Psyllid ID: psy5413


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
SLVSFREYSDSHRQTKIAREVLTLPTPALVESTPLSRSWSDNGNLSIPAMYCWLLPVPLRLGKVNIRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTMGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARLPLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK
ccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHccccccEEEEcccccHHHHHccccccccccEEEEEEEEEEEEccccccccHHHHHHHcccccccccccccEEEEEccccccccEEccHHHHHHHHHHHHHccccEEEccccccHHHHHccccEEEEEccccccccccccccccHHHHcc
ccEEEEEcccccHHHHHHHHHcccccccHccccHHHHHcccccccccccEEEEEccccccccccccEEEEcccHHHccccHHHHHHHHccccccHHHcccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccccEEEEEcccccEEEEEccHHHHHcccEEEEEEccccccccccccccHHHHHHHcccccccccccEEEEEEEccEcccccEcccHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHcccEEEEEccccccccccEEEEEcHHHHHH
slvsfreysdshrqtkiarevltlptpalvestplsrswsdngnlsipamycwllpvplrlgkvnirtvdirsdtiskptMEMKNYMfncevgddvyledptcKELQEKAAKLAGKeaaifvpsgtmGNLIAIMThcdrrdseiivgdcshimlweqggasqtsVYSQIGRVLMrgvtnqkdgtfdLDEMEAkfstadnihcastslvcventhnycggtvlpMQWLRELKARCqehnipvhmdgarlplaEVCASVDTVMFCLskglgapvgsilagpeefiqk
slvsfreysdshrqtkiarevltlptpalvestplsrswsdnGNLSIPAMYCWLLPVPLrlgkvnirtvdirsdtiskptmeMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAaifvpsgtmGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARLPLAEVCASVDTVMFCLSKGlgapvgsilagpeefiqk
SLVSFREYSDSHRQTKIAREVLTLPTPALVESTPLSRSWSDNGNLSIPAMYCWLLPVPLRLGKVNIRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCkelqekaaklagkeaaIFVPSGTMGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARLPLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK
********************VLTL***ALV*******SWSDNGNLSIPAMYCWLLPVPLRLGKVNIRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTMGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARLPLAEVCASVDTVMFCLSKGLGAPVGSILA********
*LVS****S***************************************************LGKVNIRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTMGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARLPLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQ*
**************TKIAREVLTLPTPALVESTPLSRSWSDNGNLSIPAMYCWLLPVPLRLGKVNIRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTMGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARLPLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK
SLVSFREYSDSHRQTKIAREVLTLPTPALVESTPLSRSWSDNGNLSIPAMYCWLLPVPLRLGKVNIRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTMGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARLPLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLVSFREYSDSHRQTKIAREVLTLPTPALVESTPLSRSWSDNGNLSIPAMYCWLLPVPLRLGKVNIRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTMGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARLPLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query285 2.2.26 [Sep-21-2011]
Q21890 413 Uncharacterized protein R yes N/A 0.736 0.508 0.449 9e-54
O07051 338 L-allo-threonine aldolase N/A N/A 0.733 0.618 0.441 3e-49
P75823 333 Low specificity L-threoni N/A N/A 0.722 0.618 0.424 5e-45
P58319 333 Low specificity L-threoni N/A N/A 0.722 0.618 0.420 2e-44
O13940 376 Probable low-specificity yes N/A 0.726 0.550 0.391 2e-38
P37303 387 Low specificity L-threoni yes N/A 0.726 0.534 0.340 1e-28
O13427 374 Low-specificity L-threoni N/A N/A 0.726 0.553 0.333 3e-28
Q9UW18 389 Alanine racemase TOXG OS= N/A N/A 0.726 0.532 0.311 5e-28
O74267 382 Low-specificity L-threoni yes N/A 0.726 0.541 0.340 9e-28
A1JJH3 466 Tryptophanase OS=Yersinia no N/A 0.214 0.130 0.382 0.0001
>sp|Q21890|YF64_CAEEL Uncharacterized protein R102.4 OS=Caenorhabditis elegans GN=R102.4 PE=2 SV=3 Back     alignment and function desciption
 Score =  210 bits (534), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 102/227 (44%), Positives = 146/227 (64%), Gaps = 17/227 (7%)

Query: 68  TVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTM 127
           ++D+RSDT++ P++EM+  M    VGDDVY ED T   L+++ A+L GKEA +FV SGTM
Sbjct: 66  SIDLRSDTVTVPSVEMRRAMAEAIVGDDVYGEDTTTNRLEQRCAELFGKEAGLFVTSGTM 125

Query: 128 GNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDL 187
           GNL+AIM HC +R  EIIVG  +HI  WEQG       Y+Q   +    +  + DGT DL
Sbjct: 126 GNLLAIMAHC-QRGEEIIVGRYNHIHRWEQGN------YAQFAGISATTLEVKPDGTMDL 178

Query: 188 DEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGAR 247
           +++E      D  H  ++ L+C+ENTHNY GG  LP++W+R +K   +  ++ VHMDGAR
Sbjct: 179 NDIEQAIRVKD-CHMPASKLICIENTHNYTGGKALPIEWMRSVKQLAERRDLKVHMDGAR 237

Query: 248 L---------PLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK 285
           +          ++++ +  DTV  C SKGLGAPVGSI+ GP++FI +
Sbjct: 238 IYNAAVASNCSVSKIASFADTVQMCFSKGLGAPVGSIVVGPKDFIDR 284





Caenorhabditis elegans (taxid: 6239)
>sp|O07051|LTAA_AERJA L-allo-threonine aldolase OS=Aeromonas jandaei GN=ltaA PE=1 SV=1 Back     alignment and function description
>sp|P75823|LTAE_ECOLI Low specificity L-threonine aldolase OS=Escherichia coli (strain K12) GN=ltaE PE=1 SV=1 Back     alignment and function description
>sp|P58319|LTAE_ECO57 Low specificity L-threonine aldolase OS=Escherichia coli O157:H7 GN=ltaE PE=3 SV=1 Back     alignment and function description
>sp|O13940|GLY1_SCHPO Probable low-specificity L-threonine aldolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gly1 PE=3 SV=1 Back     alignment and function description
>sp|P37303|GLY1_YEAST Low specificity L-threonine aldolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLY1 PE=1 SV=2 Back     alignment and function description
>sp|O13427|GLY1_CANAX Low-specificity L-threonine aldolase OS=Candida albicans GN=GLY1 PE=3 SV=1 Back     alignment and function description
>sp|Q9UW18|TOXG_COCCA Alanine racemase TOXG OS=Cochliobolus carbonum GN=TOXG PE=3 SV=1 Back     alignment and function description
>sp|O74267|GLY1_ASHGO Low-specificity L-threonine aldolase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLY1 PE=3 SV=3 Back     alignment and function description
>sp|A1JJH3|TNAA_YERE8 Tryptophanase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) GN=tnaA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
157111289 386 l-allo-threonine aldolase [Aedes aegypti 0.750 0.554 0.526 8e-64
328720750 393 PREDICTED: l-allo-threonine aldolase-lik 0.743 0.539 0.530 3e-62
158291946 386 AGAP003688-PA [Anopheles gambiae str. PE 0.750 0.554 0.539 4e-62
332373700378 unknown [Dendroctonus ponderosae] 0.750 0.566 0.524 2e-61
260798574360 hypothetical protein BRAFLDRAFT_260210 [ 0.729 0.577 0.535 3e-61
427789843371 Putative threonine aldolase [Rhipicephal 0.747 0.574 0.519 8e-61
312377094240 hypothetical protein AND_11716 [Anophele 0.750 0.891 0.526 1e-60
170052611 386 L-allo-threonine aldolase [Culex quinque 0.743 0.549 0.526 1e-60
91084465380 PREDICTED: similar to l-allo-threonine a 0.764 0.573 0.516 2e-60
357612191370 hypothetical protein KGM_00088 [Danaus p 0.736 0.567 0.513 5e-60
>gi|157111289|ref|XP_001651472.1| l-allo-threonine aldolase [Aedes aegypti] gi|108878466|gb|EAT42691.1| AAEL005819-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  249 bits (637), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 121/230 (52%), Positives = 159/230 (69%), Gaps = 16/230 (6%)

Query: 65  NIRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPS 124
           ++R VD RSDT+S PT  M+  M+   VGDDVY EDPT  EL+ +AA L GKEAA+FVPS
Sbjct: 15  SVRVVDFRSDTVSVPTATMRKAMYEAAVGDDVYGEDPTVNELERRAAALLGKEAALFVPS 74

Query: 125 GTMGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGT 184
           GTMGNL+A+M HC+RR SE IVGD +H+ L+EQGG+      +Q+  VL+  + N+ DGT
Sbjct: 75  GTMGNLLAVMVHCNRRGSEAIVGDMAHVFLYEQGGS------AQLAGVLLNNIKNKPDGT 128

Query: 185 FDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMD 244
           F LDE+  KF   D IH  +T LV +ENTHN CGG VLP+QW+ +L   C+E +I +HMD
Sbjct: 129 FCLDELRNKFRGFD-IHEPNTELVLIENTHNMCGGKVLPLQWMEDLSNICKEKSIKLHMD 187

Query: 245 GAR---------LPLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK 285
           GAR         +P++ V   VD+V FCLSK L  PVGS+L G ++FI++
Sbjct: 188 GARVFNAAEHLKVPVSRVVRDVDSVCFCLSKSLACPVGSMLVGSKDFIKQ 237




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328720750|ref|XP_003247119.1| PREDICTED: l-allo-threonine aldolase-like isoform 2 [Acyrthosiphon pisum] gi|328720752|ref|XP_003247120.1| PREDICTED: l-allo-threonine aldolase-like isoform 3 [Acyrthosiphon pisum] gi|328720754|ref|XP_001948416.2| PREDICTED: l-allo-threonine aldolase-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|158291946|ref|XP_313472.4| AGAP003688-PA [Anopheles gambiae str. PEST] gi|157017532|gb|EAA08948.4| AGAP003688-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|332373700|gb|AEE61991.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|260798574|ref|XP_002594275.1| hypothetical protein BRAFLDRAFT_260210 [Branchiostoma floridae] gi|229279508|gb|EEN50286.1| hypothetical protein BRAFLDRAFT_260210 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|427789843|gb|JAA60373.1| Putative threonine aldolase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|312377094|gb|EFR24010.1| hypothetical protein AND_11716 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|170052611|ref|XP_001862301.1| L-allo-threonine aldolase [Culex quinquefasciatus] gi|167873456|gb|EDS36839.1| L-allo-threonine aldolase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|91084465|ref|XP_970449.1| PREDICTED: similar to l-allo-threonine aldolase [Tribolium castaneum] gi|270008687|gb|EFA05135.1| hypothetical protein TcasGA2_TC015250 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357612191|gb|EHJ67858.1| hypothetical protein KGM_00088 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
ZFIN|ZDB-GENE-040704-14 413 tha1 "threonine aldolase 1" [D 0.747 0.515 0.467 1.6e-45
TAIR|locus:2100860 355 THA2 "threonine aldolase 2" [A 0.750 0.602 0.421 2.1e-45
WB|WBGene00011291 413 R102.4 [Caenorhabditis elegans 0.736 0.508 0.440 5e-44
FB|FBgn0039094 383 CG10184 [Drosophila melanogast 0.736 0.548 0.446 1.7e-43
TAIR|locus:2025645 358 THA1 "threonine aldolase 1" [A 0.750 0.597 0.417 4e-42
TIGR_CMR|CHY_0904 344 CHY_0904 "low-specificity L-th 0.729 0.604 0.426 1.6e-40
TIGR_CMR|GSU_3162 348 GSU_3162 "L-allo-threonine ald 0.715 0.586 0.397 4.3e-38
UNIPROTKB|F1MVX8 397 LOC507443 "Uncharacterized pro 0.768 0.551 0.387 1.1e-37
UNIPROTKB|F1PI34 391 LOC491550 "Uncharacterized pro 0.754 0.549 0.372 5.7e-36
UNIPROTKB|P75823 333 ltaE "LtaE" [Escherichia coli 0.722 0.618 0.380 7.2e-36
ZFIN|ZDB-GENE-040704-14 tha1 "threonine aldolase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 478 (173.3 bits), Expect = 1.6e-45, P = 1.6e-45
 Identities = 108/231 (46%), Positives = 141/231 (61%)

Query:    66 IRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCXXXXXXXXXXXXXXXXIFVPSG 125
             IRTVD+RSDT++KP   M+  M   EVGDDV+ EDPT                 ++VPSG
Sbjct:    43 IRTVDLRSDTVTKPGAAMRRAMAEAEVGDDVFGEDPTVNELQKIAAEMFGMKAALYVPSG 102

Query:   126 TMGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTS-VYSQIGRVLMRGVTNQKDGT 184
             TM NLIA+M HC  R  E+I GD SHI ++EQGG++Q + V+S   R L  G     DGT
Sbjct:   103 TMSNLIAVMVHCRERGDEMIAGDLSHIHIYEQGGSAQLAGVHSATLRTL--G-----DGT 155

Query:   185 FDLDEMEAKFSTA-DNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHM 243
             FDLD++ +K      + H   + LVCVENTHN  GG VLP+ +L+EL++   +  + VHM
Sbjct:   156 FDLDQLISKIRHGYPDPHYPRSRLVCVENTHNIQGGRVLPLAFLQELRSVADQFGLAVHM 215

Query:   244 DGARLPLAEVCASVD---------TVMFCLSKGLGAPVGSILAGPEEFIQK 285
             DGAR+  A V   V          +V  CLSKGLGAPVGS+L G ++FIQ+
Sbjct:   216 DGARVMNAAVALGVQPSAILQHCHSVSVCLSKGLGAPVGSMLGGSKDFIQR 266




GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0016829 "lyase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2100860 THA2 "threonine aldolase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00011291 R102.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0039094 CG10184 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2025645 THA1 "threonine aldolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0904 CHY_0904 "low-specificity L-threonine aldolase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3162 GSU_3162 "L-allo-threonine aldolase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVX8 LOC507443 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PI34 LOC491550 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P75823 ltaE "LtaE" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.2LOW CONFIDENCE prediction!
4th Layer4.1.2.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
PLN02721 353 PLN02721, PLN02721, threonine aldolase 1e-91
pfam01212288 pfam01212, Beta_elim_lyase, Beta-eliminating lyase 5e-88
cd06502 338 cd06502, TA_like, Low-specificity threonine aldola 5e-73
COG2008 342 COG2008, GLY1, Threonine aldolase [Amino acid tran 5e-71
PRK10534 333 PRK10534, PRK10534, L-threonine aldolase; Provisio 9e-66
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 1e-14
COG0520 405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 7e-08
pfam00155 357 pfam00155, Aminotran_1_2, Aminotransferase class I 2e-06
cd06454 349 cd06454, KBL_like, KBL_like; this family belongs t 4e-05
PRK13238 460 PRK13238, tnaA, tryptophanase/L-cysteine desulfhyd 5e-05
pfam00266 370 pfam00266, Aminotran_5, Aminotransferase class-V 7e-05
cd06450 345 cd06450, DOPA_deC_like, DOPA decarboxylase family 0.001
cd00609 350 cd00609, AAT_like, Aspartate aminotransferase fami 0.001
cd00617 431 cd00617, Tnase_like, Tryptophanase family (Tnase) 0.002
TIGR01979 403 TIGR01979, sufS, cysteine desulfurases, SufSfamily 0.002
TIGR02617 467 TIGR02617, tnaA_trp_ase, tryptophanase, leader pep 0.003
>gnl|CDD|178323 PLN02721, PLN02721, threonine aldolase Back     alignment and domain information
 Score =  275 bits (704), Expect = 1e-91
 Identities = 110/228 (48%), Positives = 146/228 (64%), Gaps = 15/228 (6%)

Query: 67  RTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGT 126
           R VD+RSDT++KPT  M+  M N EV DDV   DPT   L+E+ AK+ GKEAA+FVPSGT
Sbjct: 6   RVVDLRSDTVTKPTDAMRAAMANAEVDDDVLGYDPTALRLEEEMAKIFGKEAALFVPSGT 65

Query: 127 MGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFD 186
           MGNLI+++ HCD R SE+I+GD SHI L+E GG       S +G V  R V N +DGT D
Sbjct: 66  MGNLISVLVHCDVRGSEVILGDNSHIHLYENGGI------STLGGVHPRTVKNNEDGTMD 119

Query: 187 LDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGA 246
           LD +EA      + H  +T L+C+ENTH  CGG  L +++  ++    + H + +H+DGA
Sbjct: 120 LDAIEAAIRPKGDDHFPTTRLICLENTHANCGGRCLSVEYTDKVGELAKRHGLKLHIDGA 179

Query: 247 RLPLAEVCASV---------DTVMFCLSKGLGAPVGSILAGPEEFIQK 285
           R+  A V   V         D+V  CLSKGLGAPVGS++ G + FI+K
Sbjct: 180 RIFNASVALGVPVHRLVKAADSVSVCLSKGLGAPVGSVIVGSKSFIRK 227


Length = 353

>gnl|CDD|216367 pfam01212, Beta_elim_lyase, Beta-eliminating lyase Back     alignment and domain information
>gnl|CDD|99748 cd06502, TA_like, Low-specificity threonine aldolase (TA) Back     alignment and domain information
>gnl|CDD|224919 COG2008, GLY1, Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236710 PRK10534, PRK10534, L-threonine aldolase; Provisional Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|99747 cd06454, KBL_like, KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>gnl|CDD|237314 PRK13238, tnaA, tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|99741 cd00617, Tnase_like, Tryptophanase family (Tnase) Back     alignment and domain information
>gnl|CDD|131034 TIGR01979, sufS, cysteine desulfurases, SufSfamily Back     alignment and domain information
>gnl|CDD|131666 TIGR02617, tnaA_trp_ase, tryptophanase, leader peptide-associated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 285
KOG1368|consensus 384 100.0
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.98
COG2008 342 GLY1 Threonine aldolase [Amino acid transport and 99.98
COG4992 404 ArgD Ornithine/acetylornithine aminotransferase [A 99.96
PLN02721 353 threonine aldolase 99.95
cd06502 338 TA_like Low-specificity threonine aldolase (TA). T 99.94
COG0436 393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.94
COG0161 449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.93
PRK10534 333 L-threonine aldolase; Provisional 99.92
COG0160 447 GabT 4-aminobutyrate aminotransferase and related 99.92
TIGR02617 467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.91
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.91
COG0001 432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.9
PRK04013 364 argD acetylornithine/acetyl-lysine aminotransferas 99.9
KOG0257|consensus 420 99.9
PRK04073 396 rocD ornithine--oxo-acid transaminase; Provisional 99.9
TIGR03246 397 arg_catab_astC succinylornithine transaminase fami 99.9
KOG1401|consensus 433 99.9
PRK09331 387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.9
COG0156 388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.9
PLN02482 474 glutamate-1-semialdehyde 2,1-aminomutase 99.89
PRK13355 517 bifunctional HTH-domain containing protein/aminotr 99.89
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 99.89
TIGR02618 450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.89
PRK07482 461 hypothetical protein; Provisional 99.89
PRK01278 389 argD acetylornithine transaminase protein; Provisi 99.89
PRK12389 428 glutamate-1-semialdehyde aminotransferase; Provisi 99.89
TIGR01822 393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.89
PRK11522 459 putrescine--2-oxoglutarate aminotransferase; Provi 99.88
PRK08960 387 hypothetical protein; Provisional 99.88
PRK12381 406 bifunctional succinylornithine transaminase/acetyl 99.88
PRK07179 407 hypothetical protein; Provisional 99.88
PRK05965 459 hypothetical protein; Provisional 99.88
TIGR03372 442 putres_am_tran putrescine aminotransferase. Member 99.88
PRK06207 405 aspartate aminotransferase; Provisional 99.88
PRK07681 399 aspartate aminotransferase; Provisional 99.88
cd06452 361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.88
PLN00175 413 aminotransferase family protein; Provisional 99.88
PLN00145 430 tyrosine/nicotianamine aminotransferase; Provision 99.88
PRK03715 395 argD acetylornithine transaminase protein; Provisi 99.88
PRK09147 396 succinyldiaminopimelate transaminase; Provisional 99.88
PLN02242 418 methionine gamma-lyase 99.88
PRK07366 388 succinyldiaminopimelate transaminase; Validated 99.88
TIGR01821 402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.88
PRK08068 389 transaminase; Reviewed 99.88
PRK06767 386 methionine gamma-lyase; Provisional 99.88
COG0520 405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.88
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.87
PRK06062 451 hypothetical protein; Provisional 99.87
PLN02624 474 ornithine-delta-aminotransferase 99.87
PRK06225 380 aspartate aminotransferase; Provisional 99.87
PRK00854 401 rocD ornithine--oxo-acid transaminase; Reviewed 99.87
PRK12403 460 putative aminotransferase; Provisional 99.87
TIGR03540 383 DapC_direct LL-diaminopimelate aminotransferase. T 99.87
PRK05942 394 aspartate aminotransferase; Provisional 99.87
PRK05964 423 adenosylmethionine--8-amino-7-oxononanoate transam 99.87
PLN02656 409 tyrosine transaminase 99.87
PRK06943 453 adenosylmethionine--8-amino-7-oxononanoate transam 99.87
PLN00144 382 acetylornithine transaminase 99.87
PLN02822 481 serine palmitoyltransferase 99.87
TIGR03537 350 DapC succinyldiaminopimelate transaminase. Note: t 99.87
PRK05093 403 argD bifunctional N-succinyldiaminopimelate-aminot 99.87
PRK06916 460 adenosylmethionine--8-amino-7-oxononanoate transam 99.87
PRK07483 443 hypothetical protein; Provisional 99.87
PRK12414 384 putative aminotransferase; Provisional 99.87
PRK07046 453 aminotransferase; Validated 99.87
PLN02187 462 rooty/superroot1 99.87
PRK09276 385 LL-diaminopimelate aminotransferase; Provisional 99.87
PRK13392 410 5-aminolevulinate synthase; Provisional 99.87
PRK13237 460 tyrosine phenol-lyase; Provisional 99.87
PRK07324 373 transaminase; Validated 99.87
PRK08360 443 4-aminobutyrate aminotransferase; Provisional 99.87
TIGR03538 393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.87
PRK00615 433 glutamate-1-semialdehyde aminotransferase; Provisi 99.87
PRK09064 407 5-aminolevulinate synthase; Validated 99.87
PRK08742 472 adenosylmethionine--8-amino-7-oxononanoate transam 99.87
PRK06290 410 aspartate aminotransferase; Provisional 99.87
TIGR00709 442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.86
PRK08361 391 aspartate aminotransferase; Provisional 99.86
PTZ00433 412 tyrosine aminotransferase; Provisional 99.86
PRK09792 421 4-aminobutyrate transaminase; Provisional 99.86
PLN00143 409 tyrosine/nicotianamine aminotransferase; Provision 99.86
TIGR01437 363 selA_rel uncharacterized pyridoxal phosphate-depen 99.86
PRK01533 366 histidinol-phosphate aminotransferase; Validated 99.86
PRK06938 464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.86
PRK07309 391 aromatic amino acid aminotransferase; Validated 99.86
PRK07337 388 aminotransferase; Validated 99.86
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 99.86
PRK07481 449 hypothetical protein; Provisional 99.86
PLN02760 504 4-aminobutyrate:pyruvate transaminase 99.86
PRK07030 466 adenosylmethionine--8-amino-7-oxononanoate transam 99.86
PRK08363 398 alanine aminotransferase; Validated 99.86
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 99.86
PRK07682 378 hypothetical protein; Validated 99.86
PRK15481 431 transcriptional regulatory protein PtsJ; Provision 99.86
PRK07678 451 aminotransferase; Validated 99.86
COG0079 356 HisC Histidinol-phosphate/aromatic aminotransferas 99.86
PRK08636 403 aspartate aminotransferase; Provisional 99.86
PRK13393 406 5-aminolevulinate synthase; Provisional 99.86
PRK06348 384 aspartate aminotransferase; Provisional 99.86
PRK06108 382 aspartate aminotransferase; Provisional 99.86
PRK08117 433 4-aminobutyrate aminotransferase; Provisional 99.86
PRK07503 403 methionine gamma-lyase; Provisional 99.86
PRK07480 456 putative aminotransferase; Validated 99.86
TIGR02407 412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.86
PRK09264 425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.86
PRK02936 377 argD acetylornithine aminotransferase; Provisional 99.86
PRK06541 460 hypothetical protein; Provisional 99.86
PRK09028 394 cystathionine beta-lyase; Provisional 99.86
PRK05764 393 aspartate aminotransferase; Provisional 99.86
TIGR00700 420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.86
PRK09265 404 aminotransferase AlaT; Validated 99.86
PRK08912 387 hypothetical protein; Provisional 99.86
PRK07683 387 aminotransferase A; Validated 99.86
PRK06105 460 aminotransferase; Provisional 99.85
PLN02955 476 8-amino-7-oxononanoate synthase 99.85
PRK07495 425 4-aminobutyrate aminotransferase; Provisional 99.85
PLN02368407 alanine transaminase 99.85
PRK06173 429 adenosylmethionine--8-amino-7-oxononanoate transam 99.85
TIGR01141 346 hisC histidinol-phosphate aminotransferase. Histid 99.85
PRK09105 370 putative aminotransferase; Provisional 99.85
KOG1549|consensus 428 99.85
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.85
TIGR01264 401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.85
TIGR00713 423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.85
TIGR02539 370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.85
PRK04612 408 argD acetylornithine transaminase protein; Provisi 99.85
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 99.85
PRK06931 459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.85
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 99.85
PRK07777 387 aminotransferase; Validated 99.85
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.85
PRK07550 386 hypothetical protein; Provisional 99.85
PRK05639 457 4-aminobutyrate aminotransferase; Provisional 99.85
PRK06777 421 4-aminobutyrate aminotransferase; Provisional 99.85
PRK08593 445 4-aminobutyrate aminotransferase; Provisional 99.85
KOG0259|consensus 447 99.85
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 99.85
TIGR00858 360 bioF 8-amino-7-oxononanoate synthase. This model r 99.85
PRK06234 400 methionine gamma-lyase; Provisional 99.85
PRK07050 394 cystathionine beta-lyase; Provisional 99.85
PRK13360 442 omega amino acid--pyruvate transaminase; Provision 99.85
PRK05957 389 aspartate aminotransferase; Provisional 99.85
PRK08574 385 cystathionine gamma-synthase; Provisional 99.85
PLN02651 364 cysteine desulfurase 99.85
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 99.85
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 99.85
TIGR01885 401 Orn_aminotrans ornithine aminotransferase. This mo 99.85
PRK03244 398 argD acetylornithine aminotransferase; Provisional 99.85
PRK06058 443 4-aminobutyrate aminotransferase; Provisional 99.85
PRK09082 386 methionine aminotransferase; Validated 99.85
PRK07568 397 aspartate aminotransferase; Provisional 99.84
PRK07986 428 adenosylmethionine--8-amino-7-oxononanoate transam 99.84
PRK09148 405 aminotransferase; Validated 99.84
PRK05630 422 adenosylmethionine--8-amino-7-oxononanoate transam 99.84
PRK06082 459 4-aminobutyrate aminotransferase; Provisional 99.84
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.84
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 99.84
TIGR01265 403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.84
PRK09221 445 beta alanine--pyruvate transaminase; Provisional 99.84
cd06451 356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.84
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 99.84
PRK07036 466 hypothetical protein; Provisional 99.84
PLN02483 489 serine palmitoyltransferase 99.84
PRK08249 398 cystathionine gamma-synthase; Provisional 99.84
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 99.84
cd06454 349 KBL_like KBL_like; this family belongs to the pyri 99.84
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 99.84
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.84
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 99.84
PRK06939 397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.84
PRK14012 404 cysteine desulfurase; Provisional 99.84
cd00610 413 OAT_like Acetyl ornithine aminotransferase family. 99.84
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 99.84
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.84
PTZ00377 481 alanine aminotransferase; Provisional 99.84
TIGR03235 353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.84
PRK06836 394 aspartate aminotransferase; Provisional 99.84
PRK10874 401 cysteine sulfinate desulfinase; Provisional 99.84
PRK02627 396 acetylornithine aminotransferase; Provisional 99.84
PRK06918 451 4-aminobutyrate aminotransferase; Reviewed 99.83
PRK09275 527 aspartate aminotransferase; Provisional 99.83
PRK03158 359 histidinol-phosphate aminotransferase; Provisional 99.83
PRK05958 385 8-amino-7-oxononanoate synthase; Reviewed 99.83
PTZ00125 400 ornithine aminotransferase-like protein; Provision 99.83
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 99.83
PRK04870 356 histidinol-phosphate aminotransferase; Provisional 99.83
PRK08175 395 aminotransferase; Validated 99.83
PRK08861 388 cystathionine gamma-synthase; Provisional 99.83
PRK02948 381 cysteine desulfurase; Provisional 99.83
PRK08114 395 cystathionine beta-lyase; Provisional 99.83
PRK05769 441 4-aminobutyrate aminotransferase; Provisional 99.83
PF00155 363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.83
PRK14809 357 histidinol-phosphate aminotransferase; Provisional 99.83
PRK05939 397 hypothetical protein; Provisional 99.83
PRK02731 367 histidinol-phosphate aminotransferase; Validated 99.83
PLN02855 424 Bifunctional selenocysteine lyase/cysteine desulfu 99.83
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 99.83
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 99.83
PLN03026 380 histidinol-phosphate aminotransferase; Provisional 99.83
PRK06917 447 hypothetical protein; Provisional 99.83
PRK00950 361 histidinol-phosphate aminotransferase; Validated 99.83
PRK05839 374 hypothetical protein; Provisional 99.83
PRK07811 388 cystathionine gamma-synthase; Provisional 99.83
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 99.83
PRK02610 374 histidinol-phosphate aminotransferase; Provisional 99.83
PRK06209 431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 99.83
COG1104 386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.83
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 99.83
TIGR01825 385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.82
KOG1404|consensus 442 99.82
PRK08297 443 L-lysine aminotransferase; Provisional 99.82
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.82
PRK05387 353 histidinol-phosphate aminotransferase; Provisional 99.82
PLN02231 534 alanine transaminase 99.82
PRK05166 371 histidinol-phosphate aminotransferase; Provisional 99.82
PRK06855 433 aminotransferase; Validated 99.82
PRK06460 376 hypothetical protein; Provisional 99.82
PLN02450 468 1-aminocyclopropane-1-carboxylate synthase 99.82
PRK06148 1013 hypothetical protein; Provisional 99.82
PRK03321 352 putative aminotransferase; Provisional 99.82
PRK05968 389 hypothetical protein; Provisional 99.82
PRK08045 386 cystathionine gamma-synthase; Provisional 99.82
PRK13034 416 serine hydroxymethyltransferase; Reviewed 99.82
PRK03317 368 histidinol-phosphate aminotransferase; Provisional 99.81
TIGR03251 431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.81
PRK14807 351 histidinol-phosphate aminotransferase; Provisional 99.81
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.81
PRK06107 402 aspartate aminotransferase; Provisional 99.81
COG1168 388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.81
PRK08153 369 histidinol-phosphate aminotransferase; Provisional 99.81
PLN02409 401 serine--glyoxylate aminotransaminase 99.81
PRK07671 377 cystathionine beta-lyase; Provisional 99.81
KOG1402|consensus 427 99.81
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.81
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.81
PRK05967 395 cystathionine beta-lyase; Provisional 99.81
PRK00062 426 glutamate-1-semialdehyde aminotransferase; Provisi 99.81
TIGR02326 363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.81
PRK08776 405 cystathionine gamma-synthase; Provisional 99.81
TIGR01329 378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.81
cd00609 350 AAT_like Aspartate aminotransferase family. This f 99.81
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 99.81
PRK13520 371 L-tyrosine decarboxylase; Provisional 99.81
PLN02974 817 adenosylmethionine-8-amino-7-oxononanoate transami 99.81
PRK06149 972 hypothetical protein; Provisional 99.81
PRK01688 351 histidinol-phosphate aminotransferase; Provisional 99.81
PRK08056 356 threonine-phosphate decarboxylase; Provisional 99.8
TIGR03576 346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.8
TIGR00707 379 argD acetylornithine and succinylornithine aminotr 99.8
TIGR00474 454 selA seryl-tRNA(sec) selenium transferase. In bact 99.8
PRK08247 366 cystathionine gamma-synthase; Reviewed 99.8
PRK04311 464 selenocysteine synthase; Provisional 99.8
PRK07505 402 hypothetical protein; Provisional 99.8
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 99.8
PRK04260 375 acetylornithine aminotransferase; Provisional 99.8
PRK09257 396 aromatic amino acid aminotransferase; Provisional 99.8
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.8
PLN02590 539 probable tyrosine decarboxylase 99.8
PRK06176 380 cystathionine gamma-synthase/cystathionine beta-ly 99.8
PRK08064 390 cystathionine beta-lyase; Provisional 99.8
PTZ00376 404 aspartate aminotransferase; Provisional 99.8
PF01053 386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.8
PRK07049 427 methionine gamma-lyase; Validated 99.8
PRK07269 364 cystathionine gamma-synthase; Reviewed 99.8
PRK07590 409 L,L-diaminopimelate aminotransferase; Validated 99.8
TIGR00508 427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.79
TIGR00699 464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 99.79
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.79
cd00378 402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.79
PRK13479 368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.79
PRK08354 311 putative aminotransferase; Provisional 99.79
PLN02607 447 1-aminocyclopropane-1-carboxylate synthase 99.79
PRK06358 354 threonine-phosphate decarboxylase; Provisional 99.79
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.79
TIGR03301 355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.79
PRK00011 416 glyA serine hydroxymethyltransferase; Reviewed 99.78
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.78
cd06450 345 DOPA_deC_like DOPA decarboxylase family. This fami 99.78
PRK08088 425 4-aminobutyrate aminotransferase; Validated 99.78
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.78
PRK07865 364 N-succinyldiaminopimelate aminotransferase; Review 99.78
PF00266 371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.77
PRK03967 337 histidinol-phosphate aminotransferase; Provisional 99.77
PLN02880 490 tyrosine decarboxylase 99.77
PLN02509 464 cystathionine beta-lyase 99.77
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.77
COG1167 459 ARO8 Transcriptional regulators containing a DNA-b 99.77
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.77
TIGR03539 357 DapC_actino succinyldiaminopimelate transaminase. 99.77
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.77
TIGR03812 373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.77
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.77
PRK05937 370 8-amino-7-oxononanoate synthase; Provisional 99.76
COG0399 374 WecE Predicted pyridoxal phosphate-dependent enzym 99.76
PRK05664 330 threonine-phosphate decarboxylase; Reviewed 99.76
COG2873 426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.76
PLN02672 1082 methionine S-methyltransferase 99.76
TIGR03542 402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.76
PRK02769 380 histidine decarboxylase; Provisional 99.76
PLN03032 374 serine decarboxylase; Provisional 99.75
PRK04635 354 histidinol-phosphate aminotransferase; Provisional 99.75
COG0626 396 MetC Cystathionine beta-lyases/cystathionine gamma 99.75
PRK09440 416 avtA valine--pyruvate transaminase; Provisional 99.75
PLN02397 423 aspartate transaminase 99.75
PRK14808 335 histidinol-phosphate aminotransferase; Provisional 99.74
TIGR03799 522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.74
PRK07908 349 hypothetical protein; Provisional 99.74
PRK07582 366 cystathionine gamma-lyase; Validated 99.74
PRK07392 360 threonine-phosphate decarboxylase; Validated 99.74
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.74
PRK04366 481 glycine dehydrogenase subunit 2; Validated 99.74
TIGR01788 431 Glu-decarb-GAD glutamate decarboxylase. This model 99.74
PRK04781 364 histidinol-phosphate aminotransferase; Provisional 99.73
PLN03226 475 serine hydroxymethyltransferase; Provisional 99.73
PRK06425 332 histidinol-phosphate aminotransferase; Validated 99.73
TIGR01140 330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.73
KOG0053|consensus 409 99.72
PRK08637 388 hypothetical protein; Provisional 99.72
PRK13580 493 serine hydroxymethyltransferase; Provisional 99.72
TIGR01814 406 kynureninase kynureninase. This model describes ky 99.71
PLN02271 586 serine hydroxymethyltransferase 99.7
PTZ00094 452 serine hydroxymethyltransferase; Provisional 99.7
COG0075 383 Serine-pyruvate aminotransferase/archaeal aspartat 99.7
PRK00451 447 glycine dehydrogenase subunit 1; Validated 99.69
KOG1360|consensus 570 99.69
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.69
KOG1359|consensus 417 99.69
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.69
PRK06959 339 putative threonine-phosphate decarboxylase; Provis 99.69
COG0112 413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.69
PLN02263 470 serine decarboxylase 99.68
PF01276 417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.67
PRK06434 384 cystathionine gamma-lyase; Validated 99.67
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 99.67
KOG0628|consensus 511 99.67
PF06838 403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 99.67
COG0076 460 GadB Glutamate decarboxylase and related PLP-depen 99.66
COG1103 382 Archaea-specific pyridoxal phosphate-dependent enz 99.65
PF00464 399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.63
PRK05367 954 glycine dehydrogenase; Provisional 99.63
PRK12566 954 glycine dehydrogenase; Provisional 99.62
KOG0256|consensus 471 99.62
TIGR03811 608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.61
KOG1403|consensus 452 99.59
PRK15029 755 arginine decarboxylase; Provisional 99.58
COG1003 496 GcvP Glycine cleavage system protein P (pyridoxal- 99.54
PLN02724 805 Molybdenum cofactor sulfurase 99.53
KOG1357|consensus 519 99.52
PF03841 367 SelA: L-seryl-tRNA selenium transferase; InterPro: 99.5
PRK03080 378 phosphoserine aminotransferase; Provisional 99.49
PRK13578 720 ornithine decarboxylase; Provisional 99.46
KOG2862|consensus 385 99.44
KOG0634|consensus 472 99.43
COG3977 417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.43
COG1921 395 SelA Selenocysteine synthase [seryl-tRNASer seleni 99.42
COG3033 471 TnaA Tryptophanase [Amino acid transport and metab 99.38
KOG0633|consensus 375 99.37
PRK15400 714 lysine decarboxylase CadA; Provisional 99.36
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.36
COG4100 416 Cystathionine beta-lyase family protein involved i 99.32
KOG1358|consensus 467 99.31
PRK05355 360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.3
TIGR01366 361 serC_3 phosphoserine aminotransferase, putative. T 99.3
cd00611 355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.29
KOG0258|consensus 475 99.29
KOG0629|consensus 510 99.28
KOG2467|consensus 477 99.26
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.25
PRK05367 954 glycine dehydrogenase; Provisional 99.17
TIGR01364 349 serC_1 phosphoserine aminotransferase. This model 99.11
PF02347 429 GDC-P: Glycine cleavage system P-protein; InterPro 99.09
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.07
TIGR01365 374 serC_2 phosphoserine aminotransferase, Methanosarc 99.02
COG0403 450 GcvP Glycine cleavage system protein P (pyridoxal- 98.95
KOG2040|consensus 1001 98.94
COG3844 407 Kynureninase [Amino acid transport and metabolism] 98.92
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.73
COG1448 396 TyrB Aspartate/tyrosine/aromatic aminotransferase 98.66
PLN02452 365 phosphoserine transaminase 98.65
PF12897 425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 98.57
PRK12566 954 glycine dehydrogenase; Provisional 98.5
KOG1383|consensus 491 98.43
PRK12462 364 phosphoserine aminotransferase; Provisional 98.4
KOG1405|consensus 484 98.37
PF05889 389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.18
KOG1411|consensus 427 97.79
KOG1412|consensus 410 97.28
KOG3846|consensus 465 97.01
KOG3843|consensus 432 96.9
KOG2040|consensus 1001 96.41
PF04864 363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 96.15
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 95.88
COG1932 365 SerC Phosphoserine aminotransferase [Coenzyme meta 93.92
smart00642166 Aamy Alpha-amylase domain. 81.46
>KOG1368|consensus Back     alignment and domain information
Probab=100.00  E-value=2e-36  Score=250.98  Aligned_cols=215  Identities=54%  Similarity=0.941  Sum_probs=202.7

Q ss_pred             CCeeeeeccCCcCCCcHHHHHHHHhcccCCCCccCChhHHHHHHHHHhHcCCCcEEEcCChHHHHHHHHHHccccCCCeE
Q psy5413          65 NIRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTMGNLIAIMTHCDRRDSEI  144 (285)
Q Consensus        65 ~~~~~~~~~~~~~~~~~~v~~a~~~~~~~~~~y~~~~~~~~l~~~la~~~g~~~~~~~~~Gs~a~~~al~~~~~~~g~~v  144 (285)
                      -....||+++..+.|..+|+++|.++..++..|+.+|...+||+..|+++|+|.++|+.||+.+|+++++..+.++|.++
T Consensus        20 ~~~~vDLRSDTvT~PTdeMr~am~eA~vgDdVyGeD~tt~rLE~~vA~l~GKEAgLFv~SGTmgNllaIm~Hc~~rg~ei   99 (384)
T KOG1368|consen   20 THRSVDLRSDTVTVPTDEMRRAMAEASVGDDVYGEDPTTNRLEQRVAELFGKEAGLFVPSGTMGNLLAIMVHCHQRGSEI   99 (384)
T ss_pred             eeeccccccccccCChHHHHHHHhhcccCcccccCCccHHHHHHHHHHHhCccceeeecccccccHHHHHHHhcCCCceE
Confidence            35678999999999999999999999999999999999999999999999999999999999999999999998899999


Q ss_pred             EecCCcceeeecccccccccccccccceeeeeeecCCCCCCCHHHHHHHhcccc-cccCCceEEEEEecccCCCCeeeCC
Q psy5413         145 IVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTAD-NIHCASTSLVCVENTHNYCGGTVLP  223 (285)
Q Consensus       145 i~~~~~h~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~d~~~l~~~i~~~~-~~~~~~~~~v~i~~~~n~~gG~~~~  223 (285)
                      |+.+..|++.++.++++      ...|+.+.++...+++.+|++++|++|.... +.|.+.|++|.+|++++.+||.++|
T Consensus       100 i~gd~~HI~~~E~gg~s------~l~gv~~~tv~~e~dgtm~ledIe~~ir~~~GD~H~p~T~LIclENT~~~~Gg~vlP  173 (384)
T KOG1368|consen  100 IVGDRAHIHRYEQGGIS------QLAGVHVRTVKNENDGTMDLEDIEAAIRVPKGDCHMPPTKLICLENTHNNCGGKVLP  173 (384)
T ss_pred             EeccchheeehhccChh------hhccceeEeeeeCCCCeeeHHHHHHhhcCCCCCccCCCceEEEeeccccccCceEee
Confidence            99999999999999998      7789999999998999999999999998544 7788999999999999999899999


Q ss_pred             HHHHHHHHHHHHHcCCeEEEeCccC---------ChhhhcccCCeEEEecccccCcceeEEeecCcccccC
Q psy5413         224 MQWLRELKARCQEHNIPVHMDGARL---------PLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK  285 (285)
Q Consensus       224 ~~~l~~i~~la~~~gi~li~Dea~~---------~~~~~~~~~dv~~~s~sK~l~~p~gg~~~~~~~~i~~  285 (285)
                      .|++.++.++|++||+.|++|+++.         +...+++.+|.+..|+||+||+|.|.+++++++||++
T Consensus       174 le~~~~v~~lak~~glkLH~DGARi~NAavasgV~vk~i~~~fDSVsiCLSKglgAPVGSViVG~k~FI~k  244 (384)
T KOG1368|consen  174 LEELDRVKALAKRHGLKLHMDGARIFNAAVASGVPVKKICSAFDSVSICLSKGLGAPVGSVIVGSKDFIDK  244 (384)
T ss_pred             HHHHHHHHHHHhccCCeeecchhhhhhHHHHcCCCHHHHHHhhhhhhhhhhccCCCCcccEEEccHHHHHH
Confidence            9999999999999999999999977         6667788999999999999999999999999999874



>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>KOG1401|consensus Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>KOG1404|consensus Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>KOG1402|consensus Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>KOG0053|consensus Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>KOG1360|consensus Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>KOG1359|consensus Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG0628|consensus Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>KOG1403|consensus Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>KOG1357|consensus Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0633|consensus Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1358|consensus Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>KOG0258|consensus Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>KOG2467|consensus Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>KOG1405|consensus Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>KOG1411|consensus Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>KOG3846|consensus Back     alignment and domain information
>KOG3843|consensus Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
1jg8_A 347 Crystal Structure Of Threonine Aldolase (Low-Specif 2e-42
2fm1_A 355 Crystal Structure Of L-allo-threonine Aldolase (tm1 2e-42
1lw4_A 347 X-Ray Structure Of L-Threonine Aldolase (Low-Specif 7e-39
3lws_A 357 Crystal Structure Of Putative Aromatic Amino Acid B 1e-08
3pj0_A 359 Crystal Structure Of A Putative L-Allo-Threonine Al 7e-07
>pdb|1JG8|A Chain A, Crystal Structure Of Threonine Aldolase (Low-Specificity) Length = 347 Back     alignment and structure

Iteration: 1

Score = 169 bits (428), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 94/226 (41%), Positives = 127/226 (56%), Gaps = 18/226 (7%) Query: 69 VDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCXXXXXXXXXXXXXXXXIFVPSGTMG 128 +D+RSDT++KPT EM+ M EVGDDVY EDPT +FVPSGTMG Sbjct: 6 IDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMG 65 Query: 129 NLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLD 188 N ++IM H R D I+ D SHI +E G + S +M K+G D D Sbjct: 66 NQVSIMAHTQRGDEVILEAD-SHIFWYEVGAMAVLSG-------VMPHPVPGKNGAMDPD 117 Query: 189 EMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARL 248 ++ K NIH TSL+ +ENTHN GG V+P++ ++E+ +EH I VH+DGAR+ Sbjct: 118 DVR-KAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARI 176 Query: 249 ---------PLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK 285 P+ E D+VMFCLS GL APVGS++ G +FI++ Sbjct: 177 FNASIASGVPVKEYAGYADSVMFCLSXGLCAPVGSVVVGDRDFIER 222
>pdb|2FM1|A Chain A, Crystal Structure Of L-allo-threonine Aldolase (tm1744) From Thermotoga Maritima At 2.25 A Resolution Length = 355 Back     alignment and structure
>pdb|1LW4|A Chain A, X-Ray Structure Of L-Threonine Aldolase (Low-Specificity) In Complex With L-Allo-Threonine Length = 347 Back     alignment and structure
>pdb|3LWS|A Chain A, Crystal Structure Of Putative Aromatic Amino Acid Beta- Eliminating LyaseTHREONINE ALDOLASE. (YP_001813866.1) FROM Exiguobacterium Sp. 255-15 At 2.00 A Resolution Length = 357 Back     alignment and structure
>pdb|3PJ0|A Chain A, Crystal Structure Of A Putative L-Allo-Threonine Aldolase (Lmo0305) From Listeria Monocytogenes Egd-E At 1.80 A Resolution Length = 359 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
1jg8_A 347 L-ALLO-threonine aldolase; glycine biosynthesis, p 1e-104
3lws_A 357 Aromatic amino acid beta-eliminating lyase/threoni 1e-101
3pj0_A 359 LMO0305 protein; structural genomics, joint center 3e-98
1v72_A 356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 2e-74
1svv_A 359 Threonine aldolase; structural genomics, structura 4e-71
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 1e-66
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 3e-42
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 8e-38
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 4e-13
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 5e-07
2aeu_A 374 Hypothetical protein MJ0158; selenocysteine syntha 2e-05
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 2e-04
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Length = 347 Back     alignment and structure
 Score =  305 bits (784), Expect = e-104
 Identities = 102/226 (45%), Positives = 140/226 (61%), Gaps = 18/226 (7%)

Query: 69  VDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTMG 128
           +D+RSDT++KPT EM+  M   EVGDDVY EDPT  EL+  AA+  GKEAA+FVPSGTMG
Sbjct: 6   IDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMG 65

Query: 129 NLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLD 188
           N ++IM H  R D E+I+   SHI  +E G        + +  V+   V  + +G  D D
Sbjct: 66  NQVSIMAHTQRGD-EVILEADSHIFWYEVGAM------AVLSGVMPHPVPGK-NGAMDPD 117

Query: 189 EMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQWLRELKARCQEHNIPVHMDGARL 248
           ++        NIH   TSL+ +ENTHN  GG V+P++ ++E+    +EH I VH+DGAR+
Sbjct: 118 DVRKAIR-PRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARI 176

Query: 249 ---------PLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK 285
                    P+ E     D+VMFCLSKGL APVGS++ G  +FI++
Sbjct: 177 FNASIASGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIER 222


>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Length = 357 Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Length = 359 Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Length = 356 Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Length = 359 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Length = 467 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Length = 456 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Length = 374 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Length = 755 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
1jg8_A 347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.95
1v72_A 356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.94
4ao9_A 454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.93
3pj0_A 359 LMO0305 protein; structural genomics, joint center 99.93
3lws_A 357 Aromatic amino acid beta-eliminating lyase/threoni 99.93
3ly1_A 354 Putative histidinol-phosphate aminotransferase; st 99.92
3kki_A 409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.92
2w8t_A 427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.91
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.91
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 99.91
1o4s_A 389 Aspartate aminotransferase; TM1255, structural gen 99.91
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.91
3tqx_A 399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.91
1v2d_A 381 Glutamine aminotransferase; PLP, riken structural 99.91
3ele_A 398 Amino transferase; RER070207001803, structural gen 99.91
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.91
1j32_A 388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.91
1gd9_A 389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.91
1fc4_A 401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.91
3nra_A 407 Aspartate aminotransferase; structural genomics, j 99.91
1bs0_A 384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.9
3euc_A 367 Histidinol-phosphate aminotransferase 2; YP_297314 99.9
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 99.9
2dou_A 376 Probable N-succinyldiaminopimelate aminotransfera; 99.9
1u08_A 386 Hypothetical aminotransferase YBDL; alpha beta pro 99.9
3tfu_A 457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.9
3a2b_A 398 Serine palmitoyltransferase; vitamin B6-dependent 99.9
2dr1_A 386 PH1308 protein, 386AA long hypothetical serine ami 99.9
3fdb_A 377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.9
3ffh_A 363 Histidinol-phosphate aminotransferase; APC88260, l 99.9
2x5d_A 412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.9
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 99.9
1svv_A 359 Threonine aldolase; structural genomics, structura 99.9
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 99.9
3jtx_A 396 Aminotransferase; NP_283882.1, structural genomics 99.9
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 99.9
1b5p_A 385 Protein (aspartate aminotransferase); pyridoxal en 99.9
3k28_A 429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.9
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 99.9
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.9
3ezs_A 376 Aminotransferase ASPB; NP_207418.1, structural gen 99.9
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.9
3dyd_A 427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.9
3get_A 365 Histidinol-phosphate aminotransferase; NP_281508.1 99.9
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 99.9
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.89
3kax_A 383 Aminotransferase, classes I and II; PLP, C-S lyase 99.89
1xi9_A 406 Putative transaminase; alanine aminotransferase, s 99.89
3dzz_A 391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.89
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.89
2o1b_A 404 Aminotransferase, class I; aminotrasferase; HET: P 99.89
1elu_A 390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.89
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.89
1iug_A 352 Putative aspartate aminotransferase; wild type, py 99.89
2gb3_A 409 Aspartate aminotransferase; TM1698, structural gen 99.89
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 99.89
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 99.89
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 99.89
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.89
1m32_A 366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.89
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.89
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 99.89
1vjo_A 393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.89
2pb2_A 420 Acetylornithine/succinyldiaminopimelate aminotran; 99.89
4e3q_A 473 Pyruvate transaminase; aminotransferase, transfera 99.89
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 99.89
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.89
3l8a_A 421 METC, putative aminotransferase, probable beta-cys 99.89
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.89
3fq8_A 427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.89
4atq_A 456 4-aminobutyrate transaminase; transferase; HET: PL 99.89
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.89
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 99.89
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.89
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.89
2z61_A 370 Probable aspartate aminotransferase 2; amino acid 99.88
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 99.88
3f0h_A 376 Aminotransferase; RER070207000802, structural geno 99.88
2oat_A 439 Ornithine aminotransferase; 5-fluoromethylornithin 99.88
4e77_A 429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.88
3aow_A 448 Putative uncharacterized protein PH0207; protein-P 99.88
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.88
3kgw_A 393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.88
1z7d_A 433 Ornithine aminotransferase; structural genomics co 99.88
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.88
3ftb_A 361 Histidinol-phosphate aminotransferase; structural 99.88
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.88
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 99.88
3ruy_A 392 Ornithine aminotransferase; structural genomics, c 99.88
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 99.88
1iay_A 428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.88
2yrr_A 353 Aminotransferase, class V; structural genomics, NP 99.88
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 99.88
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.88
2zyj_A 397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.88
1vp4_A 425 Aminotransferase, putative; structural genomics, j 99.88
3hmu_A 472 Aminotransferase, class III; structural genomics, 99.88
3f9t_A 397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.88
3op7_A 375 Aminotransferase class I and II; PLP-dependent tra 99.88
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.88
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 99.87
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.87
2bwn_A 401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.87
1c7n_A 399 Cystalysin; transferase, aminotransferase, pyridox 99.87
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 99.87
3p1t_A 337 Putative histidinol-phosphate aminotransferase; PL 99.87
1bw0_A 416 TAT, protein (tyrosine aminotransferase); tyrosine 99.87
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 99.87
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 99.87
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.87
2ord_A 397 Acoat, acetylornithine aminotransferase; TM1785, a 99.87
4dq6_A 391 Putative pyridoxal phosphate-dependent transferas; 99.87
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.87
2epj_A 434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.87
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.87
1d2f_A 390 MALY protein; aminotransferase fold, large PLP-bin 99.87
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 99.87
3rq1_A 418 Aminotransferase class I and II; structural genomi 99.87
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 99.87
1lc5_A 364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.87
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.87
4adb_A 406 Succinylornithine transaminase; transferase, PLP e 99.87
2ch1_A 396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.86
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 99.86
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.86
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.86
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.86
1e5e_A 404 MGL, methionine gamma-lyase; methionine biosynthes 99.86
2eo5_A 419 419AA long hypothetical aminotransferase; PLP enzy 99.86
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 99.86
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 99.86
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.86
3qgu_A 449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.86
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 99.86
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.86
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.86
2oga_A 399 Transaminase; PLP-dependent enzyme, desosamine, de 99.85
3hdo_A 360 Histidinol-phosphate aminotransferase; PSI-II, his 99.85
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 99.85
2x5f_A 430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.85
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 99.85
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.85
1fg7_A 356 Histidinol phosphate aminotransferase; HISC, histi 99.85
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 99.85
3cq5_A 369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.85
2e7u_A 424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.85
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 99.85
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 99.85
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 99.85
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.85
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 99.85
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 99.85
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.85
3nmy_A 400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.85
2cjg_A 449 L-lysine-epsilon aminotransferase; internal aldimi 99.85
2yky_A 465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.75
1s0a_A 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.85
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.85
3if2_A 444 Aminotransferase; YP_265399.1, structura genomics, 99.85
2aeu_A 374 Hypothetical protein MJ0158; selenocysteine syntha 99.85
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.84
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.84
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.84
1vef_A 395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.84
3a8u_X 449 Omega-amino acid--pyruvate aminotransferase; large 99.84
2eh6_A 375 Acoat, acetylornithine aminotransferase; ARGD, str 99.84
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.84
2fnu_A 375 Aminotransferase; protein-product complex, structu 99.84
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.84
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.84
3cog_A 403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.84
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 99.84
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.84
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 99.84
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.83
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.83
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 99.83
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 99.83
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 99.83
1sff_A 426 4-aminobutyrate aminotransferase; enzyme complexes 99.83
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.83
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.83
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 99.83
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.83
1o69_A 394 Aminotransferase; structural genomics, unknown fun 99.82
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.82
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.82
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.82
1n8p_A 393 Cystathionine gamma-lyase; three open alpha/beta s 99.82
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.82
1zod_A 433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.82
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.82
3ez1_A 423 Aminotransferase MOCR family; YP_604413.1, struct 99.82
1ibj_A 464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.82
3ei9_A 432 LL-diaminopimelate aminotransferase; lysine biosyn 99.82
3fkd_A 350 L-threonine-O-3-phosphate decarboxylase; structura 99.82
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.82
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.82
3g7q_A 417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.82
3asa_A 400 LL-diaminopimelate aminotransferase; PLP dependent 99.82
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.81
3b1d_A 392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.7
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 99.81
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.81
3ppl_A 427 Aspartate aminotransferase; dimer, PLP-dependent t 99.81
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 99.81
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 99.81
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.81
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.81
2r2n_A 425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.81
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.8
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.8
3d6k_A 422 Putative aminotransferase; APC82464, corynebacteri 99.8
3ffr_A 362 Phosphoserine aminotransferase SERC; structural ge 99.79
1uu1_A 335 Histidinol-phosphate aminotransferase; histidine b 99.79
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 99.79
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 99.78
3ke3_A 379 Putative serine-pyruvate aminotransferase; structu 99.76
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.75
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.75
1w23_A 360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.74
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.72
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.69
2c0r_A 362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.69
4h51_A 420 Aspartate aminotransferase; ssgcid, structural gen 99.67
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.66
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.66
1wyu_A 438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.64
2fyf_A 398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.63
3ou5_A 490 Serine hydroxymethyltransferase, mitochondrial; st 99.62
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.62
3bwn_A 391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.62
3e77_A 377 Phosphoserine aminotransferase; SERC, PLP, structu 99.59
3qm2_A 386 Phosphoserine aminotransferase; structural genomic 99.55
2hox_A 427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.54
3m5u_A 361 Phosphoserine aminotransferase; alpha-beta half sa 99.4
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
Probab=99.95  E-value=1.1e-27  Score=212.01  Aligned_cols=210  Identities=48%  Similarity=0.790  Sum_probs=166.6

Q ss_pred             CeeeeeccCCcCCCcHHHHHHHHhcccCCCCccCChhHHHHHHHHHhHcCCCcEEEcCChHHHHHHHHHHccccCCCeEE
Q psy5413          66 IRTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGTMGNLIAIMTHCDRRDSEII  145 (285)
Q Consensus        66 ~~~~~~~~~~~~~~~~~v~~a~~~~~~~~~~y~~~~~~~~l~~~la~~~g~~~~~~~~~Gs~a~~~al~~~~~~~g~~vi  145 (285)
                      +.+++|.++....+++++++++.+...+...|++++...+|++.+++++|.+..++++||++|+.+++++++ ++||+|+
T Consensus         3 ~~~i~~~~~~~~~p~~~~~~a~~~~~~~~~~y~~~~~~~~l~~~la~~~g~~~~~~~~~gt~a~~~~~~~~~-~~gd~Vl   81 (347)
T 1jg8_A            3 HMMIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHT-QRGDEVI   81 (347)
T ss_dssp             --CEECSCGGGCCCCHHHHHHHHTCCCCCGGGTCCHHHHHHHHHHHHHHTCSEEEEESCHHHHHHHHHHHHC-CTTCEEE
T ss_pred             ceEEEeccccCCCCCHHHHHHHhcCCCCCcccCCChHHHHHHHHHHHHhCCceEEEecCcHHHHHHHHHHhc-CCCCEEE
Confidence            356899988878889999999987654445677788899999999999999989999999999999998876 6899999


Q ss_pred             ecCCcceeeecccccccccccccccceeeeeeecCCCCCCCHHHHHHHhcccccccCCceEEEEEecccCCCCeeeCCHH
Q psy5413         146 VGDCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQ  225 (285)
Q Consensus       146 ~~~~~h~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~d~~~l~~~i~~~~~~~~~~~~~v~i~~~~n~~gG~~~~~~  225 (285)
                      +++++|..++......      ...|.+++.+ ..+++.+|+++|+++|++.. .+.+++++|++++|+||+||.++|.+
T Consensus        82 ~~~~~~~~~~~~~~~~------~~~g~~~~~v-~~~~~~~d~~~l~~~i~~~~-~~~~~~~~v~~~~~~npt~G~~~~~~  153 (347)
T 1jg8_A           82 LEADSHIFWYEVGAMA------VLSGVMPHPV-PGKNGAMDPDDVRKAIRPRN-IHFPRTSLIAIENTHNRSGGRVVPLE  153 (347)
T ss_dssp             EETTCHHHHSSTTHHH------HHTCCEEEEE-CEETTEECHHHHHHHSCCSC-TTSCCEEEEEEESSBTTTTSBCCCHH
T ss_pred             EcCcchhhhccccchh------hccCeEEEEe-cCCCCccCHHHHHHHhcccc-ccccCceEEEEeccccccCCccCcHH
Confidence            9999987654322122      2347777777 43556689999999997510 01126899999999999989999999


Q ss_pred             HHHHHHHHHHHcCCeEEEeCccC---------ChhhhcccCCeEEEecccccCcceeEEeecCccccc
Q psy5413         226 WLRELKARCQEHNIPVHMDGARL---------PLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQ  284 (285)
Q Consensus       226 ~l~~i~~la~~~gi~li~Dea~~---------~~~~~~~~~dv~~~s~sK~l~~p~gg~~~~~~~~i~  284 (285)
                      ++++|+++|++||+++|+||+|.         ....+..++|.+++++||++++|.|+++++++++++
T Consensus       154 ~l~~i~~~a~~~~~~li~D~a~~~~~~~~~~~~~~~~~~~~d~~~~s~sK~l~~~~G~~~~~~~~~~~  221 (347)
T 1jg8_A          154 NIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIE  221 (347)
T ss_dssp             HHHHHHHHHHHHTCEEEEEETTHHHHHHHHCCCHHHHHHTCSEEEEESSSTTCCSSCEEEEECHHHHH
T ss_pred             HHHHHHHHHHHCCCEEEeehhhhhcchhhcCCChHHhcccccEEEEecccccCCCceEEEEcCHHHHH
Confidence            99999999999999999999863         122233578988889999999988887877776653



>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 285
d2v1pa1 467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 5e-36
d1c7ga_ 456 c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbi 3e-33
d1m6sa_ 343 c.67.1.1 (A:) Low-specificity threonine aldolase { 4e-30
d1ax4a_ 465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 3e-28
d1c4ka2 462 c.67.1.5 (A:108-569) Ornithine decarboxylase major 7e-17
d1v72a1 345 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps 2e-16
d2e7ja1 364 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase ( 4e-11
d1svva_ 340 c.67.1.1 (A:) Low-specificity threonine aldolase { 6e-10
d3bc8a1 445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 9e-09
d2z67a1 434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 9e-09
d1p3wa_ 391 c.67.1.3 (A:) Cysteine desulfurase IscS {Escherich 1e-06
d1mdoa_ 376 c.67.1.4 (A:) Aminotransferase ArnB {Salmonella ty 4e-06
d1b9ha_ 384 c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid syntha 3e-05
d1o69a_ 374 c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, 6e-05
d1js3a_ 476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 1e-04
d1b5pa_ 382 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 2e-04
d1z7da1 404 c.67.1.4 (A:7-410) Ornithine aminotransferase {Pla 0.001
d1gc0a_ 392 c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudom 0.003
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Beta-eliminating lyases
domain: Tryptophan indol-lyase (tryptophanase)
species: Escherichia coli [TaxId: 562]
 Score =  131 bits (331), Expect = 5e-36
 Identities = 47/261 (18%), Positives = 83/261 (31%), Gaps = 40/261 (15%)

Query: 56  PVPLRLGKVNIRTVDIRSDTISKPTMEMKNYMFNC-EVGDDVYLEDPTCKELQEKAAKLA 114
           P  L    V    +D+ +D+ +     +   M      GD+ +    +   L E    + 
Sbjct: 34  PFLLDSEDV---FIDLLTDSGTGA---VTQSMQAAMMRGDEAFSGSRSYYALAESVKNIF 87

Query: 115 GKEAAIFVPSGTMGNLIAIMTHCDRRDSEIIVGDC-----SHIMLWEQGGASQTS----V 165
           G +  I    G     I I     +R+ E  +        S+       G SQ +     
Sbjct: 88  GYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVR 147

Query: 166 YSQIGRVLMRGVTNQKDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQ 225
              I      GV     G FDL+ +E      + +   +   +    T N  GG  + + 
Sbjct: 148 NVYIKEAFDTGVRYDFKGNFDLEGLERG---IEEVGPNNVPYIVATITSNSAGGQPVSLA 204

Query: 226 WLRELKARCQEHNIPVHMDGARL---------------------PLAEVCASVDTVMFCL 264
            L+ + +  ++++IPV MD AR                         E     D +    
Sbjct: 205 NLKAMYSIAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSA 264

Query: 265 SKGLGAPVGSILAGPEEFIQK 285
            K    P+G +L   ++    
Sbjct: 265 KKDAMVPMGGLLCMKDDSFFD 285


>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Length = 456 Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Length = 343 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Length = 462 Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 364 Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Length = 340 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Length = 376 Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Length = 384 Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Length = 374 Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Length = 382 Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 404 Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Length = 392 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
d2e7ja1 364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.92
d1b5pa_ 382 Aspartate aminotransferase, AAT {Thermus thermophi 99.91
d1m6sa_ 343 Low-specificity threonine aldolase {Thermotoga mar 99.91
d1j32a_ 388 Aspartate aminotransferase, AAT {Phormidium lapide 99.91
d1gdea_ 388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.9
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.9
d1fc4a_ 401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.89
d2gsaa_ 427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.89
d1vefa1 387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.88
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.88
d1v2da_ 368 Glutamine aminotransferase {Thermus thermophilus [ 99.88
d2byla1 404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.88
d1bs0a_ 383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.87
d1zoda1 431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.87
d1o4sa_ 375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.86
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.86
d1xi9a_ 395 Putative alanine aminotransferase {Pyrococcus furi 99.86
d2bwna1 396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.85
d1c7na_ 394 Cystalysin {Treponema denticola [TaxId: 158]} 99.85
d1bw0a_ 412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.85
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.84
d2r5ea1 418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.84
d2gb3a1 389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.84
d1sffa_ 425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.84
d1d2fa_ 361 Modulator in mal gene expression, MalY {Escherichi 99.84
d1y4ia1 397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.84
d1z7da1 404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.84
d1gc0a_ 392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.84
d1v72a1 345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.83
d1wsta1 403 Multiple substrate aminotransferase, MSAT {Thermoc 99.82
d1w7la_ 418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.82
d1iaya_ 428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.81
d1lc5a_ 355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.81
d1jf9a_ 405 NifS-like protein/selenocysteine lyase {Escherichi 99.81
d1js3a_ 476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.81
d1elua_ 381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.8
d1m7ya_ 431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.8
d1vp4a_ 420 Putative aminotransferase TM1131 {Thermotoga marit 99.8
d1s0aa_ 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.8
d1u08a_ 382 Putative methionine aminotransferase YdbL {Escheri 99.8
d1ohwa_ 461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.79
d1mdoa_ 376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.79
d2ctza1 421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.78
d1cl1a_ 391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.78
d1qgna_ 398 Cystathionine gamma-synthase, CGS {Common tobacco 99.78
d1ibja_ 380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.78
d1cs1a_ 384 Cystathionine gamma-synthase, CGS {Escherichia col 99.77
d2aeua1 366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.77
d7aata_ 401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.76
d1eg5a_ 376 NifS-like protein/selenocysteine lyase {Thermotoga 99.76
d1t3ia_ 408 Probable cysteine desulfurase SufS {Synechocystis 99.75
d1e5ea_ 394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.74
d1b9ha_ 384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.72
d1ajsa_ 412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.72
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 99.71
d1pmma_ 450 Glutamate decarboxylase beta, GadB {Escherichia co 99.71
d1fg7a_ 354 Histidinol-phosphate aminotransferase HisC {Escher 99.71
d1h0ca_ 388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.7
d1svva_ 340 Low-specificity threonine aldolase {Leishmania maj 99.7
d1yaaa_ 412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.7
d1n8pa_ 393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.7
d1m32a_ 361 2-aminoethylphosphonate transaminase {Salmonella t 99.7
d3tata_ 397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.69
d1o69a_ 374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.69
d1kl1a_ 405 Serine hydroxymethyltransferase {Bacillus stearoth 99.69
d2q7wa1 396 Aspartate aminotransferase, AAT {Escherichia coli 99.68
d1dfoa_ 416 Serine hydroxymethyltransferase {Escherichia coli 99.68
d2ay1a_ 394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.68
d1pffa_ 331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.68
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.67
d2f8ja1 334 Histidinol-phosphate aminotransferase HisC {Thermo 99.66
d2fnua1 371 Spore coat polysaccharide biosynthesis protein C { 99.65
d1qz9a_ 404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.64
d2z67a1 434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.63
d2bkwa1 382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.61
d1rv3a_ 470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.6
d2ch1a1 388 3-hydroxykynurenine transaminase {Malaria mosquito 99.58
d1vjoa_ 377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.57
d2a7va1 463 Serine hydroxymethyltransferase {Human (Homo sapie 99.55
d1iuga_ 348 Subgroup IV putative aspartate aminotransferase {T 99.48
d2hoxa1 425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.36
d2c0ra1 361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.2
d1w23a_ 360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.11
d1bjna_ 360 Phosphoserine aminotransferase, PSAT {Escherichia 99.01
d1wyua1 437 Glycine dehydrogenase (decarboxylating) subunit 1 98.85
d1wyub1 471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.5
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: SepSecS-like
domain: Selenocysteinyl-tRNA synthase (SepSecS)
species: Archaeoglobus fulgidus [TaxId: 2234]
Probab=99.92  E-value=1.3e-24  Score=191.27  Aligned_cols=190  Identities=13%  Similarity=0.208  Sum_probs=148.7

Q ss_pred             CcHHHHHHHHhcccCCC--Cc---------cCChhHHHHHHHHHhHcCCCcEEEcCChHHHHHHHHHHccccCCCeEEec
Q psy5413          79 PTMEMKNYMFNCEVGDD--VY---------LEDPTCKELQEKAAKLAGKEAAIFVPSGTMGNLIAIMTHCDRRDSEIIVG  147 (285)
Q Consensus        79 ~~~~v~~a~~~~~~~~~--~y---------~~~~~~~~l~~~la~~~g~~~~~~~~~Gs~a~~~al~~~~~~~g~~vi~~  147 (285)
                      .++++++|+.+...+..  .|         ...+....+++.+|+++|.+.+++++||++|+.+++.+++ ++||+||++
T Consensus        14 l~~~a~~a~~~~~~g~~~~~~~~~~~~~~~~~~~l~~~~~~~~A~~~g~e~~~~t~g~t~a~~~~~~al~-~~gd~Vi~~   92 (364)
T d2e7ja1          14 LTEEARQALLEWGDGYSVCDFCTTGRLDEIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLA-KKDAWVVMD   92 (364)
T ss_dssp             CCHHHHHHHHHC--------------------CCHHHHHHTHHHHHTTSSEEEEESSHHHHHHHHHHHHC-CTTCEEEEE
T ss_pred             CCHHHHHHHHHHhcCCchhccccccccccccChHHHHHHHHHHHHHhCcCEEEEECcHHHHHHHHHHHHh-CCCcEEEee
Confidence            57889999877543211  11         1224678899999999999999999999999999999987 699999999


Q ss_pred             CCcceeeecccccccccccccccceeeeeeecC--CCCCCCHHHHHHHhcccccccCCceEEEEEecccCCCCeeeCCHH
Q psy5413         148 DCSHIMLWEQGGASQTSVYSQIGRVLMRGVTNQ--KDGTFDLDEMEAKFSTADNIHCASTSLVCVENTHNYCGGTVLPMQ  225 (285)
Q Consensus       148 ~~~h~~~~~~~~~~~~~~~~~~~g~~~~~~~~~--~~~~~d~~~l~~~i~~~~~~~~~~~~~v~i~~~~n~~gG~~~~~~  225 (285)
                      .+.|.+......         ..|.+++.+|..  .++.+|+++++++|++..+  ..++++|++++++|++ |.+.|  
T Consensus        93 ~~~h~s~~~~~~---------~~g~~v~~v~~~~~~~~~i~~~~l~~~i~~~~k--~~~~~lv~i~~~~n~t-G~~~~--  158 (364)
T d2e7ja1          93 ENCHYSSYVAAE---------RAGLNIALVPKTDYPDYAITPENFAQTIEETKK--RGEVVLALITYPDGNY-GNLPD--  158 (364)
T ss_dssp             TTCCHHHHHHHH---------HTTCEEEEECCCCTTTCCCCHHHHHHHHHHHTT--TSCEEEEEEESSCTTT-CCCCC--
T ss_pred             cccccccchHHH---------hccceEEEeeeccccccccCHHHHHhhhhhhcc--cCCceEEEeecCCCCC-ceeec--
Confidence            999976654322         338888888764  3567999999999976322  2267899999999999 89999  


Q ss_pred             HHHHHHHHHHHcCCeEEEeCccC----ChhhhcccCCeEEEecccccCcc-eeEEeecCccccc
Q psy5413         226 WLRELKARCQEHNIPVHMDGARL----PLAEVCASVDTVMFCLSKGLGAP-VGSILAGPEEFIQ  284 (285)
Q Consensus       226 ~l~~i~~la~~~gi~li~Dea~~----~~~~~~~~~dv~~~s~sK~l~~p-~gg~~~~~~~~i~  284 (285)
                       +++|+++|++||+++|+|++|+    +......++|++++|+||+++++ .+|+++.++++++
T Consensus       159 -l~~I~~ia~~~~i~livD~a~~~g~~~~~~~~~g~D~~~~S~~K~~~~~g~~g~l~~~~~~~~  221 (364)
T d2e7ja1         159 -VKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAE  221 (364)
T ss_dssp             -HHHHHHHHHTTTCCEEEECTTTBTTBCCCHHHHTCSEEEEEHHHHSSCCSSCEEEEECTTTTT
T ss_pred             -chhheeccccccchhhccccchhhhhhhcccccccceeeeccccccCCCCCEEEEEECHHHHH
Confidence             9999999999999999999998    22222347899999999999985 4688888877664



>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure