y      + + S ++ V  
Sbjct: 54  PYLSDPSNPQEADWSRQTFNHLLSHIHSPSAEKMGLALISGYNLFRKAVPDPSWKDTVLG 113

Query: 59  YRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVSSFSGLES 118
           +R     EL +    Y YG ++ +L+++   +L W  KR++++G K  +  V SF  +  
Sbjct: 114 FRKLTLRELDM-FPGYSYGWFNTSLILDGRSYLQWLTKRLTERGVKLFQRKVESFDEVAG 172

Query: 119 E-FDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYD--------VYVIP 169
              D + NC G+ A AL  D  L P RGQ+IKV APW+ HF  + +D         Y+IP
Sbjct: 173 GGVDVIVNCTGVWASALQPDPLLQPGRGQIIKVDAPWVKHF-IITHDPESGIYKSPYIIP 231

Query: 170 HSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHR---- 225
             + AVTLGG     ++S   S  D  +I + C SL P L++A ++ EW G RP R    
Sbjct: 232 GVH-AVTLGGIFQMGNWSEGNSTDDHNTIWKGCCSLEPTLKDARIVGEWTGFRPVRPQIR 290

Query: 226 ------------SLVIHNYGHGGYGVTTAPGTSRYAVQLVKQALDPTSS 262
                       + VIHNYGHGGYG+T   G +  A +L  + L+   S
Sbjct: 291 LGREQLSAGPSKTEVIHNYGHGGYGLTIHWGCALEAAKLFGKILEEKKS 339
Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
Oryctolagus cuniculus (taxid: 9986)
EC: 1EC: .EC: 4EC: .EC: 3EC: .EC: 3
>sp|O35078|OXDA_RAT D-amino-acid oxidase OS=Rattus norvegicus GN=Dao PE=2 SV=1 Back     alignment and function description
>sp|P14920|OXDA_HUMAN D-amino-acid oxidase OS=Homo sapiens GN=DAO PE=1 SV=3 Back     alignment and function description
>sp|P18894|OXDA_MOUSE D-amino-acid oxidase OS=Mus musculus GN=Dao PE=1 SV=3 Back     alignment and function description
>sp|Q9Z302|OXDA_CRIGR D-amino-acid oxidase OS=Cricetulus griseus GN=DAO PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1M5|OXDA_CAVPO D-amino-acid oxidase OS=Cavia porcellus GN=DAO PE=2 SV=1 Back     alignment and function description
>sp|A2V9Y8|OXDA_MACFA D-amino-acid oxidase OS=Macaca fascicularis GN=DAO PE=2 SV=1 Back     alignment and function description
>sp|P31228|OXDD_BOVIN D-aspartate oxidase OS=Bos taurus GN=DDO PE=1 SV=2 Back     alignment and function description
>sp|P00371|OXDA_PIG D-amino-acid oxidase OS=Sus scrofa GN=DAO PE=1 SV=2 Back     alignment and function description
>sp|Q99489|OXDD_HUMAN D-aspartate oxidase OS=Homo sapiens GN=DDO PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
312376514296 hypothetical protein AND_12652 [Anophele 0.842 0.760 0.5 4e-60
58387114334 AGAP005323-PB [Anopheles gambiae str. PE 0.842 0.673 0.491 6e-60
157133215334 d-amino acid oxidase [Aedes aegypti] gi| 0.906 0.724 0.460 1e-58
157119089334 d-amino acid oxidase [Aedes aegypti] gi| 0.906 0.724 0.456 2e-58
242021760338 D-aspartate oxidase, putative [Pediculus 0.842 0.665 0.473 1e-57
195433084334 GK23907 [Drosophila willistoni] gi|19416 0.794 0.634 0.473 3e-56
194884189335 GG22723 [Drosophila erecta] gi|190659365 0.816 0.650 0.474 4e-56
195582254335 GD25962 [Drosophila simulans] gi|1941929 0.816 0.650 0.478 9e-56
321461793343 hypothetical protein DAPPUDRAFT_231376 [ 0.853 0.664 0.459 1e-55
125811087335 GA11563 [Drosophila pseudoobscura pseudo 0.816 0.650 0.457 1e-55
>gi|312376514|gb|EFR23574.1| hypothetical protein AND_12652 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  237 bits (605), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 155/242 (64%), Gaps = 17/242 (7%)

Query: 38  MISTYQTSLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKR 97
           + S+   ++++N  IE +VPVYR A   EL +    +KYGS+  T++ E   + PWA +R
Sbjct: 56  IFSSRDPAIVRNHYIEKIVPVYRSATEPELGLCPGEWKYGSFFTTILAECRLYQPWATER 115

Query: 98  VSKQGGKFRRGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSH 157
             + GG+  +  ++SF  L  ++D V NC GLGA+ LC D KL PIRGQ+ KV APW+  
Sbjct: 116 FLENGGQIVKLDLNSFRELHGKYDVVVNCTGLGAKRLCSDHKLVPIRGQITKVRAPWVKT 175

Query: 158 FYYLDYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYE 217
            +Y D+D YVIP   G VTLGGCR+YDSY+ D+ RHD A+I ERC SLLP L+ APVL E
Sbjct: 176 AFYADFDTYVIPGFEG-VTLGGCRNYDSYNTDVCRHDAAAIRERCESLLPSLKSAPVLRE 234

Query: 218 WCGLRPHRS----------------LVIHNYGHGGYGVTTAPGTSRYAVQLVKQALDPTS 261
             GLRPHR                  V+HNYGHGGYGVTTAPGT++YAVQLV  AL   S
Sbjct: 235 AVGLRPHRDPVRVEIELVSTTEGALRVVHNYGHGGYGVTTAPGTAKYAVQLVYDALKSNS 294

Query: 262 SL 263
            L
Sbjct: 295 KL 296

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|58387114|ref|XP_315337.2| AGAP005323-PB [Anopheles gambiae str. PEST] gi|158293988|ref|XP_001688634.1| AGAP005323-PA [Anopheles gambiae str. PEST] gi|55238139|gb|EAA11815.2| AGAP005323-PB [Anopheles gambiae str. PEST] gi|157015356|gb|EDO63640.1| AGAP005323-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157133215|ref|XP_001662804.1| d-amino acid oxidase [Aedes aegypti] gi|108870913|gb|EAT35138.1| AAEL012674-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157119089|ref|XP_001659331.1| d-amino acid oxidase [Aedes aegypti] gi|108875482|gb|EAT39707.1| AAEL008512-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|242021760|ref|XP_002431311.1| D-aspartate oxidase, putative [Pediculus humanus corporis] gi|212516579|gb|EEB18573.1| D-aspartate oxidase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195433084|ref|XP_002064545.1| GK23907 [Drosophila willistoni] gi|194160630|gb|EDW75531.1| GK23907 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194884189|ref|XP_001976178.1| GG22723 [Drosophila erecta] gi|190659365|gb|EDV56578.1| GG22723 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195582254|ref|XP_002080943.1| GD25962 [Drosophila simulans] gi|194192952|gb|EDX06528.1| GD25962 [Drosophila simulans] Back     alignment and taxonomy information
>gi|321461793|gb|EFX72821.1| hypothetical protein DAPPUDRAFT_231376 [Daphnia pulex] Back     alignment and taxonomy information
>gi|125811087|ref|XP_001361743.1| GA11563 [Drosophila pseudoobscura pseudoobscura] gi|195153509|ref|XP_002017668.1| GL17186 [Drosophila persimilis] gi|54636919|gb|EAL26322.1| GA11563 [Drosophila pseudoobscura pseudoobscura] gi|194113464|gb|EDW35507.1| GL17186 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
FB|FBgn0033543335 CG12338 [Drosophila melanogast 0.816 0.650 0.474 3.5e-52
UNIPROTKB|E1BUW4328 E1BUW4 "Uncharacterized protei 0.857 0.698 0.369 9.8e-32
ZFIN|ZDB-GENE-080204-116339 zgc:172341 "zgc:172341" [Danio 0.685 0.539 0.356 4.5e-27
UNIPROTKB|E1C9D0342 DDO "Uncharacterized protein" 0.906 0.707 0.339 1.1e-25
WB|WBGene00022076322 daao-1 [Caenorhabditis elegans 0.898 0.745 0.287 7.6e-25
WB|WBGene00008127334 ddo-1 [Caenorhabditis elegans 0.531 0.425 0.337 1e-24
UNIPROTKB|O45307334 C47A10.5 "D-aspartate oxidase 0.531 0.425 0.337 1e-24
UNIPROTKB|P31228341 DDO "D-aspartate oxidase" [Bos 0.737 0.577 0.351 3.3e-24
UNIPROTKB|F1MP99341 DDO "D-aspartate oxidase" [Bos 0.737 0.577 0.351 4.2e-24
UNIPROTKB|A8WXM1331 CBG04460 "D-aspartate oxidase 0.531 0.429 0.317 5e-24
FB|FBgn0033543 CG12338 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 541 (195.5 bits), Expect = 3.5e-52, P = 3.5e-52
 Identities = 112/236 (47%), Positives = 151/236 (63%)

Query:    45 SLLKNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGK 104
             S+++N  IE L+PVYR A  +EL + N  +KYGS+  T + E+  FLP+A K+  + GG+
Sbjct:   101 SIVRNHFIEKLLPVYRRATEEELRLCNGGWKYGSFFTTCLTESRLFLPYATKKFLENGGE 160

Query:   105 FRRGTVSSFSGLESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYD 164
               R  V+SF  +    D + NC G+GA+ LC D+ L PIRGQV+KV APW+   +Y DYD
Sbjct:   161 VVRQHVNSFFEVPQNIDLLLNCTGMGAKELCGDQHLVPIRGQVLKVRAPWVKTAFYGDYD 220

Query:   165 VYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPH 224
              YV+P     VTLGGCR +DSY+ +  ++D+ +I ERCY LLP L +A ++ E  GLRPH
Sbjct:   221 TYVLPGFE-TVTLGGCRQFDSYNTEWCKYDSMAIRERCYDLLPSLRKAEIVRECVGLRPH 279

Query:   225 RSLV-----------------IHNYGHGGYGVTTAPGTSRYAVQLVKQALDPTSSL 263
             RS+V                 +HNYGHGGYGVTTAPGT+ YAV+LV+  L   S L
Sbjct:   280 RSVVRVEPELITNPEGRRLKVVHNYGHGGYGVTTAPGTAMYAVRLVRDLLAGNSKL 335
GO:0008445 "D-aspartate oxidase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0003884 "D-amino-acid oxidase activity" evidence=IEA
UNIPROTKB|E1BUW4 E1BUW4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080204-116 zgc:172341 "zgc:172341" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9D0 DDO "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00022076 daao-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00008127 ddo-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O45307 C47A10.5 "D-aspartate oxidase 2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P31228 DDO "D-aspartate oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MP99 DDO "D-aspartate oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A8WXM1 CBG04460 "D-aspartate oxidase 1" [Caenorhabditis briggsae (taxid:6238)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P00371OXDA_PIG1, ., 4, ., 3, ., 30.32300.79770.6138yesN/A
P14920OXDA_HUMAN1, ., 4, ., 3, ., 30.32630.94380.7262yesN/A
P18894OXDA_MOUSE1, ., 4, ., 3, ., 30.3360.82770.6405yesN/A
Q9Z1M5OXDA_CAVPO1, ., 4, ., 3, ., 30.34260.82770.6368yesN/A
P22942OXDA_RABIT1, ., 4, ., 3, ., 30.32870.95880.7377yesN/A
O35078OXDA_RAT1, ., 4, ., 3, ., 30.34260.82770.6387yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.30.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 4e-15
TIGR02352337 TIGR02352, thiamin_ThiO, glycine oxidase ThiO 2e-12
PRK12409410 PRK12409, PRK12409, D-amino acid dehydrogenase sma 4e-04
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information 
 Score = 74.2 bits (182), Expect = 4e-15
 Identities = 46/165 (27%), Positives = 58/165 (35%), Gaps = 30/165 (18%)

Query: 119 EFDFVFNCAGLGAQALCR-----DRKLTPIRGQVIKVWAP--------WLSHFYYLDYDV 165
           E D V   AG  A  L          L P+RGQ +    P                D   
Sbjct: 200 EADKVVLAAGAWAGELAATLGELPLPLRPVRGQALTTEPPEGLLADGLAPVVLVVDDGGG 259

Query: 166 YVIPHSNGAVTLGGC-RHYDSYSRDISRHDT--ASILERCYSLLPRLEEAPVLYEWCGLR 222
           Y+ P  +G + +GG          D  R D   A +L    +LLP L +A +   W GLR
Sbjct: 260 YIRPRGDGRLRVGGTDEEGGDDPSDPEREDLVIAELLRVARALLPGLADAGIEAAWAGLR 319

Query: 223 ----PHRSLVIH----------NYGHGGYGVTTAPGTSRYAVQLV 253
               P    VI             GHGG+G T AP   R    L+
Sbjct: 320 PPTTPDGLPVIGRAAPLPNLYVATGHGGHGFTLAPALGRLLADLI 364

Length = 387
>gnl|CDD|233831 TIGR02352, thiamin_ThiO, glycine oxidase ThiO Back     alignment and domain information
>gnl|CDD|237093 PRK12409, PRK12409, D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 267
KOG3923|consensus342 100.0
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 99.97
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.96
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.95
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 99.95
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.94
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.94
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.94
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.94
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.92
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.92
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.92
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.92
KOG2844|consensus 856 99.91
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.9
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 99.9
KOG2853|consensus509 99.88
PRK11728393 hydroxyglutarate oxidase; Provisional 99.87
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 99.87
PLN02464 627 glycerol-3-phosphate dehydrogenase 99.86
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.8
KOG2820|consensus399 99.78
KOG2852|consensus380 99.74
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.72
COG0579429 Predicted dehydrogenase [General function predicti 99.58
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.39
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.38
KOG0042|consensus 680 99.37
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.28
PRK05257494 malate:quinone oxidoreductase; Validated 99.26
KOG2665|consensus453 99.02
PLN02697 529 lycopene epsilon cyclase 98.25
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.1
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.96
PLN02463 447 lycopene beta cyclase 97.54
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.49
PRK06185407 hypothetical protein; Provisional 97.26
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.04
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 96.92
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.76
PRK10157 428 putative oxidoreductase FixC; Provisional 96.74
PRK08244 493 hypothetical protein; Provisional 96.43
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 96.37
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.36
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 96.26
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 96.18
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 95.84
PRK10015 429 oxidoreductase; Provisional 95.42
PRK06847375 hypothetical protein; Provisional 95.26
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 95.18
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 95.01
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 94.65
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 94.6
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 94.52
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 94.47
PLN02612567 phytoene desaturase 94.42
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 94.01
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 93.94
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.58
COG2081 408 Predicted flavoproteins [General function predicti 93.33
PRK07233434 hypothetical protein; Provisional 93.27
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 92.41
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 92.23
TIGR02730493 carot_isom carotene isomerase. Members of this fam 92.19
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 92.03
KOG0404|consensus322 90.7
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 90.65
PRK06184 502 hypothetical protein; Provisional 90.5
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 90.39
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 90.02
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 89.95
PLN02487569 zeta-carotene desaturase 89.82
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 89.69
PLN02985 514 squalene monooxygenase 89.38
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 89.17
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 89.03
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 89.0
PRK09126392 hypothetical protein; Provisional 88.9
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 87.11
PRK08401 466 L-aspartate oxidase; Provisional 86.86
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 86.84
PRK07045388 putative monooxygenase; Reviewed 85.84
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 85.64
PRK12839 572 hypothetical protein; Provisional 85.51
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 85.38
PRK07121 492 hypothetical protein; Validated 85.25
TIGR00275 400 flavoprotein, HI0933 family. The model when search 84.78
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 84.68
PRK08274 466 tricarballylate dehydrogenase; Validated 84.59
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 84.04
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 83.91
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 83.78
PRK08163396 salicylate hydroxylase; Provisional 83.35
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 83.35
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 83.05
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 83.01
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 82.69
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 82.69
PRK11445351 putative oxidoreductase; Provisional 82.61
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 81.77
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 81.48
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 81.41
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 81.25
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 81.07
PRK06175 433 L-aspartate oxidase; Provisional 80.86
>KOG3923|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.1e-40  Score=278.88  Aligned_cols=230  Identities=40%  Similarity=0.665  Sum_probs=209.7

Q ss_pred             cCCCCceEEEEEeeEeccCC-----chhHhhhCCCcEECChhhhhcCCCCceeEEEeeeeeeehHHHHHHHHHHHHhCCc
Q psy5261          29 SADGSTGKAMISTYQTSLLK-----NASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGG  103 (267)
Q Consensus        29 ~~~~~~g~~~~~g~~~~~~~-----~~~~~~~g~~~~~l~~~el~~~P~~~~~g~~~~~~~vdp~~~~~~L~~~~~~~G~  103 (267)
                      +...++|+.+.+|+.+++++     .++|.+..+.++.|+.+|+.-+|.....|+.|++...++.+|+.+|.+.+.++|+
T Consensus        87 ~~a~~aGV~l~sg~~ls~~e~~~~~~~~w~diV~~fr~l~e~EL~~f~~~~~~G~~~Tt~~sE~~~ylpyl~k~l~e~Gv  166 (342)
T KOG3923|consen   87 EEAGEAGVCLVSGHILSDSESLDDQQRSWGDIVYGFRDLTERELLGFPDYSTYGIHFTTYLSEGPKYLPYLKKRLTENGV  166 (342)
T ss_pred             ccccccceEEeeeeeeccCCCchhhhhhHHhhhhhhhcCCHHHhcCCCCccccceeEEEeeccchhhhHHHHHHHHhcCc
Confidence            35578999999999998842     2699999999999999999955733478999999999999999999999999999


Q ss_pred             EEEEEeeCCccccc-cCCCEEEEccCcCchhhcCCCCceeecceEEEEECCCcceEEEeC-CeEEEEecCCCeEEEccee
Q psy5261         104 KFRRGTVSSFSGLE-SEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLD-YDVYVIPHSNGAVTLGGCR  181 (267)
Q Consensus       104 ~~~~~~V~~l~~~~-~~ad~VV~aaG~~s~~l~~~~~l~p~rg~~~~~~~p~~~~~v~~~-~~~y~~p~~~g~l~lGg~~  181 (267)
                      +|.+.+|.++++.. -.+|.||||||.|++.|+.|-.++|+|||++.+++||++++++.| ...|++|..+ .+.+||+.
T Consensus       167 ef~~r~v~~l~E~~~~~~DVivNCtGL~a~~L~gDd~~yPiRGqVl~V~ApWvkhf~~~D~~~ty~iP~~~-~V~lGg~~  245 (342)
T KOG3923|consen  167 EFVQRRVESLEEVARPEYDVIVNCTGLGAGKLAGDDDLYPIRGQVLKVDAPWVKHFIYRDFSRTYIIPGTE-SVTLGGTK  245 (342)
T ss_pred             EEEEeeeccHHHhccCCCcEEEECCccccccccCCcceeeccceEEEeeCCceeEEEEecCCccEEecCCc-eEEEcccc
Confidence            99999999998763 689999999999999999977799999999999999999988744 3369999766 89999999


Q ss_pred             ecCCCCCCCCHHHHHHHHHHHHhhCCCCCCCCceeeeccccCCCCC----------------eEEEeCCCchhhhccHHH
Q psy5261         182 HYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSL----------------VIHNYGHGGYGVTTAPGT  245 (267)
Q Consensus       182 ~~~~~~~~~~~~~~~~l~~~~~~~~P~l~~~~~~~~w~G~rp~~pd----------------l~~~~G~gg~G~t~a~~~  245 (267)
                      ++++|+.++++++...|++++.++.|+|..++++..|+|+||.++.                |+|++||||.|+|++||+
T Consensus       246 Q~g~w~~ei~~~D~~dIl~rc~aL~P~l~~a~ii~E~vGlRP~Rk~vRlE~e~~~~~~k~~~VVHnYGHgG~G~Tl~wGt  325 (342)
T KOG3923|consen  246 QEGNWNLEITDEDRRDILERCCALEPSLRHAEIIREWVGLRPGRKQVRLEAELRTRGGKRLTVVHNYGHGGNGFTLGWGT  325 (342)
T ss_pred             ccCcccCcCChhhHHHHHHHHHHhCcccccceehhhhhcccCCCCceeeeeeeecCCCccceeEeeccCCCCceecccch
Confidence            9999999999999999999999999999999999999999999875                799999999999999999


Q ss_pred             HHHHHHHHHhhhCC
Q psy5261         246 SRYAVQLVKQALDP  259 (267)
Q Consensus       246 a~~la~li~~~l~~  259 (267)
                      |...+.++...++.
T Consensus       326 Alea~~Lv~~~l~~  339 (342)
T KOG3923|consen  326 ALEAAKLVLDALGA  339 (342)
T ss_pred             HHHHHHHHHHHhhh
Confidence            99999999988775

>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
3g3e_A351 Crystal Structure Of Human D-Amino Acid Oxidase In 6e-28
2du8_A347 Crystal Structure Of Human D-Amino Acid Oxidase Len 6e-28
1an9_A340 D-Amino Acid Oxidase Complex With O-Aminobenzoate L 2e-26
1kif_A347 D-Amino Acid Oxidase From Pig Kidney Length = 347 3e-26
1c0k_A363 Crystal Structure Analysis Of D-Amino Acid Oxidase 1e-09
3if9_A382 Crystal Structure Of Glycine Oxidase G51sA54RH244A 5e-05
1ryi_A382 Structure Of Glycine Oxidase With Bound Inhibitor G 6e-05
1ng3_A390 Complex Of Thio (Glycine Oxidase) With Acetyl-Glyci 8e-05
>pdb|3G3E|A Chain A, Crystal Structure Of Human D-Amino Acid Oxidase In Complex With Hydroxyquinolin-2(1h) Length = 351 Back     alignment and structure 
Iteration: 1

 Score =  120 bits (302), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 138/285 (48%), Gaps = 33/285 (11%)
Query: 4   PVISVDASVQNEDGSRTL---TLSQTKFSADGSTGKAMISTYQT--SLLKNASIENLVPV 58
           P +S   + Q  D S+      LS        + G  +IS Y      + + S ++ V  
Sbjct: 54  PYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLG 113
Query: 59  YRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVSSFSGLES 118
           +R   P EL +    Y YG +  +L++E  ++L W  +R++++G KF +  V SF  +  
Sbjct: 114 FRKLTPRELDM-FPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAR 172
Query: 119 E-FDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYD--------VYVIP 169
           E  D + NC G+ A AL RD  L P RGQ++KV APW+ HF  L +D         Y+IP
Sbjct: 173 EGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHF-ILTHDPERGIYNSPYIIP 231
Query: 170 HSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHR---- 225
            +   VTLGG     ++S   +  D  +I E C  L P L+ A ++ E  G RP R    
Sbjct: 232 GTQ-TVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIR 290
Query: 226 ------------SLVIHNYGHGGYGVTTAPGTSRYAVQLVKQALD 258
                       + VIHNYGHGGYG+T   G +  A +L  + L+
Sbjct: 291 LEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILE 335
>pdb|2DU8|A Chain A, Crystal Structure Of Human D-Amino Acid Oxidase Length = 347 Back     alignment and structure
>pdb|1AN9|A Chain A, D-Amino Acid Oxidase Complex With O-Aminobenzoate Length = 340 Back     alignment and structure
>pdb|1KIF|A Chain A, D-Amino Acid Oxidase From Pig Kidney Length = 347 Back     alignment and structure
>pdb|1C0K|A Chain A, Crystal Structure Analysis Of D-Amino Acid Oxidase In Complex With L-Lactate Length = 363 Back     alignment and structure
>pdb|3IF9|A Chain A, Crystal Structure Of Glycine Oxidase G51sA54RH244A MUTANT IN COMPLEX With Inhibitor Glycolate Length = 382 Back     alignment and structure
>pdb|1RYI|A Chain A, Structure Of Glycine Oxidase With Bound Inhibitor Glycolate Length = 382 Back     alignment and structure
>pdb|1NG3|A Chain A, Complex Of Thio (Glycine Oxidase) With Acetyl-Glycine Length = 390 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 7e-55
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 3e-49
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 4e-17
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 4e-04
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 7e-04
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 Back     alignment and structure
 Score =  179 bits (456), Expect = 7e-55
 Identities = 83/247 (33%), Positives = 121/247 (48%), Gaps = 29/247 (11%)

Query: 48  KNASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRR 107
            + S ++ V  +R   P EL +    Y YG +  +L++E  ++L W  +R++++G KF +
Sbjct: 103 PDPSWKDTVLGFRKLTPRELDMFPD-YGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQ 161

Query: 108 GTVSSFSGLESE-FDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYL----- 161
             V SF  +  E  D + NC G+ A AL RD  L P RGQ++KV APW+ HF        
Sbjct: 162 RKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPER 221

Query: 162 --DYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWC 219
                 Y+IP +   VTLGG     ++S   +  D  +I E C  L P L+ A ++ E  
Sbjct: 222 GIYNSPYIIPGTQT-VTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT 280

Query: 220 GLRPHRSL----------------VIHNYGHGGYGVTTAPGTSRYAVQLVKQALD--PTS 261
           G RP R                  VIHNYGHGGYG+T   G +  A +L  + L+    S
Sbjct: 281 GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLS 340

Query: 262 SL-KSKL 267
            +  S L
Sbjct: 341 RMPPSHL 347
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Length = 689 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 100.0
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.97
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.96
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.95
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.94
3dme_A369 Conserved exported protein; structural genomics, P 99.94
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.94
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.94
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.93
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.92
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.92
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.92
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.9
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.9
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.89
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.88
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.87
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.85
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.85
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.36
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.13
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 98.03
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.71
3atr_A 453 Conserved archaeal protein; saturating double bond 97.65
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 97.61
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.42
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.39
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 96.97
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 96.91
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 96.83
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 96.79
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 96.74
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 96.57
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 96.46
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 96.42
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.23
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 96.2
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 95.92
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 95.62
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 95.48
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 94.43
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 94.06
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 93.82
2cul_A232 Glucose-inhibited division protein A-related PROT 92.86
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 92.71
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 91.82
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 91.12
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 91.06
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 90.71
2ywl_A180 Thioredoxin reductase related protein; uncharacter 90.68
2gqf_A401 Hypothetical protein HI0933; structural genomics, 90.1
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 89.72
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 89.65
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 89.21
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 88.82
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 88.38
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 88.13
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 87.97
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 87.89
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 87.78
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 87.68
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 87.07
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 86.91
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 86.2
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 86.07
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 86.04
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 85.82
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 85.08
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 83.53
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 83.5
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 82.25
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 82.12
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 81.57
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 80.89
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 80.75
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 80.32
2bry_A 497 NEDD9 interacting protein with calponin homology a 80.13
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-34  Score=257.94  Aligned_cols=232  Identities=37%  Similarity=0.597  Sum_probs=196.2

Q ss_pred             ceEEEEEeeEeccCC--chhHhhhCCCcEECChhhhhcCCCCceeEEEeeeeeeehHHHHHHHHHHHHhCCcEEEEEeeC
Q psy5261          34 TGKAMISTYQTSLLK--NASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGTVS  111 (267)
Q Consensus        34 ~g~~~~~g~~~~~~~--~~~~~~~g~~~~~l~~~el~~~P~~~~~g~~~~~~~vdp~~~~~~L~~~~~~~G~~~~~~~V~  111 (267)
                      +++...+|+.++.++  ..+|++.+.+++.++++|+...| .+..|++++++++||.+++.+|++.++++|++|++++|+
T Consensus        87 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~l~~~e~~~~p-~~~~~~~~~~~~v~p~~~~~~l~~~~~~~Gv~i~~~~V~  165 (351)
T 3g3e_A           87 LGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFP-DYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVE  165 (351)
T ss_dssp             HTEEEEEEEEEESSCCCCCGGGGTSEEEEECCHHHHTTCT-TCCEEEEEEEEEECHHHHHHHHHHHHHHTTCEEEECCCC
T ss_pred             ccEEEEEEEEEecCCccccCHHHhCCCceECCHHHhccCC-CCceEEEecceEEcHHHHHHHHHHHHHHCCCEEEEEEeC
Confidence            567778888666554  25778889999999999995338 777888777899999999999999999999999888888


Q ss_pred             Ccccc-ccCCCEEEEccCcCchhhcCCCCceeecceEEEEECCCcceEEE-e------CCeEEEEecCCCeEEEcceeec
Q psy5261         112 SFSGL-ESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYY-L------DYDVYVIPHSNGAVTLGGCRHY  183 (267)
Q Consensus       112 ~l~~~-~~~ad~VV~aaG~~s~~l~~~~~l~p~rg~~~~~~~p~~~~~v~-~------~~~~y~~p~~~g~l~lGg~~~~  183 (267)
                      +++.. .++||.||+|+|.|+..|+++.|+.|+|||++.+++|.++++++ .      +...|++|+.+ ++++|++.+.
T Consensus       166 ~i~~~~~~~a~~VV~A~G~~s~~l~~~~~l~p~rg~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~p~~~-~~~iGg~~~~  244 (351)
T 3g3e_A          166 SFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQ-TVTLGGIFQL  244 (351)
T ss_dssp             CHHHHHHTTCSEEEECCGGGGGGTSCCTTCEEEEEEEEEEECTTCCSEEEECCTTTCTTCSCEEEECSS-CEEEECCCEE
T ss_pred             CHHHhhcCCCCEEEECCCcChHhhcCCCceeecCCcEEEEeCCCcceEEEeccccCCCCceeEEEeCCC-cEEEeeeeec
Confidence            88654 37899999999999999998899999999999999876555554 1      13579999987 8999999988


Q ss_pred             CCCCCCCCHHHHHHHHHHHHhhCCCCCCCCceeeeccccCCCCC----------------eEEEeCCCchhhhccHHHHH
Q psy5261         184 DSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSL----------------VIHNYGHGGYGVTTAPGTSR  247 (267)
Q Consensus       184 ~~~~~~~~~~~~~~l~~~~~~~~P~l~~~~~~~~w~G~rp~~pd----------------l~~~~G~gg~G~t~a~~~a~  247 (267)
                      .+++..++++..+.+++.+.++||.+.+.++.+.|+|+||++||                +|+++||+|+||++||++|+
T Consensus       245 ~~~~~~~~~~~~~~l~~~~~~~~P~l~~~~i~~~w~G~r~~t~D~p~~~~~ig~~~~~~~~~~~~G~~g~G~~~ap~~g~  324 (351)
T 3g3e_A          245 GNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCAL  324 (351)
T ss_dssp             TCCCCSCCHHHHHHHHHHHHHHCGGGGGCEEEEEEEEEEEECSSCEEEEEEECCSSSCEEEEEEECCTTCHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCccCCcEeeeeEeeCCCCCCccceeeeccCCCCCCeEEEEeCCCcchHhhhHHHHH
Confidence            88888899999999999999999999888999999999999887                78999999999999999999


Q ss_pred             HHHHHHHhhhCC---CCccCCCC
Q psy5261         248 YAVQLVKQALDP---TSSLKSKL  267 (267)
Q Consensus       248 ~la~li~~~l~~---~~~~~~~~  267 (267)
                      .+|++|.+.+++   ++.++|||
T Consensus       325 ~la~li~~~~~~~~~~~~~~~~~  347 (351)
T 3g3e_A          325 EAAKLFGRILEEKKLSRMPPSHL  347 (351)
T ss_dssp             HHHHHHHHHHHHTTCC-------
T ss_pred             HHHHHHHHHHHhcccccCCcccc
Confidence            999999998874   45566776
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 267
d1c0pa295 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodot 5e-20
d1ryia288 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillu 2e-19
d1kifa293 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus 9e-19
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 1e-15
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 2e-12
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 4e-10
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Length = 95 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FAD-linked reductases, C-terminal domain
superfamily: FAD-linked reductases, C-terminal domain
family: D-aminoacid oxidase-like
domain: D-aminoacid oxidase
species: Rhodotorula gracilis [TaxId: 5286]

 Score = 80.2 bits (197), Expect = 5e-20
 Identities = 27/93 (29%), Positives = 35/93 (37%), Gaps = 9/93 (9%)

Query: 142 PIRGQVIKVWAPWLSHFYYL---DYDVYVIPHSNGAVTLGGCRHYDSYSRDISRHDTASI 198
           PIRGQ + V +P               Y+IP   G V  GG      +   ++      I
Sbjct: 3   PIRGQTVLVKSPCKRCTMDSSDPASPAYIIPRPGGEVICGGTYGVGDWDLSVNPETVQRI 62

Query: 199 LERCYSLLPRL------EEAPVLYEWCGLRPHR 225
           L+ C  L P +      E   VL    GLRP R
Sbjct: 63  LKHCLRLDPTISSDGTIEGIEVLRHNVGLRPAR 95
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 88 Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Length = 93 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 99.8
d1ryia288 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.71
d1kifa293 D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823 99.7
d1c0pa295 D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 99.63
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 99.53
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.45
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.45
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.32
d1pj5a3119 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.6
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 94.98
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 94.78
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 94.78
d2gf3a2104 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.37
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 93.86
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 93.63
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.06
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.02
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 92.69
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 92.47
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 92.37
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 92.15
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 91.53
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 91.48
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 90.69
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.78
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.51
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 87.54
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 87.31
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 86.76
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 85.39
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 83.48
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 83.32
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 80.76
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 80.17
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 80.08
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-binding domain
superfamily: Nucleotide-binding domain
family: D-aminoacid oxidase, N-terminal domain
domain: D-aminoacid oxidase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=99.80  E-value=1.7e-19  Score=149.31  Aligned_cols=156  Identities=28%  Similarity=0.478  Sum_probs=128.9

Q ss_pred             CCceEEEEEeeEeccCCc--hhHhhhCCCcEECChhhhhcCCCCceeEEEeeeeeeehHHHHHHHHHHHHhCCcEEEEEe
Q psy5261          32 GSTGKAMISTYQTSLLKN--ASIENLVPVYRDAQPDELVVGNKTYKYGSYSETLVIENSDFLPWAMKRVSKQGGKFRRGT  109 (267)
Q Consensus        32 ~~~g~~~~~g~~~~~~~~--~~~~~~g~~~~~l~~~el~~~P~~~~~g~~~~~~~vdp~~~~~~L~~~~~~~G~~~~~~~  109 (267)
                      ...++....++.+++++.  +.+++....++.++..+....| ....++.+.++++||.+++.+|.+.++++|++|++.+
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~-~~~~~~~~~~~~id~~~~~~~L~~~~~~~G~~~~~~~  163 (246)
T d1kifa1          85 ANMGLTPVSGYNLFREAVPDPYWKDMVLGFRKLTPRELDMFP-DYRYGWFNTSLILEGRKYLQWLTERLTERGVKFFLRK  163 (246)
T ss_dssp             TTTTEEEEEEEEEESSCCCCCTTTTTSEEEEECCHHHHTTST-TCCEEEEEEEEEECHHHHHHHHHHHHHHTTCEEEECC
T ss_pred             CceeEEEcccEEEecCchhhhhHHhhccchhhhccccccCCc-ccceEEEccceEEcHHHHHHHHHHHHHHCCCEEEEeE
Confidence            456777888888888753  5777778888888877765444 5556677777999999999999999999999999888


Q ss_pred             eCCcccc-ccCCCEEEEccCcCchhhcCCCCceeecceEEEEECCCcceEEEeCCeEEEEecCCCeEEEcceeecCCCCC
Q psy5261         110 VSSFSGL-ESEFDFVFNCAGLGAQALCRDRKLTPIRGQVIKVWAPWLSHFYYLDYDVYVIPHSNGAVTLGGCRHYDSYSR  188 (267)
Q Consensus       110 V~~l~~~-~~~ad~VV~aaG~~s~~l~~~~~l~p~rg~~~~~~~p~~~~~v~~~~~~y~~p~~~g~l~lGg~~~~~~~~~  188 (267)
                      |+++++. ...+|.||||||.|++.+.++.+.+|+|||.+.+..+.+                                 
T Consensus       164 v~~l~~~~~~~~d~vVnctG~~a~~l~~d~~~~~~r~~~lr~~~~~~---------------------------------  210 (246)
T d1kifa1         164 VESFEEVARGGADVIINCTGVWAGVLQPDPLQVRLEREQLRFGSSNT---------------------------------  210 (246)
T ss_dssp             CCCHHHHHHTTCSEEEECCGGGHHHHSCCTTSCEEEEEEEESSSCEE---------------------------------
T ss_pred             eCCHHHhccCCCCEEEECCcccccccCCCCCeeccceEEEeeCCCCC---------------------------------
Confidence            9998764 468999999999999999999999999999864322110                                 


Q ss_pred             CCCHHHHHHHHHHHHhhCCCCCCCCceeeeccccCCCCCeEEEeCCCchhhhccHHHHHHHHHHHHhhhCC
Q psy5261         189 DISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVIHNYGHGGYGVTTAPGTSRYAVQLVKQALDP  259 (267)
Q Consensus       189 ~~~~~~~~~l~~~~~~~~P~l~~~~~~~~w~G~rp~~pdl~~~~G~gg~G~t~a~~~a~~la~li~~~l~~  259 (267)
                                                            -|+||+||||.|+|++||||..+++++.+.|.+
T Consensus       211 --------------------------------------~vvh~yghgg~G~~l~~G~a~~~~~lv~~~l~~  243 (246)
T d1kifa1         211 --------------------------------------EVIHNYGHGGYGLTIHWGCALEVAKLFGKVLEE  243 (246)
T ss_dssp             --------------------------------------EEEEEECCGGGHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             --------------------------------------EEEEecCCCCCeEEeehHHHHHHHHHHHHHHHh
Confidence                                                  078999999999999999999999999998865
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a3 d.16.1.5 (A:220-338) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2gf3a2 d.16.1.3 (A:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure