Psyllid ID: psy5532

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKQVAMFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKK
cEEEEEEccccccHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccccEEEEcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHccc
cHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHcccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccc
MFAEMIHTAslihddvidqsdfrrgkpsvnvVYNHKKELISNTNQEELRTISTyyfdgqgkavRPMVSVLMGRAINYHLNRKQVAMFAEMIHTASlihddvidqsdfrrgkpsvnvVYNHKKELISNTNQEELRTISTyyfdgqgkavRPMVSVLMGRAINYHLNRKK
MFAEMihtaslihddvidqsdfrrGKPSvnvvynhkkelisntnqeeLRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKQVAMFAEMIHTASLIHDDVIDQSDFRRGKPSvnvvynhkkelisntnqeeLRTISTYYFDGQGKAVRPMVSVLMGRainyhlnrkk
MFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKQVAMFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKK
******HTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKQVAMFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHL****
MFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKQVAMFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYH*****
MFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKQVAMFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKK
MFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKQVAMFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKQVAMFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query168 2.2.26 [Sep-21-2011]
Q5T2R2 415 Decaprenyl-diphosphate sy yes N/A 0.619 0.250 0.443 9e-21
Q33DR2 409 Decaprenyl-diphosphate sy yes N/A 0.619 0.254 0.434 4e-20
P0AD58 323 Octaprenyl-diphosphate sy yes N/A 0.5 0.260 0.388 1e-13
P0AD57 323 Octaprenyl-diphosphate sy N/A N/A 0.5 0.260 0.388 1e-13
Q54VJ9 456 Decaprenyl-diphosphate sy yes N/A 0.470 0.173 0.419 2e-12
P44916 329 Octaprenyl-diphosphate sy yes N/A 0.428 0.218 0.410 4e-12
O43091 378 Decaprenyl-diphosphate sy yes N/A 0.511 0.227 0.327 4e-11
P72580 323 Prenyl transferase OS=Syn N/A N/A 0.476 0.247 0.369 1e-10
P31114 348 Heptaprenyl diphosphate s yes N/A 0.369 0.178 0.460 3e-10
P55785 320 Heptaprenyl diphosphate s N/A N/A 0.553 0.290 0.317 3e-10
>sp|Q5T2R2|DPS1_HUMAN Decaprenyl-diphosphate synthase subunit 1 OS=Homo sapiens GN=PDSS1 PE=1 SV=1 Back     alignment and function desciption
 Score = 99.4 bits (246), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 11/115 (9%)

Query: 22  FRRGKPSVNVVYNH-KKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLN 80
           F+ G   +  +Y   +KEL+ +T+  EL+ +S YYFDG+GKA RP++  LM RA N H N
Sbjct: 96  FKLGWRDLKGLYEDIRKELLISTS--ELKEMSEYYFDGKGKAFRPIIVALMARACNIHHN 153

Query: 81  --------RKQVAMFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISN 127
                   ++ +A+ AEMIHTASL+HDDVID +  RRGK +VN ++  KK +++ 
Sbjct: 154 NSRHVQASQRAIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAG 208
Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 9EC: 1
>sp|Q33DR2|DPS1_MOUSE Decaprenyl-diphosphate synthase subunit 1 OS=Mus musculus GN=Pdss1 PE=1 SV=1 Back     alignment and function description
>sp|P0AD58|ISPB_SHIFL Octaprenyl-diphosphate synthase OS=Shigella flexneri GN=ispB PE=3 SV=1 Back     alignment and function description
>sp|P0AD57|ISPB_ECOLI Octaprenyl-diphosphate synthase OS=Escherichia coli (strain K12) GN=ispB PE=1 SV=1 Back     alignment and function description
>sp|Q54VJ9|DPS1_DICDI Decaprenyl-diphosphate synthase OS=Dictyostelium discoideum GN=coq1 PE=3 SV=1 Back     alignment and function description
>sp|P44916|ISPB_HAEIN Octaprenyl-diphosphate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ispB PE=1 SV=1 Back     alignment and function description
>sp|O43091|DPS1_SCHPO Decaprenyl-diphosphate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 Back     alignment and function description
>sp|P72580|PREA_SYNY3 Prenyl transferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=preA PE=3 SV=2 Back     alignment and function description
>sp|P31114|HEPS2_BACSU Heptaprenyl diphosphate synthase component 2 OS=Bacillus subtilis (strain 168) GN=hepT PE=1 SV=1 Back     alignment and function description
>sp|P55785|HEPS2_GEOSE Heptaprenyl diphosphate synthase component 2 OS=Geobacillus stearothermophilus GN=hepT PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
328713339 338 PREDICTED: decaprenyl-diphosphate syntha 0.511 0.254 0.709 9e-33
358443028 410 control protein HCTL026 [Heliconius erat 0.559 0.229 0.644 2e-32
358443018224 control protein HCTL026 [Heliconius melp 0.559 0.419 0.644 3e-32
358443032204 control protein HCTL026 [Heliconius hewi 0.559 0.460 0.644 4e-32
358443026204 control protein HCTL026 [Heliconius burn 0.559 0.460 0.644 4e-32
358443036204 control protein HCTL026 [Heliconius deme 0.559 0.460 0.644 5e-32
358443020204 control protein HCTL026 [Heliconius isme 0.559 0.460 0.644 5e-32
358443022204 control protein HCTL026 [Heliconius heca 0.559 0.460 0.644 5e-32
358443024204 control protein HCTL026 [Heliconius dori 0.559 0.460 0.644 6e-32
358443016206 control protein HCTL026 [Eueides isabell 0.559 0.456 0.644 7e-32
>gi|328713339|ref|XP_001947197.2| PREDICTED: decaprenyl-diphosphate synthase subunit 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 80/93 (86%), Gaps = 7/93 (7%)

Query: 37  KELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLN-------RKQVAMFAE 89
           +EL  NTNQ+ELRTI+TYYFDGQGKA+RPMV++LM  AINYH+N       +++VAM AE
Sbjct: 101 RELELNTNQDELRTIATYYFDGQGKALRPMVAILMAHAINYHMNNNGLDKKQREVAMIAE 160

Query: 90  MIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKK 122
           MIH+ASLIHDDVIDQSDFRRGKPSVN +++HKK
Sbjct: 161 MIHSASLIHDDVIDQSDFRRGKPSVNALWSHKK 193

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|358443028|gb|AEU11760.1| control protein HCTL026 [Heliconius erato] Back     alignment and taxonomy information
>gi|358443018|gb|AEU11755.1| control protein HCTL026 [Heliconius melpomene] Back     alignment and taxonomy information
>gi|358443032|gb|AEU11762.1| control protein HCTL026 [Heliconius hewitsoni] gi|358443034|gb|AEU11763.1| control protein HCTL026 [Heliconius sara] Back     alignment and taxonomy information
>gi|358443026|gb|AEU11759.1| control protein HCTL026 [Heliconius burneyi] Back     alignment and taxonomy information
>gi|358443036|gb|AEU11764.1| control protein HCTL026 [Heliconius demeter] Back     alignment and taxonomy information
>gi|358443020|gb|AEU11756.1| control protein HCTL026 [Heliconius ismenius] gi|358443030|gb|AEU11761.1| control protein HCTL026 [Heliconius hortense] gi|358443038|gb|AEU11765.1| control protein HCTL026 [Heliconius charithonia] Back     alignment and taxonomy information
>gi|358443022|gb|AEU11757.1| control protein HCTL026 [Heliconius hecale] Back     alignment and taxonomy information
>gi|358443024|gb|AEU11758.1| control protein HCTL026 [Heliconius doris] Back     alignment and taxonomy information
>gi|358443016|gb|AEU11754.1| control protein HCTL026 [Eueides isabella] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
FB|FBgn0051005 436 qless "qless" [Drosophila mela 0.535 0.206 0.62 9.1e-29
UNIPROTKB|E1BZW8 366 PDSS1 "Uncharacterized protein 0.720 0.330 0.428 3e-21
UNIPROTKB|F1PV51 365 PDSS1 "Uncharacterized protein 0.613 0.282 0.456 1.4e-20
ZFIN|ZDB-GENE-030131-4430 411 pdss1 "prenyl (decaprenyl) dip 0.672 0.274 0.411 1.9e-20
UNIPROTKB|F1RTW8 410 PDSS1 "Uncharacterized protein 0.613 0.251 0.456 1.5e-19
UNIPROTKB|Q5T2R2 415 PDSS1 "Decaprenyl-diphosphate 0.613 0.248 0.447 2.1e-19
MGI|MGI:1889278 409 Pdss1 "prenyl (solanesyl) diph 0.625 0.256 0.452 5.4e-19
UNIPROTKB|F6RJN8 418 PDSS1 "Uncharacterized protein 0.613 0.246 0.447 5.9e-19
CGD|CAL0005672 510 orf19.7478 [Candida albicans ( 0.273 0.090 0.521 7.4e-14
UNIPROTKB|P0AD57 323 ispB "IspB" [Escherichia coli 0.5 0.260 0.388 1.5e-13
FB|FBgn0051005 qless "qless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 320 (117.7 bits), Expect = 9.1e-29, P = 9.1e-29
 Identities = 62/100 (62%), Positives = 82/100 (82%)

Query:    33 YNHKKELI-SNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLN---------RK 82
             Y+  + L+ S T+Q EL TI++YYFDGQGKA+RPMV++LM +AINYHLN         ++
Sbjct:   125 YDDVRYLLKSGTSQPELDTIASYYFDGQGKALRPMVTMLMAKAINYHLNNESHQLVHKQR 184

Query:    83 QVAMFAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKK 122
             Q+A+F+EM+H+ASL+HDDVIDQSDFRRGKPSVN ++NHKK
Sbjct:   185 QIALFSEMVHSASLVHDDVIDQSDFRRGKPSVNALWNHKK 224
GO:0000010 "trans-hexaprenyltranstransferase activity" evidence=ISS
GO:0008299 "isoprenoid biosynthetic process" evidence=IEA
GO:0033554 "cellular response to stress" evidence=IMP
GO:0043066 "negative regulation of apoptotic process" evidence=IMP
GO:0014019 "neuroblast development" evidence=IMP
UNIPROTKB|E1BZW8 PDSS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV51 PDSS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4430 pdss1 "prenyl (decaprenyl) diphosphate synthase, subunit 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTW8 PDSS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T2R2 PDSS1 "Decaprenyl-diphosphate synthase subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1889278 Pdss1 "prenyl (solanesyl) diphosphate synthase, subunit 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F6RJN8 PDSS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
CGD|CAL0005672 orf19.7478 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P0AD57 ispB "IspB" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.10LOW CONFIDENCE prediction!
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
cd00685 259 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphat 2e-25
COG0142 322 COG0142, IspA, Geranylgeranyl pyrophosphate syntha 5e-22
PRK10888 323 PRK10888, PRK10888, octaprenyl diphosphate synthas 5e-18
pfam00348 260 pfam00348, polyprenyl_synt, Polyprenyl synthetase 9e-17
TIGR02748 319 TIGR02748, GerC3_HepT, heptaprenyl diphosphate syn 3e-16
cd00685259 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphat 1e-15
CHL00151 323 CHL00151, preA, prenyl transferase; Reviewed 2e-15
COG0142322 COG0142, IspA, Geranylgeranyl pyrophosphate syntha 6e-15
cd00867 236 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate S 2e-14
TIGR02749 322 TIGR02749, prenyl_cyano, solanesyl diphosphate syn 3e-14
PLN02857 416 PLN02857, PLN02857, octaprenyl-diphosphate synthas 1e-13
PLN02890 422 PLN02890, PLN02890, geranyl diphosphate synthase 1e-12
pfam00348260 pfam00348, polyprenyl_synt, Polyprenyl synthetase 4e-12
CHL00151323 CHL00151, preA, prenyl transferase; Reviewed 1e-11
PLN02857416 PLN02857, PLN02857, octaprenyl-diphosphate synthas 3e-11
TIGR02749322 TIGR02749, prenyl_cyano, solanesyl diphosphate syn 6e-11
cd00867236 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate S 1e-10
cd00385 243 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynth 2e-09
PRK10888323 PRK10888, PRK10888, octaprenyl diphosphate synthas 3e-08
TIGR02748319 TIGR02748, GerC3_HepT, heptaprenyl diphosphate syn 3e-08
PLN02890422 PLN02890, PLN02890, geranyl diphosphate synthase 1e-07
cd00385243 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynth 1e-07
PRK10581 299 PRK10581, PRK10581, geranyltranstransferase; Provi 4e-05
PRK10581299 PRK10581, PRK10581, geranyltranstransferase; Provi 7e-04
>gnl|CDD|173833 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information 
 Score = 97.6 bits (244), Expect = 2e-25
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 43  TNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNRKQVAMFA--EMIHTASLIHDD 100
           +  E LR    Y     GK +RP++ +L  RA+        + + A  E++HTASL+HDD
Sbjct: 1   SEVELLREALRYLLLAGGKRLRPLLVLLAARALGGPELEAALRLAAAIELLHTASLVHDD 60

Query: 101 VIDQSDFRRGKPSVNVVYNHK 121
           V+D SD RRGKP+V+ V+ + 
Sbjct: 61  VMDNSDLRRGKPTVHKVFGNA 81

These trans-Isoprenyl Diphosphate Synthases (Trans_IPPS) catalyze head-to-tail (HT) (1'-4) condensation reactions. This CD includes all-trans (E)-isoprenyl diphosphate synthases which synthesize various chain length (C10, C15, C20, C25, C30, C35, C40, C45, and C50) linear isoprenyl diphosphates from precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). They catalyze the successive 1'-4 condensation of the 5-carbon IPP to allylic substrates geranyl-, farnesyl-, or geranylgeranyl-diphosphate. Isoprenoid chain elongation reactions proceed via electrophilic alkylations in which a new carbon-carbon single bond is generated through interaction between a highly reactive electron-deficient allylic carbocation and an electron-rich carbon-carbon double bond. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions (DDXX(XX)D) located on opposite walls. These residues mediate binding of prenyl phosphates via bridging Mg2+ ions, inducing proposed conformational changes that close the active site to solvent, protecting and stabilizing reactive carbocation intermediates. Farnesyl diphosphate synthases produce the precursors of steroids, cholesterol, sesquiterpenes, farnsylated proteins, heme, and vitamin K12; and geranylgeranyl diphosphate and longer chain synthases produce the precursors of carotenoids, retinoids, diterpenes, geranylgeranylated chlorophylls, ubiquinone, and archaeal ether linked lipids. Isoprenyl diphosphate synthases are widely distributed among archaea, bacteria, and eukareya. Length = 259
>gnl|CDD|223220 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|182813 PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|215873 pfam00348, polyprenyl_synt, Polyprenyl synthetase Back     alignment and domain information
>gnl|CDD|131795 TIGR02748, GerC3_HepT, heptaprenyl diphosphate synthase component II Back     alignment and domain information
>gnl|CDD|173833 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>gnl|CDD|164542 CHL00151, preA, prenyl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|223220 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>gnl|CDD|131796 TIGR02749, prenyl_cyano, solanesyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|215462 PLN02857, PLN02857, octaprenyl-diphosphate synthase Back     alignment and domain information
>gnl|CDD|178478 PLN02890, PLN02890, geranyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|215873 pfam00348, polyprenyl_synt, Polyprenyl synthetase Back     alignment and domain information
>gnl|CDD|164542 CHL00151, preA, prenyl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|215462 PLN02857, PLN02857, octaprenyl-diphosphate synthase Back     alignment and domain information
>gnl|CDD|131796 TIGR02749, prenyl_cyano, solanesyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>gnl|CDD|182813 PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|131795 TIGR02748, GerC3_HepT, heptaprenyl diphosphate synthase component II Back     alignment and domain information
>gnl|CDD|178478 PLN02890, PLN02890, geranyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>gnl|CDD|182567 PRK10581, PRK10581, geranyltranstransferase; Provisional Back     alignment and domain information
>gnl|CDD|182567 PRK10581, PRK10581, geranyltranstransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 168
COG0142322 IspA Geranylgeranyl pyrophosphate synthase [Coenzy 99.97
PRK10888323 octaprenyl diphosphate synthase; Provisional 99.97
CHL00151323 preA prenyl transferase; Reviewed 99.96
PLN02857416 octaprenyl-diphosphate synthase 99.96
PLN02890422 geranyl diphosphate synthase 99.96
TIGR02749322 prenyl_cyano solanesyl diphosphate synthase. Membe 99.96
TIGR02748319 GerC3_HepT heptaprenyl diphosphate synthase compon 99.96
PRK10581299 geranyltranstransferase; Provisional 99.95
PF00348260 polyprenyl_synt: Polyprenyl synthetase; InterPro: 99.95
cd00685259 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthase 99.93
KOG0776|consensus384 99.91
KOG0777|consensus322 99.87
cd00867236 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases. 99.82
KOG0711|consensus347 99.77
PRK10888 323 octaprenyl diphosphate synthase; Provisional 99.77
COG0142 322 IspA Geranylgeranyl pyrophosphate synthase [Coenzy 99.77
TIGR02748 319 GerC3_HepT heptaprenyl diphosphate synthase compon 99.77
TIGR02749 322 prenyl_cyano solanesyl diphosphate synthase. Membe 99.77
PLN02890 422 geranyl diphosphate synthase 99.76
PRK10581 299 geranyltranstransferase; Provisional 99.75
CHL00151 323 preA prenyl transferase; Reviewed 99.75
PLN02857 416 octaprenyl-diphosphate synthase 99.74
cd00685 259 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthase 99.71
PF00348 260 polyprenyl_synt: Polyprenyl synthetase; InterPro: 99.64
KOG0776|consensus 384 99.62
KOG0777|consensus 322 99.36
cd00385243 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzym 99.09
cd00867 236 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases. 99.03
KOG0711|consensus 347 98.44
cd00385 243 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzym 96.2
>COG0142 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information 
Probab=99.97  E-value=9.1e-31  Score=209.55  Aligned_cols=120  Identities=28%  Similarity=0.450  Sum_probs=90.6

Q ss_pred             HhHHHhHhhhhcccccCCCccccChhhHHhhhhhhhhhhcccChHHHHH---------------------HHHHHHh---
Q psy5532           2 FAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEELRT---------------------ISTYYFD---   57 (168)
Q Consensus         2 ~~El~h~aslihDDi~D~~~~RRG~~~~~~~~g~~~ai~~~~~~~~l~~---------------------~~~~~~~---   57 (168)
                      ++|++|++|||||||||+|++|||+||+|.+||+..||+  .++..+..                     ....+..   
T Consensus        74 avEliH~~SLiHDDvmD~s~~RRG~pt~~~~~g~~~AIl--aGD~L~~~Af~~l~~~~~~~~~~~~~~~~~~~~~~~GQ~  151 (322)
T COG0142          74 AIELIHTASLIHDDLMDDDDLRRGKPTVHAKFGEATAIL--AGDALLAAAFELLSKLGSEALEAIKALAEAINGLCGGQA  151 (322)
T ss_pred             HHHHHHHHHHHHhhcccCCCccCCCCCchhHhccHHHHH--HHHHHHHHHHHHHHhCCchhHHHHHHHHHHHHHHHHhHH
Confidence            799999999999999999999999999999999988872  11111111                     1111111   


Q ss_pred             ----CCC---------cchHHHHHHHHHHHhcCCc--------cHHHHHHHHHHHHHHHHHHhhhcCC------------
Q psy5532          58 ----GQG---------KAVRPMVSVLMGRAINYHL--------NRKQVAMFAEMIHTASLIHDDVIDQ------------  104 (168)
Q Consensus        58 ----~~g---------k~~r~~~~~l~~~~~~~~~--------~~~~l~~~~e~lg~afqI~DDilD~------------  104 (168)
                          ..+         ..++.+++.++..++..++        ....+..||..+|+||||+|||+|+            
T Consensus       152 lDl~~~~~~~t~e~y~~~i~~KTa~L~~~a~~~ga~la~~~~~~~~~l~~~g~~lGlaFQi~DDiLD~~~d~~~lGK~~g  231 (322)
T COG0142         152 LDLAFENKPVTLEEYLRVIELKTAALFAAAAVLGAILAGADEELLEALEDYGRNLGLAFQIQDDILDITGDEEELGKPVG  231 (322)
T ss_pred             HHHHccCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhhHHHHHHHHhhcCCCChHHhCCCcc
Confidence                001         2466777777776665443        4678999999999999999999998            


Q ss_pred             CccccCCCchhHHhccchh
Q psy5532         105 SDFRRGKPSVNVVYNHKKE  123 (168)
Q Consensus       105 ~d~r~Gk~t~~~~~g~~~a  123 (168)
                      +|++.||+|+|++++.+.+
T Consensus       232 ~Dl~~gK~T~p~l~~l~~~  250 (322)
T COG0142         232 SDLKEGKPTLPVLLALEKA  250 (322)
T ss_pred             hHHHcCCchHHHHHHHHcC
Confidence            4788999999999985533

>PRK10888 octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>CHL00151 preA prenyl transferase; Reviewed Back     alignment and domain information
>PLN02857 octaprenyl-diphosphate synthase Back     alignment and domain information
>PLN02890 geranyl diphosphate synthase Back     alignment and domain information
>TIGR02749 prenyl_cyano solanesyl diphosphate synthase Back     alignment and domain information
>TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II Back     alignment and domain information
>PRK10581 geranyltranstransferase; Provisional Back     alignment and domain information
>PF00348 polyprenyl_synt: Polyprenyl synthetase; InterPro: IPR000092 A variety of isoprenoid compounds are synthesized by various organisms Back     alignment and domain information
>cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>KOG0776|consensus Back     alignment and domain information
>KOG0777|consensus Back     alignment and domain information
>cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>KOG0711|consensus Back     alignment and domain information
>PRK10888 octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>COG0142 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II Back     alignment and domain information
>TIGR02749 prenyl_cyano solanesyl diphosphate synthase Back     alignment and domain information
>PLN02890 geranyl diphosphate synthase Back     alignment and domain information
>PRK10581 geranyltranstransferase; Provisional Back     alignment and domain information
>CHL00151 preA prenyl transferase; Reviewed Back     alignment and domain information
>PLN02857 octaprenyl-diphosphate synthase Back     alignment and domain information
>cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>PF00348 polyprenyl_synt: Polyprenyl synthetase; InterPro: IPR000092 A variety of isoprenoid compounds are synthesized by various organisms Back     alignment and domain information
>KOG0776|consensus Back     alignment and domain information
>KOG0777|consensus Back     alignment and domain information
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>KOG0711|consensus Back     alignment and domain information
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
3mzv_A 341 Crystal Structure Of A Decaprenyl Diphosphate Synth 2e-11
3rmg_A 334 Crystal Structure Of Geranylgeranyl Pyrophosphate S 5e-09
3apz_A 348 Apo Form Of Arabidopsis MediumLONG-Chain Length Pre 1e-08
3aq0_A 348 Ligand-Bound Form Of Arabidopsis MediumLONG-Chain L 1e-08
3oyr_A 345 Crystal Structure Of Polyprenyl Synthase From Caulo 3e-08
1v4h_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 5e-08
2ftz_A 284 Crystal Structure Of Geranyltranstransferase (Ec 2. 7e-08
3aqb_B 325 M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphospha 1e-07
1vg7_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-07
1v4i_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-07
1v4e_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-07
1vg6_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-07
1vg4_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-07
2azl_A 299 Crystal Structure For The Mutant F117e Of Thermotog 2e-07
1wy0_A 342 Crystal Structure Of Geranylgeranyl Pyrophosphate S 3e-07
4dhd_A 358 Crystal Structure Of Isoprenoid Synthase A3msh1 (Ta 4e-07
1v4j_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 6e-07
1wkz_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 6e-07
1v4k_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 8e-07
1wl2_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
1wl0_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
1wl3_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
1vg2_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
3tc1_A 315 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
3kra_A 295 Mint Heterotetrameric Geranyl Pyrophosphate Synthas 3e-06
3uca_A 324 Crystal Structure Of Isoprenoid Synthase (Target Ef 4e-06
3lmd_A 360 Crystal Structure Of Geranylgeranyl Pyrophosphate S 4e-06
1vg3_A 299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 6e-06
1rtr_A 301 Crystal Structure Of S. Aureus Farnesyl Pyrophospha 7e-06
3lom_A 313 Crystal Structure Of Geranyltransferase From Legion 9e-06
2j1p_A 293 Geranylgeranyl Diphosphate Synthase From Sinapis Al 9e-06
3m9u_A 309 Crystal Structure Of Geranylgeranyl Pyrophosphate S 1e-05
3ipi_A 295 Crystal Structure Of A Geranyltranstransferase From 1e-05
3lk5_A 380 Crystal Structure Of Putative Geranylgeranyl Pyroph 3e-05
3p8r_A 302 Crystal Structure Of Polyprenyl Synthase From Vibri 3e-05
4f62_A 317 Crystal Structure Of A Putative Farnesyl-Diphosphat 1e-04
3npk_A 291 The Crystal Structure Of Geranyltranstransferase Fr 1e-04
3n3d_A 335 Crystal Structure Of Geranylgeranyl Pyrophosphate S 3e-04
3pko_A 334 Crystal Structure Of Geranylgeranyl Pyrophosphate S 3e-04
3p8l_A 302 Crystal Structure Of Polyprenyl Synthase From Enter 5e-04
2azk_A 289 Crystal Structure For The Mutant W136e Of Sulfolobu 7e-04
>pdb|3MZV|A Chain A, Crystal Structure Of A Decaprenyl Diphosphate Synthase From Rhodobacter Capsulatus Length = 341 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 59/93 (63%), Gaps = 7/93 (7%)
Query: 37  KELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINY----HLNRKQVAMFAEMIH 92
           +E +S+ +   +  ++ +  +  GK +RPM+++   R + Y    H++   +A   E IH
Sbjct: 30  RERMSSEHAPRIPEVTAHLIEAGGKRLRPMLTLAAARLVGYGGPFHVH---LAATVEFIH 86
Query: 93  TASLIHDDVIDQSDFRRGKPSVNVVYNHKKELI 125
           TA+L+HDDV+D+S  RRG+P+ N+++++K  ++
Sbjct: 87  TATLLHDDVVDESRQRRGRPTANLLWDNKSSVL 119
>pdb|3RMG|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Bacteroides Thetaiotaomicron Length = 334 Back     alignment and structure
>pdb|3APZ|A Chain A, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase Length = 348 Back     alignment and structure
>pdb|3AQ0|A Chain A, Ligand-Bound Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase (Surface Polar Residue Mutant) Length = 348 Back     alignment and structure
>pdb|3OYR|A Chain A, Crystal Structure Of Polyprenyl Synthase From Caulobacter Crescentus Cb15 Complexed With Calcium And Isoprenyl Diphosphate Length = 345 Back     alignment and structure
>pdb|1V4H|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F52a Mutant Length = 299 Back     alignment and structure
>pdb|2FTZ|A Chain A, Crystal Structure Of Geranyltranstransferase (Ec 2.5.1.10) (Tm0161) From Thermotoga Maritima At 1.90 A Resolution Length = 284 Back     alignment and structure
>pdb|3AQB|B Chain B, M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphosphate Synthase In Complex With Magnesium Length = 325 Back     alignment and structure
>pdb|1VG7|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128AI123AD62A MUTANT Length = 299 Back     alignment and structure
>pdb|1V4I|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132a Mutant Length = 299 Back     alignment and structure
>pdb|1V4E|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima Length = 299 Back     alignment and structure
>pdb|1VG6|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128AI123A MUTANT Length = 299 Back     alignment and structure
>pdb|1VG4|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128A MUTANT Length = 299 Back     alignment and structure
>pdb|2AZL|A Chain A, Crystal Structure For The Mutant F117e Of Thermotoga Maritima Octaprenyl Pyrophosphate Synthase Length = 299 Back     alignment and structure
>pdb|1WY0|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthetase From Pyrococcus Horikoshii Ot3 Length = 342 Back     alignment and structure
>pdb|4DHD|A Chain A, Crystal Structure Of Isoprenoid Synthase A3msh1 (Target Efi-501992) From Pyrobaculum Calidifontis Length = 358 Back     alignment and structure
>pdb|1V4J|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima V73y Mutant Length = 299 Back     alignment and structure
>pdb|1WKZ|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima K41a Mutant Length = 299 Back     alignment and structure
>pdb|1V4K|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima S77f Mutant Length = 299 Back     alignment and structure
>pdb|1WL2|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima R90a Mutant Length = 299 Back     alignment and structure
>pdb|1WL0|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima R44a Mutant Length = 299 Back     alignment and structure
>pdb|1WL3|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima R91a Mutant Length = 299 Back     alignment and structure
>pdb|1VG2|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima A76y Mutant Length = 299 Back     alignment and structure
>pdb|3TC1|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Helicobacter Pylori Length = 315 Back     alignment and structure
>pdb|3KRA|A Chain A, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium Length = 295 Back     alignment and structure
>pdb|3UCA|A Chain A, Crystal Structure Of Isoprenoid Synthase (Target Efi-501974) From Clostridium Perfringens Length = 324 Back     alignment and structure
>pdb|3LMD|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Corynebacterium Glutamicum Atcc 13032 Length = 360 Back     alignment and structure
>pdb|1VG3|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima A76yS77F MUTANT Length = 299 Back     alignment and structure
>pdb|1RTR|A Chain A, Crystal Structure Of S. Aureus Farnesyl Pyrophosphate Synthase Length = 301 Back     alignment and structure
>pdb|3LOM|A Chain A, Crystal Structure Of Geranyltransferase From Legionella Pneumophila Length = 313 Back     alignment and structure
>pdb|2J1P|A Chain A, Geranylgeranyl Diphosphate Synthase From Sinapis Alba In Complex With Ggpp Length = 293 Back     alignment and structure
>pdb|3M9U|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Length = 309 Back     alignment and structure
>pdb|3IPI|A Chain A, Crystal Structure Of A Geranyltranstransferase From The Methanosarcina Mazei Length = 295 Back     alignment and structure
>pdb|3LK5|A Chain A, Crystal Structure Of Putative Geranylgeranyl Pyrophosphate Synthase From Corynebacterium Glutamicum Length = 380 Back     alignment and structure
>pdb|3P8R|A Chain A, Crystal Structure Of Polyprenyl Synthase From Vibrio Cholerae Length = 302 Back     alignment and structure
>pdb|4F62|A Chain A, Crystal Structure Of A Putative Farnesyl-Diphosphate Synthase From Marinomonas Sp. Med121 (Target Efi-501980) Length = 317 Back     alignment and structure
>pdb|3NPK|A Chain A, The Crystal Structure Of Geranyltranstransferase From Campylobacter Jejuni Length = 291 Back     alignment and structure
>pdb|3N3D|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Length = 335 Back     alignment and structure
>pdb|3PKO|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Complexed With Citrate Length = 334 Back     alignment and structure
>pdb|3P8L|A Chain A, Crystal Structure Of Polyprenyl Synthase From Enterococcus Faecalis V583 Length = 302 Back     alignment and structure
>pdb|2AZK|A Chain A, Crystal Structure For The Mutant W136e Of Sulfolobus Solfataricus Hexaprenyl Pyrophosphate Synthase Length = 289 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
3ipi_A 295 Geranyltranstransferase; isoprene biosynthesis, he 4e-25
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, he 9e-15
1v4e_A 299 Octoprenyl-diphosphate synthase; trans-type prenyl 6e-25
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyl 2e-14
3apz_A 348 Geranyl diphosphate synthase; prenyltransferase, a 7e-25
3apz_A348 Geranyl diphosphate synthase; prenyltransferase, a 1e-15
1wy0_A 342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 1e-23
1wy0_A 342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 3e-14
4fp4_A 285 Polyprenyl synthetase; isoprenoid synthesis, isopr 2e-23
4fp4_A285 Polyprenyl synthetase; isoprenoid synthesis, isopr 7e-15
4dhd_A 358 Polyprenyl synthetase; isoprenoid synthesis, isopr 3e-23
4dhd_A 358 Polyprenyl synthetase; isoprenoid synthesis, isopr 7e-14
3pko_A 334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 4e-23
3pko_A334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 2e-14
3rmg_A 334 Octaprenyl-diphosphate synthase; structural genomi 4e-23
3rmg_A334 Octaprenyl-diphosphate synthase; structural genomi 2e-14
3aqb_B 325 Component B of hexaprenyl diphosphate synthase; pr 5e-23
3aqb_B325 Component B of hexaprenyl diphosphate synthase; pr 2e-14
3tc1_A 315 Octaprenyl pyrophosphate synthase; all alpha-helic 5e-23
3tc1_A315 Octaprenyl pyrophosphate synthase; all alpha-helic 9e-14
3oyr_A 345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 7e-23
3oyr_A345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 4e-14
1wmw_A 330 Geranylgeranyl diphosphate synthetase; GGPP, preny 4e-22
1wmw_A330 Geranylgeranyl diphosphate synthetase; GGPP, preny 5e-14
3lmd_A 360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 5e-22
3lmd_A360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 8e-14
2azj_A 289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 1e-21
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 5e-14
2q80_A 301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 2e-21
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 1e-13
3mzv_A 341 Decaprenyl diphosphate synthase; transferase, stru 2e-21
3mzv_A341 Decaprenyl diphosphate synthase; transferase, stru 2e-13
3nf2_A 352 Putative polyprenyl synthetase; isoprenyl diphosph 2e-21
3nf2_A 352 Putative polyprenyl synthetase; isoprenyl diphosph 2e-14
2e8v_A 340 Geranylgeranyl pyrophosphate synthetase; prenyltra 9e-21
2e8v_A 340 Geranylgeranyl pyrophosphate synthetase; prenyltra 2e-13
3lk5_A 380 Geranylgeranyl pyrophosphate synthase; structural 3e-18
3lk5_A 380 Geranylgeranyl pyrophosphate synthase; structural 3e-13
2her_A 368 Fragment, farnesyl pyrophosphate synthase; farnesy 2e-15
2her_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 4e-11
2ihi_A 395 Pyrophosphate synthase; PV092040, structural genom 3e-15
2ihi_A 395 Pyrophosphate synthase; PV092040, structural genom 3e-11
1uby_A 367 FPS, farnesyl diphosphate synthase; transferase, i 3e-14
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, i 2e-11
1yhl_A 362 Farnesyl pyrophosphate synthase; farnesyl diphosph 2e-13
1yhl_A 362 Farnesyl pyrophosphate synthase; farnesyl diphosph 1e-11
3pde_A 309 Farnesyl-diphosphate synthase; isoprenyl diphospha 6e-13
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphospha 9e-10
2j1p_A 293 Geranylgeranyl pyrophosphate synthetase; transfera 7e-13
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transfera 1e-10
3llw_A 311 Geranyltranstransferase (ISPA); structural genomic 2e-12
3llw_A311 Geranyltranstransferase (ISPA); structural genomic 5e-10
3uca_A 324 Geranyltranstransferase; isoprenoid synthesis, iso 2e-12
3uca_A324 Geranyltranstransferase; isoprenoid synthesis, iso 3e-10
3p8l_A 302 Geranyltranstransferase; isoprenyl synthase, struc 3e-12
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, struc 5e-10
1rtr_A 301 Geranyltranstransferase; 2.50A {Staphylococcus aur 3e-12
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aur 6e-10
3lsn_A 304 Geranyltranstransferase; structural genomics, prot 4e-12
3lsn_A304 Geranyltranstransferase; structural genomics, prot 3e-10
4f62_A 317 Geranyltranstransferase; enzyme function initiativ 4e-12
4f62_A317 Geranyltranstransferase; enzyme function initiativ 4e-10
3npk_A 291 Geranyltranstransferase; isoprene biosynthesis, SG 4e-12
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SG 9e-10
2h8o_A 335 Geranyltranstransferase; geranyltransferase,agroba 5e-12
2h8o_A335 Geranyltranstransferase; geranyltransferase,agroba 3e-10
3dyh_A 390 Farnesyl pyrophosphate synthase; protein-bisphosph 6e-12
3dyh_A 390 Farnesyl pyrophosphate synthase; protein-bisphosph 5e-11
1rqj_A 299 Geranyltranstransferase; bisphosphonate, isoprenyl 6e-12
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl 5e-10
3lom_A 313 Geranyltranstransferase; geranyltransferase, struc 6e-12
3lom_A313 Geranyltranstransferase; geranyltransferase, struc 7e-10
3ts7_A 324 Geranyltranstransferase; isoprenoid synthesis, far 6e-12
3ts7_A324 Geranyltranstransferase; isoprenoid synthesis, far 4e-10
3p8r_A 302 Geranyltranstransferase; isoprenyl synthase, struc 6e-12
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, struc 5e-10
3m0g_A 297 Farnesyl diphosphate synthase; structural genomics 1e-11
3m0g_A297 Farnesyl diphosphate synthase; structural genomics 4e-10
2qis_A 374 Farnesyl pyrophosphate synthetase; trans-prenyltra 1e-11
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltra 2e-09
3kra_B 274 Geranyl diphosphate synthase small subunit; prenyl 5e-11
3kra_B274 Geranyl diphosphate synthase small subunit; prenyl 6e-09
3qkc_B 273 Geranyl diphosphate synthase small subunit; struct 8e-11
3qkc_B273 Geranyl diphosphate synthase small subunit; struct 5e-08
2ftz_A 284 Geranyltranstransferase; TM0161, structural GE joi 1e-07
2ftz_A284 Geranyltranstransferase; TM0161, structural GE joi 3e-05
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Length = 295 Back     alignment and structure
 Score = 96.9 bits (242), Expect = 4e-25
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 14/115 (12%)

Query: 37  KELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMGRAINYHLNR-KQVAMFAEMIHTAS 95
           KE I+      L+ +  +     GK +RP++ +L+    +   +R    A+  EM+H+AS
Sbjct: 19  KESITLIEDPGLKKMVEHVCHSGGKRIRPIILLLVSEICSGSYSRSLNAALAVEMMHSAS 78

Query: 96  LIHDDVIDQSDFRRGKPSVNVVYNHKK-------------ELISNTNQEELRTIS 137
           LIHDD++DQ   RR  PS    +                   IS   ++ ++   
Sbjct: 79  LIHDDLLDQGLVRRNLPSAPEKFGPSGALLCGDYLIAKSIAFISPYGEKVIQDFG 133
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Length = 295 Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Length = 299 Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Length = 299 Back     alignment and structure
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Length = 348 Back     alignment and structure
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Length = 348 Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Length = 342 Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Length = 342 Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Length = 285 Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Length = 285 Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} Length = 358 Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} Length = 358 Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Length = 334 Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Length = 334 Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Length = 334 Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Length = 334 Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Length = 325 Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Length = 325 Back     alignment and structure
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Length = 315 Back     alignment and structure
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Length = 315 Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Length = 345 Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Length = 345 Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Length = 330 Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Length = 330 Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Length = 360 Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Length = 360 Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Length = 289 Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Length = 289 Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Length = 341 Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Length = 341 Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Length = 352 Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Length = 352 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Length = 340 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Length = 340 Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Length = 380 Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Length = 380 Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Length = 367 Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Length = 367 Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Length = 362 Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Length = 362 Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Length = 309 Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Length = 309 Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* 3oab_A* 3oac_A* Length = 293 Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* 3oab_A* 3oac_A* Length = 293 Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} PDB: 3q1o_A* Length = 311 Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} PDB: 3q1o_A* Length = 311 Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Length = 324 Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Length = 324 Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Length = 302 Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Length = 302 Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Length = 304 Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Length = 304 Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Length = 317 Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Length = 317 Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Length = 291 Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Length = 291 Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Length = 335 Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Length = 335 Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Length = 390 Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Length = 390 Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Length = 299 Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Length = 299 Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Length = 313 Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Length = 313 Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Length = 324 Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Length = 324 Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} Length = 302 Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} Length = 302 Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Length = 297 Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Length = 297 Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Length = 374 Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Length = 374 Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* 3oab_B* 3oac_B* Length = 274 Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* 3oab_B* 3oac_B* Length = 274 Back     alignment and structure
>3qkc_B Geranyl diphosphate synthase small subunit; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.20A {Antirrhinum majus} Length = 273 Back     alignment and structure
>3qkc_B Geranyl diphosphate synthase small subunit; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.20A {Antirrhinum majus} Length = 273 Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Length = 284 Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Length = 284 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
3tc1_A315 Octaprenyl pyrophosphate synthase; all alpha-helic 99.97
3oyr_A345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 99.97
3mzv_A341 Decaprenyl diphosphate synthase; transferase, stru 99.97
3mav_A395 Farnesyl pyrophosphate synthase; PV092040, structu 99.96
3rmg_A334 Octaprenyl-diphosphate synthase; structural genomi 99.96
1wy0_A342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 99.96
2q58_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 99.96
3pko_A334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 99.96
3nf2_A352 Putative polyprenyl synthetase; isoprenyl diphosph 99.96
3lmd_A360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 99.96
4dhd_A358 Polyprenyl synthetase; isoprenoid synthesis, isopr 99.96
3apz_A348 Geranyl diphosphate synthase; prenyltransferase, a 99.96
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyl 99.96
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphospha 99.96
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 99.95
3lk5_A380 Geranylgeranyl pyrophosphate synthase; structural 99.95
3ts7_A324 Geranyltranstransferase; isoprenoid synthesis, far 99.95
4f62_A317 Geranyltranstransferase; enzyme function initiativ 99.95
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, struc 99.95
2her_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 99.95
3lsn_A304 Geranyltranstransferase; structural genomics, prot 99.95
2ihi_A395 Pyrophosphate synthase; PV092040, structural genom 99.95
1wmw_A330 Geranylgeranyl diphosphate synthetase; GGPP, preny 99.95
3aqb_B325 Component B of hexaprenyl diphosphate synthase; pr 99.95
2e8v_A340 Geranylgeranyl pyrophosphate synthetase; prenyltra 99.95
3dyh_A390 Farnesyl pyrophosphate synthase; protein-bisphosph 99.95
3uca_A324 Geranyltranstransferase; isoprenoid synthesis, iso 99.95
2h8o_A335 Geranyltranstransferase; geranyltransferase,agroba 99.95
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosph 99.95
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltra 99.95
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aur 99.95
3m0g_A297 Farnesyl diphosphate synthase; structural genomics 99.95
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, struc 99.95
3lom_A313 Geranyltranstransferase; geranyltransferase, struc 99.95
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, i 99.95
3llw_A311 Geranyltranstransferase (ISPA); structural genomic 99.94
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 99.94
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl 99.94
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, he 99.94
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SG 99.94
2ftz_A284 Geranyltranstransferase; TM0161, structural GE joi 99.93
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transfera 99.92
4fp4_A285 Polyprenyl synthetase; isoprenoid synthesis, isopr 99.92
3qkc_B273 Geranyl diphosphate synthase small subunit; struct 99.85
3kra_B274 Geranyl diphosphate synthase small subunit; prenyl 99.85
4fp4_A 285 Polyprenyl synthetase; isoprenoid synthesis, isopr 99.8
3oyr_A 345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 99.79
3ipi_A 295 Geranyltranstransferase; isoprene biosynthesis, he 99.79
3mzv_A 341 Decaprenyl diphosphate synthase; transferase, stru 99.78
2q80_A 301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 99.78
2e8v_A 340 Geranylgeranyl pyrophosphate synthetase; prenyltra 99.78
3rmg_A 334 Octaprenyl-diphosphate synthase; structural genomi 99.77
2azj_A 289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 99.77
3lmd_A 360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 99.77
1wy0_A 342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 99.76
1wmw_A 330 Geranylgeranyl diphosphate synthetase; GGPP, preny 99.76
2ftz_A 284 Geranyltranstransferase; TM0161, structural GE joi 99.76
3aqb_B 325 Component B of hexaprenyl diphosphate synthase; pr 99.76
4f62_A 317 Geranyltranstransferase; enzyme function initiativ 99.75
1v4e_A 299 Octoprenyl-diphosphate synthase; trans-type prenyl 99.75
3pko_A 334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 99.75
4dhd_A 358 Polyprenyl synthetase; isoprenoid synthesis, isopr 99.75
3lsn_A 304 Geranyltranstransferase; structural genomics, prot 99.75
3p8l_A 302 Geranyltranstransferase; isoprenyl synthase, struc 99.75
3pde_A 309 Farnesyl-diphosphate synthase; isoprenyl diphospha 99.75
3nf2_A 352 Putative polyprenyl synthetase; isoprenyl diphosph 99.75
3npk_A 291 Geranyltranstransferase; isoprene biosynthesis, SG 99.74
3lom_A 313 Geranyltranstransferase; geranyltransferase, struc 99.74
3uca_A 324 Geranyltranstransferase; isoprenoid synthesis, iso 99.74
3ts7_A 324 Geranyltranstransferase; isoprenoid synthesis, far 99.74
3m0g_A 297 Farnesyl diphosphate synthase; structural genomics 99.73
1rtr_A 301 Geranyltranstransferase; 2.50A {Staphylococcus aur 99.73
1rqj_A 299 Geranyltranstransferase; bisphosphonate, isoprenyl 99.73
2h8o_A 335 Geranyltranstransferase; geranyltransferase,agroba 99.73
3llw_A 311 Geranyltranstransferase (ISPA); structural genomic 99.73
3apz_A 348 Geranyl diphosphate synthase; prenyltransferase, a 99.71
3p8r_A 302 Geranyltranstransferase; isoprenyl synthase, struc 99.71
2q58_A 368 Fragment, farnesyl pyrophosphate synthase; farnesy 99.71
3mav_A 395 Farnesyl pyrophosphate synthase; PV092040, structu 99.71
3kra_B 274 Geranyl diphosphate synthase small subunit; prenyl 99.71
2j1p_A 293 Geranylgeranyl pyrophosphate synthetase; transfera 99.7
3lk5_A 380 Geranylgeranyl pyrophosphate synthase; structural 99.69
3qkc_B 273 Geranyl diphosphate synthase small subunit; struct 99.69
2qis_A 374 Farnesyl pyrophosphate synthetase; trans-prenyltra 99.66
2ihi_A 395 Pyrophosphate synthase; PV092040, structural genom 99.66
3tc1_A 315 Octaprenyl pyrophosphate synthase; all alpha-helic 99.66
2her_A 368 Fragment, farnesyl pyrophosphate synthase; farnesy 99.65
1yhl_A 362 Farnesyl pyrophosphate synthase; farnesyl diphosph 99.65
1uby_A 367 FPS, farnesyl diphosphate synthase; transferase, i 99.64
3dyh_A 390 Farnesyl pyrophosphate synthase; protein-bisphosph 99.63
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Back     alignment and structure
Probab=99.97  E-value=3e-31  Score=210.43  Aligned_cols=159  Identities=24%  Similarity=0.336  Sum_probs=90.6

Q ss_pred             HhHHHhHhhhhcccccCCCccccChhhHHhhhhhhhhhh-------------cccChHHHHH----HHHH---------H
Q psy5532           2 FAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELI-------------SNTNQEELRT----ISTY---------Y   55 (168)
Q Consensus         2 ~~El~h~aslihDDi~D~~~~RRG~~~~~~~~g~~~ai~-------------~~~~~~~l~~----~~~~---------~   55 (168)
                      ++||+|+||||||||||+|++|||+||+|++||+..||+             +... +.+..    ....         .
T Consensus        65 aiEliH~asLiHDDi~D~s~~RRG~pt~h~~~G~~~AIl~GD~L~~~a~~~l~~~~-~~~~~~~~~~~~~~~~GQ~~dl~  143 (315)
T 3tc1_A           65 IVEMIQTASLLHDDVIDKATMRRKLPSINALFGNFNAVMLGDVFYSKAFFELSKMG-ELIAQALSNAVLRLSRGEIEDVF  143 (315)
T ss_dssp             HHHHHHHHHHHHHHTC----------------CCSHHHHHHHHHHHHHHHHHTTSC-HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCCCCCCCcCCCccHHHHhCchHHHHHHHHHHHHHHHHHHHCc-HHHHHHHHHHHHHHHHHHHHHHH
Confidence            799999999999999999999999999999999988872             1111 11111    1100         0


Q ss_pred             HhCC-C-------cchHHHHHHHHHHHhcCCc-----cHHHHHHHHHHHHHHHHHHhhhcCC------------CccccC
Q psy5532          56 FDGQ-G-------KAVRPMVSVLMGRAINYHL-----NRKQVAMFAEMIHTASLIHDDVIDQ------------SDFRRG  110 (168)
Q Consensus        56 ~~~~-g-------k~~r~~~~~l~~~~~~~~~-----~~~~l~~~~e~lg~afqI~DDilD~------------~d~r~G  110 (168)
                      .... .       ++++.+++.++..++..++     ....+..||..+|+||||+||++|+            +|+++|
T Consensus       144 ~~~~~~~~~~~y~~~i~~KTa~L~~~~~~~ga~lag~~~~~l~~~g~~lG~aFQI~DD~ld~~~d~~~~GK~~g~Dl~eg  223 (315)
T 3tc1_A          144 VGECFNSDKQKYWRILEDKTAHFIEASLKSMAILLNKDAKIYADFGLNFGMAFQIIDDLLDITQDAKTLGKPNFSDFKEG  223 (315)
T ss_dssp             HTTSCCCCHHHHHHHHHHHTHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHTTSCCTTCCCCCCCCTGGGT
T ss_pred             cCCCCCCCHHHHHHHHhcchHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHhcccCCHHHhCCChhhHHHcC
Confidence            0000 0       2345666666655543322     4778999999999999999999997            488999


Q ss_pred             CCchhHHhccchhhccCCCHHHHHHHhhhhhcCCCchHHHHHHHHh-hhhhhhhhhh
Q psy5532         111 KPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLM-GRAINYHLNR  166 (168)
Q Consensus       111 k~t~~~~~g~~~ail~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~-~~~~~y~~~~  166 (168)
                      |+|+|.+++.+     ...++..+.|..............+.+... .++++|+++.
T Consensus       224 K~T~p~i~al~-----~~~~~~~~~L~~~l~~~~~~~~~~i~~li~~~ga~~~~~~~  275 (315)
T 3tc1_A          224 KTTLPYLLLYE-----KLNQHDQGLLISYFKQDSHEIIEWTKEKFKQYGIIEETLKT  275 (315)
T ss_dssp             CCCHHHHHHHT-----TSCHHHHHHHHHTTTCCCHHHHHHHHHHHHHTTHHHHHHHH
T ss_pred             ChhHHHHHHHH-----hCCHHHHHHHHHHHcCCCHHHHHHHHHHHHHcChHHHHHHH
Confidence            99999999843     334445555555544442223334444443 3888888754
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>3mav_A Farnesyl pyrophosphate synthase; PV092040, structural genomics, structural genomics consortium, SGC, transferase, isoprene biosynthesis; 2.10A {Plasmodium vivax} PDB: 3cc9_A* 3ez3_A* 3ldw_A* 3mys_A* 3ph7_A* 3rbm_A* 3ryw_A* Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2q58_A Fragment, farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, structural genomics, structur genomics consortium, SGC; HET: ZOL; 2.37A {Cryptosporidium parvum} PDB: 2o1o_A* Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} PDB: 4gp1_A* 4gp2_A* Back     alignment and structure
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} SCOP: a.128.1.1 Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} PDB: 3q1o_A* Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* 3oab_A* 3oac_A* Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Back     alignment and structure
>3qkc_B Geranyl diphosphate synthase small subunit; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.20A {Antirrhinum majus} Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* 3oab_B* 3oac_B* Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} PDB: 4gp1_A* 4gp2_A* Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} PDB: 3q1o_A* Back     alignment and structure
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} SCOP: a.128.1.1 Back     alignment and structure
>2q58_A Fragment, farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, structural genomics, structur genomics consortium, SGC; HET: ZOL; 2.37A {Cryptosporidium parvum} PDB: 2o1o_A* Back     alignment and structure
>3mav_A Farnesyl pyrophosphate synthase; PV092040, structural genomics, structural genomics consortium, SGC, transferase, isoprene biosynthesis; 2.10A {Plasmodium vivax} PDB: 3cc9_A* 3ez3_A* 3ldw_A* 3mys_A* 3ph7_A* 3rbm_A* 3ryw_A* Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* 3oab_B* 3oac_B* Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* 3oab_A* 3oac_A* Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Back     alignment and structure
>3qkc_B Geranyl diphosphate synthase small subunit; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.20A {Antirrhinum majus} Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Back     alignment and structure
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 168
d2q80a1 291 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate s 2e-11
d2q80a1291 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate s 5e-06
d1rtra_ 290 a.128.1.1 (A:) Farnesyl diphosphate synthase (gera 5e-07
d1fpsa_ 348 a.128.1.1 (A:) Farnesyl diphosphate synthase (gera 9e-06
d1v4ea_ 280 a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Th 0.003
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Length = 291 Back     information, alignment and structure

class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Isoprenyl diphosphate synthases
domain: Geranylgeranyl pyrophosphate synthetase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 58.6 bits (140), Expect = 2e-11
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 54  YYFDGQGKAVRPMVSVLMGRAINYHLNR-KQVAMFAEMIHTASLIHDDVIDQSDFRRGKP 112
           Y     GK VR  +S      +    ++ + +    EM+H ASL+ DD+ D S  RRG P
Sbjct: 13  YLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNSKLRRGFP 72

Query: 113 SVNVVYNH 120
             + +Y  
Sbjct: 73  VAHSIYGI 80
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Length = 291 Back     information, alignment and structure
>d1rtra_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]} Length = 290 Back     information, alignment and structure
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Length = 348 Back     information, alignment and structure
>d1v4ea_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} Length = 280 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
d1fpsa_348 Farnesyl diphosphate synthase (geranyltranstransfe 99.96
d2q80a1291 Geranylgeranyl pyrophosphate synthetase {Human (Ho 99.96
d1v4ea_280 Octoprenyl-diphosphate synthase {Thermotoga mariti 99.95
d1rqja_299 Farnesyl diphosphate synthase (geranyltranstransfe 99.94
d1rtra_290 Farnesyl diphosphate synthase (geranyltranstransfe 99.94
d2q80a1 291 Geranylgeranyl pyrophosphate synthetase {Human (Ho 99.76
d1rqja_ 299 Farnesyl diphosphate synthase (geranyltranstransfe 99.73
d1fpsa_ 348 Farnesyl diphosphate synthase (geranyltranstransfe 99.72
d1v4ea_ 280 Octoprenyl-diphosphate synthase {Thermotoga mariti 99.68
d1rtra_ 290 Farnesyl diphosphate synthase (geranyltranstransfe 99.67
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Isoprenyl diphosphate synthases
domain: Farnesyl diphosphate synthase (geranyltranstransferase)
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=99.96  E-value=3.2e-30  Score=205.65  Aligned_cols=156  Identities=15%  Similarity=0.069  Sum_probs=98.6

Q ss_pred             HhHHHhHhhhhcccccCCCccccChhhHHhhhhhhhhhhcccChHH-------------------------HHHHH----
Q psy5532           2 FAEMIHTASLIHDDVIDQSDFRRGKPSVNVVYNHKKELISNTNQEE-------------------------LRTIS----   52 (168)
Q Consensus         2 ~~El~h~aslihDDi~D~~~~RRG~~~~~~~~g~~~ai~~~~~~~~-------------------------l~~~~----   52 (168)
                      ++|++|+||||||||||+|++|||+||+|++||+..+++.  ++..                         +....    
T Consensus        86 avEliH~asLihDDi~D~~~~RRG~pt~~~~~g~~~ail~--gd~ll~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  163 (348)
T d1fpsa_          86 CIELFQAFFLVADDIMDQSLTRRGQLCWYKKEGVGLDAIN--DSFLLESSVYRVLKKYCRQRPYYVHLLELFLQTAYQTE  163 (348)
T ss_dssp             HHHHHHHHHHHHHHHTTTCCEETTEECTTTSTTTTTTHHH--HHHHHHHHHHHHHHHHHTTSTTHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCccccCCccccccchhhhhccccHHHHH--HHHHHHHHHHHHHHhhccchHHHHHHHHhhhhhhhHHH
Confidence            6899999999999999999999999999999999766520  0000                         11111    


Q ss_pred             -----HHHHhCCC-------------cchHHHHHHH-------HHHHhcCCc---cHHHHHHHHHHHHHHHHHHhhhcCC
Q psy5532          53 -----TYYFDGQG-------------KAVRPMVSVL-------MGRAINYHL---NRKQVAMFAEMIHTASLIHDDVIDQ  104 (168)
Q Consensus        53 -----~~~~~~~g-------------k~~r~~~~~l-------~~~~~~~~~---~~~~l~~~~e~lg~afqI~DDilD~  104 (168)
                           +......+             ++++.+++.+       .+.+..+..   ....+..||+.+|+||||+||++|+
T Consensus       164 ~GQ~ldl~~~~~~~~~~~~~t~~~Y~~~i~~KTa~l~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~lGiaFQI~DDilD~  243 (348)
T d1fpsa_         164 LGQMLDLITAPVSKVDLSHFSEERYKAIVKYKTAFYSFYLPVAAAMYMVGIDSKEEHENAKAILLEMGEYFQIQDDYLDC  243 (348)
T ss_dssp             HHHHHHHHHSCTTTCCSSSCCHHHHHHHHHHHTHHHHTHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhhhccccccccccCHHHHHHHHHHHhhhhhHHHHHHHHHHhhhhccccchhhccccccccchHHHHHHHHhhh
Confidence                 00010000             1233333322       111122222   4578999999999999999999996


Q ss_pred             -----------CccccCCCchhHHhccchhhccCCCHHHHHHHhhhhhcCCCchHHHHHHHHhh-hhhhhhh
Q psy5532         105 -----------SDFRRGKPSVNVVYNHKKELISNTNQEELRTISTYYFDGQGKAVRPMVSVLMG-RAINYHL  164 (168)
Q Consensus       105 -----------~d~r~Gk~t~~~~~g~~~ail~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~-~~~~y~~  164 (168)
                                 +|+++||+|+|.++..     ....++..+.+...+.+...+....+.++... ++.+|+.
T Consensus       244 ~gd~~~~GK~g~Dl~egK~Tlpii~al-----~~~~~~~r~~l~~~~~~~~~e~i~~v~~~i~~~g~~~~~~  310 (348)
T d1fpsa_         244 FGDPALTGKVGTDIQDNKCSWLVVQCL-----QRVTPEQRQLLEDNYGRKEPEKVAKVKELYEAVGMRAAFQ  310 (348)
T ss_dssp             SCCSSCCSSCSCCCSSCCCCHHHHHHH-----HTCCHHHHHHHHHHSSSSCHHHHHHHHHHHHHHTHHHHHH
T ss_pred             hcchhccCcccccccCCccHHHHHHHH-----HhCCHHHHHHHHHHhCCCCHHHHHHHHHHHHHCChHHHHH
Confidence                       5899999999999973     34445555666666554443333444444332 5555544
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v4ea_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rqja_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rtra_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rqja_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1v4ea_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rtra_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure