Psyllid ID: psy5548

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MKSYNGRRKAERQDLASAGEKPRSSTSEIVIKWLDSNPAGREGRFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTCEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFKMEKS
cccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccccEEEEEcccccccccccccccccccccccccccccEEEEEccccccccEEEEEEEccccccccccccccEEcccc
cccccccEEEEHHHHHHHHHHHHHHccHHHHHHHHHHccccHccccEEEEEccccccHHHHHHHHHHHcccccccEcccccccHHcHHHHHHHHHHHHccccccHHHHHcccccEccccEEEEEcccEEEEEEccccEccEEEEEEEEEccccccEEEEEEEEccccEHHHcEEEEEEEEEcc
mksyngrrKAERQDlasagekprsstSEIVIKWldsnpagregrfedkqkavgshLYPIITKLYQAWLVHQANslvgtktrhdtCEAVAYGAAVQAAILhgdkseevqdlllldvtplslgieTAGGVMTALIKrnttiptkqtqtfttysdnqpgvLIQVYEgeramtkdnnllgkfkmeks
mksyngrrkaerqdlasagekprsstseiVIKWldsnpagregrFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTCEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRnttiptkqtqtfttysdnqpgVLIQVyegeramtkdnnllgkfkmeks
MKSYNGRRKAERQDLASAGEKPRSSTSEIVIKWLDSNPAGREGRFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTCEavaygaavqaaILHGDKSEEVQDlllldvtplslGIETAGGVMTALIKRNttiptkqtqtfttYSDNQPGVLIQVYEGERAMTKDNNLLGKFKMEKS
****************************IVIKWL****************AVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTCEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEG*******************
******RRKAERQDLASAGEKPRSSTSEIVIKWLDSNPAGREGRFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTCEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFKM***
**************************SEIVIKWLDSNPAGREGRFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTCEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFKMEKS
***YNGRRKAERQDLASAGEKPRSSTSEIVIKWLDSNPAGREGRFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTCEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFKMEK*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSYNGRRKAERQDLASAGEKPRSSTSEIVIKWLDSNPAGREGRFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTCEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFKMEKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
Q9U639 652 Heat shock 70 kDa protein N/A N/A 0.666 0.187 0.759 4e-48
P11147 651 Heat shock 70 kDa protein yes N/A 0.519 0.145 0.947 1e-47
Q90473 649 Heat shock cognate 71 kDa yes N/A 0.666 0.187 0.759 5e-47
P19378 646 Heat shock cognate 71 kDa yes N/A 0.666 0.188 0.759 5e-47
Q71U34 646 Heat shock cognate 71 kDa N/A N/A 0.666 0.188 0.759 6e-47
P11142 646 Heat shock cognate 71 kDa yes N/A 0.666 0.188 0.759 6e-47
A2Q0Z1 646 Heat shock cognate 71 kDa yes N/A 0.666 0.188 0.759 6e-47
P19120 650 Heat shock cognate 71 kDa yes N/A 0.666 0.187 0.759 6e-47
P63018 646 Heat shock cognate 71 kDa yes N/A 0.666 0.188 0.759 6e-47
P63017 646 Heat shock cognate 71 kDa yes N/A 0.666 0.188 0.759 6e-47
>sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 Back     alignment and function desciption
 Score =  190 bits (483), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/129 (75%), Positives = 105/129 (81%), Gaps = 7/129 (5%)

Query: 53  GSHLYPIITKLYQAWLV-HQANSLVGTKTRHDTCEAVAYGAAVQAAILHGDKSEEVQDLL 111
           GS   P + KL Q +    + N  +         EAVAYGAAVQAAILHGDKSEEVQDLL
Sbjct: 339 GSTRIPKVQKLLQDFFNGKELNKSINPD------EAVAYGAAVQAAILHGDKSEEVQDLL 392

Query: 112 LLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKD 171
           LLDVTPLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQV+EGERAMTKD
Sbjct: 393 LLDVTPLSLGIETAGGVMTTLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKD 452

Query: 172 NNLLGKFKM 180
           NNLLGKF++
Sbjct: 453 NNLLGKFEL 461

Manduca sexta (taxid: 7130)
>sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 Back     alignment and function description
>sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 Back     alignment and function description
>sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 Back     alignment and function description
>sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 Back     alignment and function description
>sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 Back     alignment and function description
>sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 Back     alignment and function description
>sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 Back     alignment and function description
>sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 Back     alignment and function description
>sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
211908975 347 cognate 70 kDa heat shock protein, parti 0.666 0.351 0.775 1e-47
398025479 653 heat shock protein 70 [Aphis glycines] 0.666 0.186 0.775 2e-47
193688192 661 PREDICTED: heat shock 70 kDa protein cog 0.666 0.184 0.775 2e-47
151302107 651 heat shock protein 70 [Harmonia axyridis 0.519 0.145 0.978 2e-47
193603576 654 PREDICTED: heat shock 70 kDa protein cog 0.666 0.186 0.775 2e-47
322785911 534 hypothetical protein SINV_15088 [Solenop 0.666 0.228 0.775 3e-47
91093813 649 PREDICTED: similar to heat shock cognate 0.666 0.187 0.775 3e-47
283827879 649 heat shock protein 70 [Mantichorula seme 0.519 0.146 0.978 3e-47
124244561 653 heat shock protein 70 [Laternula ellipti 0.666 0.186 0.775 3e-47
313510878 653 heat shock protein 70s [Nereis aibuhiten 0.666 0.186 0.775 4e-47
>gi|211908975|gb|ACJ12782.1| cognate 70 kDa heat shock protein, partial [Pyrrhocoris apterus] Back     alignment and taxonomy information
 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/129 (77%), Positives = 106/129 (82%), Gaps = 7/129 (5%)

Query: 53  GSHLYPIITKLYQAWLV-HQANSLVGTKTRHDTCEAVAYGAAVQAAILHGDKSEEVQDLL 111
           GS   P + KL Q +    + N  +         EAVAYGAAVQAAILHGDKSEEVQDLL
Sbjct: 34  GSTRIPKVQKLLQDFFNGKELNKSINPD------EAVAYGAAVQAAILHGDKSEEVQDLL 87

Query: 112 LLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKD 171
           LLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKD
Sbjct: 88  LLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKD 147

Query: 172 NNLLGKFKM 180
           NNLLGKF++
Sbjct: 148 NNLLGKFEL 156

Source: Pyrrhocoris apterus

Species: Pyrrhocoris apterus

Genus: Pyrrhocoris

Family: Pyrrhocoridae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|398025479|gb|AFO70211.1| heat shock protein 70 [Aphis glycines] Back     alignment and taxonomy information
>gi|193688192|ref|XP_001951386.1| PREDICTED: heat shock 70 kDa protein cognate 4-like isoform 1 [Acyrthosiphon pisum] gi|328709708|ref|XP_003244048.1| PREDICTED: heat shock 70 kDa protein cognate 4-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|151302107|gb|ABR92405.1| heat shock protein 70 [Harmonia axyridis] Back     alignment and taxonomy information
>gi|193603576|ref|XP_001951233.1| PREDICTED: heat shock 70 kDa protein cognate 4-like isoform 2 [Acyrthosiphon pisum] gi|193603578|ref|XP_001951207.1| PREDICTED: heat shock 70 kDa protein cognate 4-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322785911|gb|EFZ12530.1| hypothetical protein SINV_15088 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|91093813|ref|XP_966611.1| PREDICTED: similar to heat shock cognate 70 isoform 1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|283827879|gb|ADB44081.1| heat shock protein 70 [Mantichorula semenowi] Back     alignment and taxonomy information
>gi|124244561|gb|ABM92345.1| heat shock protein 70 [Laternula elliptica] Back     alignment and taxonomy information
>gi|313510878|gb|ADR66514.1| heat shock protein 70s [Nereis aibuhitensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
FB|FBgn0001219 651 Hsc70-4 "Heat shock protein co 0.453 0.127 0.650 3.3e-22
UNIPROTKB|A8K7Q2 410 HSPA8 "cDNA FLJ77848" [Homo sa 0.453 0.202 0.650 3.5e-22
WB|WBGene00002005 640 hsp-1 [Caenorhabditis elegans 0.453 0.129 0.662 6.6e-22
UNIPROTKB|E9PNE6 500 HSPA8 "Heat shock cognate 71 k 0.453 0.166 0.650 9.1e-22
RGD|1595502 565 LOC680121 "similar to heat sho 0.453 0.146 0.650 1.3e-21
ZFIN|ZDB-GENE-990415-92 649 hspa8 "heat shock protein 8" [ 0.672 0.189 0.5 1.4e-21
UNIPROTKB|D4A4S3 610 D4A4S3 "Uncharacterized protei 0.453 0.136 0.650 1.6e-21
UNIPROTKB|E9PKE3 627 HSPA8 "Heat shock cognate 71 k 0.453 0.132 0.650 1.7e-21
UNIPROTKB|F1S9Q1 643 F1S9Q1 "Uncharacterized protei 0.453 0.129 0.650 1.8e-21
UNIPROTKB|F1S9Q3 645 F1S9Q3 "Uncharacterized protei 0.453 0.128 0.650 1.8e-21
FB|FBgn0001219 Hsc70-4 "Heat shock protein cognate 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 3.3e-22, P = 3.3e-22
 Identities = 54/83 (65%), Positives = 58/83 (69%)

Query:    98 ILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGV 157
             ILHGDKS+EVQD           GIETAGGVM+ LIKRN             YSDNQPGV
Sbjct:   379 ILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGV 438

Query:   158 LIQVYEGERAMTKDNNLLGKFKM 180
             LIQVYEGERAMTKDNNLLGKF++
Sbjct:   439 LIQVYEGERAMTKDNNLLGKFEL 461
GO:0005737 "cytoplasm" evidence=IDA
GO:0005726 "perichromatin fibrils" evidence=IDA
GO:0005743 "mitochondrial inner membrane" evidence=IDA
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=IMP
GO:0007413 "axonal fasciculation" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
GO:0007399 "nervous system development" evidence=IMP
GO:0006457 "protein folding" evidence=ISS;NAS
GO:0016887 "ATPase activity" evidence=NAS
GO:0051082 "unfolded protein binding" evidence=ISS;NAS
GO:0007269 "neurotransmitter secretion" evidence=IGI;IMP;IPI
GO:0016192 "vesicle-mediated transport" evidence=IMP
GO:0005739 "mitochondrion" evidence=ISS
GO:0051087 "chaperone binding" evidence=IDA
GO:0016246 "RNA interference" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
GO:0030018 "Z disc" evidence=IDA
UNIPROTKB|A8K7Q2 HSPA8 "cDNA FLJ77848" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00002005 hsp-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E9PNE6 HSPA8 "Heat shock cognate 71 kDa protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1595502 LOC680121 "similar to heat shock protein 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-92 hspa8 "heat shock protein 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D4A4S3 D4A4S3 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PKE3 HSPA8 "Heat shock cognate 71 kDa protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9Q1 F1S9Q1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9Q3 F1S9Q3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P08107HSP71_HUMANNo assigned EC number0.90520.48630.1388noN/A
P29843HSP7A_DROMENo assigned EC number0.90520.51910.1482noN/A
P09446HSP7A_CAEELNo assigned EC number0.92630.51910.1484yesN/A
O73885HSP7C_CHICKNo assigned EC number0.75960.66660.1888yesN/A
P47773HSP7C_ICTPUNo assigned EC number0.90520.51910.1463N/AN/A
P63018HSP7C_RATNo assigned EC number0.75960.66660.1888yesN/A
P63017HSP7C_MOUSENo assigned EC number0.75960.66660.1888yesN/A
P19378HSP7C_CRIGRNo assigned EC number0.75960.66660.1888yesN/A
P11503HSP70_ONCVONo assigned EC number0.92630.51910.2950N/AN/A
Q4R888HS71L_MACFANo assigned EC number0.90520.51910.1482N/AN/A
Q90473HSP7C_DANRENo assigned EC number0.75960.66660.1879yesN/A
Q5R7D3HSP71_PONABNo assigned EC number0.90520.48630.1388noN/A
Q5NVM9HSP7C_PONABNo assigned EC number0.75960.66660.1888yesN/A
A2Q0Z1HSP7C_HORSENo assigned EC number0.75960.66660.1888yesN/A
P27541HSP70_BRUMANo assigned EC number0.90520.51910.1475N/AN/A
Q61696HS71A_MOUSENo assigned EC number0.90520.51910.1482noN/A
P17879HS71B_MOUSENo assigned EC number0.90520.51910.1479noN/A
P11147HSP7D_DROMENo assigned EC number0.94730.51910.1459yesN/A
Q07439HSP71_RATNo assigned EC number0.90520.51910.1482noN/A
P11142HSP7C_HUMANNo assigned EC number0.75960.66660.1888yesN/A
P19120HSP7C_BOVINNo assigned EC number0.75960.66660.1876yesN/A
P34931HS71L_HUMANNo assigned EC number0.90520.48630.1388noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
PTZ00009 653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 3e-60
pfam00012 598 pfam00012, HSP70, Hsp70 protein 4e-50
PRK00290 627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 4e-49
TIGR02350 595 TIGR02350, prok_dnaK, chaperone protein DnaK 4e-44
CHL00094 621 CHL00094, dnaK, heat shock protein 70 2e-38
PRK13411 653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 8e-38
PTZ00400 663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 7e-37
PRK13410 668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 1e-35
COG0443 579 COG0443, DnaK, Molecular chaperone [Posttranslatio 4e-34
PRK05183 616 PRK05183, hscA, chaperone protein HscA; Provisiona 6e-33
TIGR01991 599 TIGR01991, HscA, Fe-S protein assembly chaperone H 1e-32
PLN03184 673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 1e-30
PTZ00186 657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 1e-27
PRK01433 595 PRK01433, hscA, chaperone protein HscA; Provisiona 6e-21
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 5e-05
cd10233376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 0.001
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information 
 Score =  197 bits (503), Expect = 3e-60
 Identities = 80/96 (83%), Positives = 91/96 (94%)

Query: 86  EAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQ 145
           EAVAYGAAVQAAIL G++S +VQDLLLLDVTPLSLG+ETAGGVMT LI+RNTTIPTK++Q
Sbjct: 369 EAVAYGAAVQAAILTGEQSSQVQDLLLLDVTPLSLGLETAGGVMTKLIERNTTIPTKKSQ 428

Query: 146 TFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFKME 181
            FTTY+DNQPGVLIQV+EGERAMTKDNNLLGKF ++
Sbjct: 429 IFTTYADNQPGVLIQVFEGERAMTKDNNLLGKFHLD 464

Length = 653
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
KOG0100|consensus 663 100.0
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 100.0
KOG0101|consensus 620 100.0
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 100.0
PRK01433 595 hscA chaperone protein HscA; Provisional 100.0
PRK13411 653 molecular chaperone DnaK; Provisional 100.0
PRK13410 668 molecular chaperone DnaK; Provisional 100.0
PTZ00009 653 heat shock 70 kDa protein; Provisional 100.0
PRK05183 616 hscA chaperone protein HscA; Provisional 100.0
PLN03184 673 chloroplast Hsp70; Provisional 100.0
PTZ00400 663 DnaK-type molecular chaperone; Provisional 100.0
CHL00094 621 dnaK heat shock protein 70 100.0
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 100.0
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 100.0
KOG0102|consensus 640 100.0
PF00012 602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 100.0
COG0443 579 DnaK Molecular chaperone [Posttranslational modifi 99.97
KOG0103|consensus 727 99.93
KOG0104|consensus 902 99.91
PRK11678450 putative chaperone; Provisional 99.58
PRK13928336 rod shape-determining protein Mbl; Provisional 99.47
PRK13927334 rod shape-determining protein MreB; Provisional 99.34
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 99.24
PRK13930335 rod shape-determining protein MreB; Provisional 99.21
PRK13929335 rod-share determining protein MreBH; Provisional 99.21
PRK15080267 ethanolamine utilization protein EutJ; Provisional 99.03
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 98.93
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 98.88
PRK09472420 ftsA cell division protein FtsA; Reviewed 98.68
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 98.06
PRK13917344 plasmid segregation protein ParM; Provisional 97.73
PF02782198 FGGY_C: FGGY family of carbohydrate kinases, C-ter 97.21
PRK15027484 xylulokinase; Provisional 97.04
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 97.03
COG0849418 ftsA Cell division ATPase FtsA [Cell division and 96.94
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 96.91
COG1077342 MreB Actin-like ATPase involved in cell morphogene 96.73
TIGR01315541 5C_CHO_kinase FGGY-family pentulose kinase. This m 96.72
TIGR02261262 benz_CoA_red_D benzoyl-CoA reductase, bcr type, su 96.68
TIGR01312481 XylB D-xylulose kinase. D-xylulose kinase (XylB) g 96.62
PLN02669556 xylulokinase 96.58
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 96.38
TIGR02628465 fuculo_kin_coli L-fuculokinase. Members of this fa 96.36
PRK13317277 pantothenate kinase; Provisional 96.31
PRK04123548 ribulokinase; Provisional 96.29
TIGR01311493 glycerol_kin glycerol kinase. This model describes 96.24
TIGR02259432 benz_CoA_red_A benzoyl-CoA reductase, bcr type, su 96.24
TIGR01234536 L-ribulokinase L-ribulokinase. This enzyme catalyz 96.23
PRK10331470 L-fuculokinase; Provisional 96.18
PRK00047498 glpK glycerol kinase; Provisional 96.15
PTZ00294504 glycerol kinase-like protein; Provisional 96.14
KOG2517|consensus516 96.08
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 96.04
TIGR01314505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 95.85
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 95.82
PLN02295512 glycerol kinase 95.77
TIGR02627454 rhamnulo_kin rhamnulokinase. This model describes 95.67
TIGR03739320 PRTRC_D PRTRC system protein D. A novel genetic sy 95.66
cd00012371 ACTIN Actin; An ubiquitous protein involved in the 95.65
PRK10939520 autoinducer-2 (AI-2) kinase; Provisional 95.45
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 95.37
PRK10640471 rhaB rhamnulokinase; Provisional 95.31
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbo 94.92
PF00022393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 94.81
PF06406318 StbA: StbA protein; InterPro: IPR009440 This entry 93.93
KOG2531|consensus545 93.8
PF03702364 UPF0075: Uncharacterised protein family (UPF0075); 93.72
COG4820277 EutJ Ethanolamine utilization protein, possible ch 93.55
PF01869271 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In 92.83
COG1069544 AraB Ribulose kinase [Energy production and conver 91.66
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 91.61
PRK09585365 anmK anhydro-N-acetylmuramic acid kinase; Reviewed 90.1
TIGR03281326 methan_mark_12 putative methanogenesis marker prot 89.54
TIGR00143711 hypF [NiFe] hydrogenase maturation protein HypF. A 88.29
PTZ00281376 actin; Provisional 87.99
PTZ00452375 actin; Provisional 87.14
TIGR00555279 panK_eukar pantothenate kinase, eukaryotic/staphyl 87.05
PTZ00004378 actin-2; Provisional 86.16
PTZ00466380 actin-like protein; Provisional 85.47
PRK00976326 hypothetical protein; Provisional 85.44
PF08841332 DDR: Diol dehydratase reactivase ATPase-like domai 84.78
PF02543360 CmcH_NodU: Carbamoyltransferase; InterPro: IPR0036 84.64
PTZ00280414 Actin-related protein 3; Provisional 84.37
COG0554499 GlpK Glycerol kinase [Energy production and conver 82.54
PRK03011358 butyrate kinase; Provisional 81.21
PRK09604332 UGMP family protein; Validated 81.12
PF07318343 DUF1464: Protein of unknown function (DUF1464); In 80.04
>KOG0100|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.5e-44  Score=298.39  Aligned_cols=170  Identities=45%  Similarity=0.626  Sum_probs=164.1

Q ss_pred             CCceeecHHHHHHhhhhHHHhHHHHHHHHHhhCCCCCCCCCCcEEeecCccchHHHHHHHHhhcCCcccccCCCcccCCc
Q psy5548           5 NGRRKAERQDLASAGEKPRSSTSEIVIKWLDSNPAGREGRFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDT   84 (183)
Q Consensus         5 ~~~~~itR~~fe~l~~~l~~~~~~~~~~~l~~~~~~~~~~i~~ViLvGGss~iP~V~~~l~~~f~~~~~~~~~~~~~~~p   84 (183)
                      +++.++||+.||+|.-+|+.++..++.++|+++++ .+.|||.++|||||||||+||++|+++|.|+.+++.     +||
T Consensus       324 DfSEtLtRAkFEElNmDLFr~TlkPv~kvl~Ds~l-kKsdideiVLVGGsTrIPKvQqllk~fF~GKepskG-----inP  397 (663)
T KOG0100|consen  324 DFSETLTRAKFEELNMDLFRKTLKPVQKVLEDSDL-KKSDIDEIVLVGGSTRIPKVQQLLKDFFNGKEPSKG-----INP  397 (663)
T ss_pred             cccchhhhhHHHHhhhHHHHHhhHHHHHHHhhcCc-ccccCceEEEecCcccChhHHHHHHHHhCCCCccCC-----CCh
Confidence            34689999999999999999999999999999999 599999999999999999999999999999999999     999


Q ss_pred             hhHHhhhHHHHHHHHhCCCccccceeEEEeecceeeeEEEeCCEEEEEEeCCCCcCcceEEEEEcccCCCccEEEEEEec
Q psy5548          85 CEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEG  164 (183)
Q Consensus        85 ~eaVA~GAa~~a~~l~~~~~~~~~~~~~~d~~~~~igi~~~~g~~~~ii~~~t~lP~~~~~~~~~~~d~q~~i~i~i~eG  164 (183)
                      |||||+|||.||..++|.  +...++.+.|+.|.++||++.+|.|+.+|||||.+|+++++.|++..|||+.+.|++|||
T Consensus       398 dEAVAYGAAVQaGvlsGe--e~t~divLLDv~pLtlGIETvGGVMTklI~RNTviPTkKSQvFsTa~DnQ~tV~I~vyEG  475 (663)
T KOG0100|consen  398 DEAVAYGAAVQAGVLSGE--EDTGDIVLLDVNPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAQDNQPTVTIQVYEG  475 (663)
T ss_pred             HHHHHhhhhhhhcccccc--cCcCcEEEEeeccccceeeeecceeeccccCCcccCccccceeeecccCCceEEEEEeec
Confidence            999999999999999997  457899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCceeeEEEEeC
Q psy5548         165 ERAMTKDNNLLGKFKMEK  182 (183)
Q Consensus       165 e~~~~~~n~~lG~~~l~g  182 (183)
                      |+.+.++|++||+|+|.|
T Consensus       476 ER~mtkdn~lLGkFdltG  493 (663)
T KOG0100|consen  476 ERPMTKDNHLLGKFDLTG  493 (663)
T ss_pred             cccccccccccccccccC
Confidence            999999999999999987

>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>KOG0101|consensus Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>KOG0102|consensus Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0103|consensus Back     alignment and domain information
>KOG0104|consensus Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D Back     alignment and domain information
>TIGR01312 XylB D-xylulose kinase Back     alignment and domain information
>PLN02669 xylulokinase Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>KOG2517|consensus Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase Back     alignment and domain information
>TIGR03739 PRTRC_D PRTRC system protein D Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] Back     alignment and domain information
>KOG2531|consensus Back     alignment and domain information
>PF03702 UPF0075: Uncharacterised protein family (UPF0075); InterPro: IPR005338 Anhydro-N-acetylmuramic acid kinase catalyzes the specific phosphorylation of 1,6-anhydro-N-acetylmuramic acid (anhMurNAc) with the simultaneous cleavage of the 1,6-anhydro ring, generating MurNAc-6-P Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>PRK09585 anmK anhydro-N-acetylmuramic acid kinase; Reviewed Back     alignment and domain information
>TIGR03281 methan_mark_12 putative methanogenesis marker protein 12 Back     alignment and domain information
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>PRK00976 hypothetical protein; Provisional Back     alignment and domain information
>PF08841 DDR: Diol dehydratase reactivase ATPase-like domain; InterPro: IPR009191 Diol dehydratase (propanediol dehydratase) and glycerol dehydratase undergo concomitant, irreversible inactivation by glycerol during catalysis [, ] Back     alignment and domain information
>PF02543 CmcH_NodU: Carbamoyltransferase; InterPro: IPR003696 The putative O-carbamoyltransferases (O-Cases) encoded by the nodU genes of Rhizobium fredii and Bradyrhizobium japonicum are involved in the synthesis of nodulation factors [] Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>COG0554 GlpK Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>PRK03011 butyrate kinase; Provisional Back     alignment and domain information
>PRK09604 UGMP family protein; Validated Back     alignment and domain information
>PF07318 DUF1464: Protein of unknown function (DUF1464); InterPro: IPR009927 This family consists of several hypothetical archaeal proteins of around 350 residues in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1yuw_A554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 2e-24
3c7n_B554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 2e-24
2v7z_A543 Crystal Structure Of The 70-Kda Heat Shock Cognate 3e-24
1ckr_A159 High Resolution Solution Structure Of The Heat Shoc 2e-21
3h0x_A152 Crystal Structure Of Peptide-Binding Domain Of Kar2 9e-16
3dob_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 2e-15
2v7y_A509 Crystal Structure Of The Molecular Chaperone Dnak F 2e-08
2op6_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 2e-08
3dqg_A151 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 5e-08
1dkx_A 219 The Substrate Binding Domain Of Dnak In Complex Wit 1e-07
3dpo_A 219 Crystal Structure Of The Substrate Binding Domain O 1e-07
2kho_A 605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 1e-07
1bpr_A191 Nmr Structure Of The Substrate Binding Domain Of Dn 2e-07
1dg4_A115 Nmr Structure Of The Substrate Binding Domain Of Dn 2e-07
1dky_A 219 The Substrate Binding Domain Of Dnak In Complex Wit 2e-07
1q5l_A135 Nmr Structure Of The Substrate Binding Domain Of Dn 3e-07
3n8e_A182 Substrate Binding Domain Of The Human Heat Shock 70 3e-07
4b9q_A 605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 7e-07
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure 
Iteration: 1

 Score =  108 bits (269), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 56/83 (67%)
Query: 98  ILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGV 157
           IL GDKSE VQD           GIETAGGVMT LIKRN             YSDNQPGV
Sbjct: 379 ILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGV 438
Query: 158 LIQVYEGERAMTKDNNLLGKFKM 180
           LIQVYEGERAMTKDNNLLGKF++
Sbjct: 439 LIQVYEGERAMTKDNNLLGKFEL 461
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|1CKR|A Chain A, High Resolution Solution Structure Of The Heat Shock Cognate-70 Kd Substrate Binding Domain Obtained By Multidimensional Nmr Techniques Length = 159 Back     alignment and structure
>pdb|3H0X|A Chain A, Crystal Structure Of Peptide-Binding Domain Of Kar2 Protein From Saccharomyces Cerevisiae Length = 152 Back     alignment and structure
>pdb|3DOB|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F44e5.5 From C.Elegans. Length = 152 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|2OP6|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein D Precursor From C.Elegans Length = 152 Back     alignment and structure
>pdb|3DQG|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F, Mitochondrial Precursor, From Caenorhabditis Elegans. Length = 151 Back     alignment and structure
>pdb|1DKX|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 1 Selenomethionyl Crystals Length = 219 Back     alignment and structure
>pdb|3DPO|A Chain A, Crystal Structure Of The Substrate Binding Domain Of E. Coli Dnak In Complex With A Short Pyrrhocoricin-Derived Inhibitor Peptide Length = 219 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|1BPR|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak, Minimized Average Structure Length = 191 Back     alignment and structure
>pdb|1DG4|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak In The Apo Form Length = 115 Back     alignment and structure
>pdb|1DKY|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 2 Native Crystals Length = 219 Back     alignment and structure
>pdb|1Q5L|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak Bound To The Peptide Nrllltg Length = 135 Back     alignment and structure
>pdb|3N8E|A Chain A, Substrate Binding Domain Of The Human Heat Shock 70kda Prote (Mortalin) Length = 182 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 9e-71
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 1e-52
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 2e-52
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 1e-51
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 2e-51
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 2e-48
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 2e-47
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 2e-43
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 3e-41
4e81_A 219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 2e-39
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 8e-37
1u00_A 227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 3e-36
3lof_A113 Heat shock 70 kDa protein 1; structural genomics, 3e-06
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 3e-06
2p32_A120 Heat shock 70 kDa protein A; three-helix bundle, c 3e-06
1ud0_A113 HSC70, 70 kDa heat-shock-like protein; chaperone; 8e-06
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 1e-04
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
 Score =  222 bits (569), Expect = 9e-71
 Identities = 90/93 (96%), Positives = 90/93 (96%)

Query: 86  EAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQ 145
           EAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLGIETAGGVMT LIKRNTTIPTKQTQ
Sbjct: 367 EAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQ 426

Query: 146 TFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKF 178
           TFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKF
Sbjct: 427 TFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKF 459
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Length = 152 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182 Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135 Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219 Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Length = 151 Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Length = 227 Back     alignment and structure
>3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A Length = 113 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans} Length = 120 Back     alignment and structure
>1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1 Length = 113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 100.0
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 100.0
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 100.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 100.0
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 99.98
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 99.74
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 99.74
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 99.73
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 99.72
4e81_A 219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 99.72
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 99.71
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 99.71
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 99.71
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 99.7
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 99.69
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 99.65
1u00_A 227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 99.62
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 99.39
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.11
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 98.89
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 98.84
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 98.67
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 98.66
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 98.56
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 98.29
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 98.08
3js6_A355 Uncharacterized PARM protein; partition, segregati 97.87
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 97.72
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 97.33
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 97.13
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 96.96
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 96.92
4bc3_A538 Xylulose kinase; transferase, glucuronate xyluloki 96.85
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 96.76
3ezw_A526 Glycerol kinase; glycerol metabolism, allosteric r 96.69
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 96.67
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 96.66
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 96.59
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 96.49
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 96.45
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 96.44
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 96.42
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 96.42
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 96.35
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 96.33
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 96.33
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 96.3
2d0o_A610 DIOL dehydratase-reactivating factor large subunit 96.25
2w40_A503 Glycerol kinase, putative; closed conformation, ma 96.22
1nbw_A607 Glycerol dehydratase reactivase alpha subunit; mol 96.05
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 95.41
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO 93.66
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 93.34
3qbx_A371 Anhydro-N-acetylmuramic acid kinase; acetate and s 92.55
3cqy_A370 Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1 89.24
3vth_A761 Hydrogenase maturation factor; carbamoyltransfer, 88.95
3ttc_A657 HYPF, transcriptional regulatory protein; Zn finge 88.85
4g9i_A772 Hydrogenase maturation protein HYPF; zinc finger, 87.9
3ven_A 576 O-carbamoyltransferase TOBZ; antibiotic biosynthes 86.93
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops compl 86.7
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 85.03
3eno_A334 Putative O-sialoglycoprotein endopeptidase; hydrol 84.4
2e2o_A299 Hexokinase; acetate and sugar kinases, HSP70, acti 83.82
4fo0_A593 Actin-related protein 8; chromatin remodeling, nuc 82.73
3r8e_A321 Hypothetical sugar kinase; ribonuclease H-like mot 81.47
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
Probab=100.00  E-value=1e-36  Score=271.66  Aligned_cols=166  Identities=42%  Similarity=0.545  Sum_probs=157.5

Q ss_pred             CceeecHHHHHHhhhhHHHhHHHHHHHHHhhCCCCCCCCCCcEEeecCccchHHHHHHHHhhcCCcccccCCCcccCCch
Q psy5548           6 GRRKAERQDLASAGEKPRSSTSEIVIKWLDSNPAGREGRFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTC   85 (183)
Q Consensus         6 ~~~~itR~~fe~l~~~l~~~~~~~~~~~l~~~~~~~~~~i~~ViLvGGss~iP~V~~~l~~~f~~~~~~~~~~~~~~~p~   85 (183)
                      ++.+|||++||++++++++++.++++++|+++++ ...+|+.|+||||+|++|.|+++|+++|+ ..+..+     .||+
T Consensus       296 ~~~~itr~~~e~l~~~~~~~i~~~v~~~L~~a~~-~~~~i~~VvLvGG~sriP~v~~~l~~~fg-~~~~~~-----~nPd  368 (605)
T 4b9q_A          296 MNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIDDVILVGGQTRMPMVQKKVAEFFG-KEPRKD-----VNPD  368 (605)
T ss_dssp             EEEEEEHHHHHHHHHHHHHHTTHHHHHHHHHTTC-CGGGCSEEEEESGGGGSHHHHHHHHHHHT-SCCCSS-----SCTT
T ss_pred             EEEEEeHHHHHHHHHHHHHHHHHHHHHHHHHcCC-CHHHCcEEEEeCCccCchHHHHHHHHHhc-cCcCCC-----cChh
Confidence            3578999999999999999999999999999998 48999999999999999999999999995 666677     8999


Q ss_pred             hHHhhhHHHHHHHHhCCCccccceeEEEeecceeeeEEEeCCEEEEEEeCCCCcCcceEEEEEcccCCCccEEEEEEecC
Q psy5548          86 EAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGE  165 (183)
Q Consensus        86 eaVA~GAa~~a~~l~~~~~~~~~~~~~~d~~~~~igi~~~~g~~~~ii~~~t~lP~~~~~~~~~~~d~q~~i~i~i~eGe  165 (183)
                      +|||+|||++|+.+++.    .+++.+.|++|+++|+++.+|.+.+|||+|+++|++++.+|++..|||+.+.|+|||||
T Consensus       369 eaVA~GAai~a~~l~~~----~~~~~l~dv~p~slgie~~~g~~~~ii~rnt~iP~~~~~~f~t~~d~q~~v~i~v~~ge  444 (605)
T 4b9q_A          369 EAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGE  444 (605)
T ss_dssp             THHHHHHHHHHHHHHTS----SCSEEEECBCSSCEEEEETTTEEEEEECTTCBSSEEEEEEECCSSTTCCEEEEEEEESS
T ss_pred             HHHHHhHHHHHHHhcCC----CCceEEEeeeeeEEEEEEcCCEEEEEEeCCCcCCcceEEEeeeecccCceEEEEEEecc
Confidence            99999999999999986    57889999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCceeeEEEEeC
Q psy5548         166 RAMTKDNNLLGKFKMEK  182 (183)
Q Consensus       166 ~~~~~~n~~lG~~~l~g  182 (183)
                      +.++.+|+.||+|.|+|
T Consensus       445 ~~~~~~n~~lg~~~l~~  461 (605)
T 4b9q_A          445 RKRAADNKSLGQFNLDG  461 (605)
T ss_dssp             CSBGGGSEEEEEEEEEC
T ss_pred             ccccccCCEeeEEEEeC
Confidence            99999999999999986
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A* Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3qbx_A Anhydro-N-acetylmuramic acid kinase; acetate and sugar kinases, HSP70, actin superfamily, anhydro-N-actetylmuramic acid binding; HET: AH0; 2.10A {Pseudomonas aeruginosa} PDB: 3qbw_A* Back     alignment and structure
>3cqy_A Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1313, structural genomics, PSI-2, shewanella one MR-1, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3vth_A Hydrogenase maturation factor; carbamoyltransfer, maturation of [NIFE]-hydrogenase, carbamoylphosphate, iron, HYPE; HET: APC AP2; 2.00A {Thermoanaerobacter tengcongensis} PDB: 3vti_A Back     alignment and structure
>3ttc_A HYPF, transcriptional regulatory protein; Zn finger, nucleotide binding, hydrogenase maturation factor transferase; HET: ADP; 1.86A {Escherichia coli} PDB: 3tsp_A* 3tsu_A* 3ttf_A* 3ttd_A 3tsq_A Back     alignment and structure
>4g9i_A Hydrogenase maturation protein HYPF; zinc finger, ATP binding, carbamoyla transferase; 4.50A {Thermococcus kodakarensis} Back     alignment and structure
>3ven_A O-carbamoyltransferase TOBZ; antibiotic biosynthesis, substrate assisted catalysis, subst channeling, adenylation; HET: TLA; 1.57A {Streptoalloteichus tenebrarius} PDB: 3veo_A 3ves_A* 3vet_A* 3vew_A* 3ver_A* 3vf4_A* 3vf2_A* 3vex_A* 3vez_A* Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d1yuwa1159 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus 1e-35
d1dkza2118 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI 2e-32
d1u00a2115 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6 7e-31
d1ud0a_84 a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 4e-06
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure

class: All beta proteins
fold: Heat shock protein 70kD (HSP70), peptide-binding domain
superfamily: Heat shock protein 70kD (HSP70), peptide-binding domain
family: Heat shock protein 70kD (HSP70), peptide-binding domain
domain: DnaK
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  120 bits (301), Expect = 1e-35
 Identities = 73/78 (93%), Positives = 75/78 (96%)

Query: 104 SEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYE 163
           SE VQDLLLLDVTPLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYE
Sbjct: 1   SENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYE 60

Query: 164 GERAMTKDNNLLGKFKME 181
           GERAMTKDNNLLGKF++ 
Sbjct: 61  GERAMTKDNNLLGKFELT 78
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118 Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 84 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.87
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 99.86
d1yuwa1159 DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} 99.83
d1dkza2118 DnaK {Escherichia coli [TaxId: 562]} 99.8
d1u00a2115 Chaperone protein hscA (Hsc66) {Escherichia coli [ 99.77
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 99.56
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 98.46
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 98.0
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 97.88
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 97.81
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 96.73
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 96.52
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 95.54
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 92.21
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 92.17
d1b74a2147 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 92.09
d1z05a2197 Transcriptional regulator VC2007 {Vibrio cholerae 89.86
d2d0oa3203 Diol dehydratase-reactivating factor large subunit 89.39
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) 88.37
d2hoea2169 N-acetylglucosamine kinase {Thermotoga maritima [T 87.81
d2ap1a1186 Putative regulator protein YcfX {Salmonella typhim 87.46
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 86.83
d1nbwa3202 ATPase domain of the glycerol dehydratase reactiva 86.18
d2aa4a2170 N-acetylmannosamine kinase NanK {Escherichia coli 86.18
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.87  E-value=1.4e-22  Score=154.53  Aligned_cols=89  Identities=30%  Similarity=0.248  Sum_probs=82.9

Q ss_pred             CceeecHHHHHHhhhhHHHhHHHHHHHHHhhCCCCCCCCCCcEEeecCccchHHHHHHHHhhcCCcccccCCCcccCCch
Q psy5548           6 GRRKAERQDLASAGEKPRSSTSEIVIKWLDSNPAGREGRFEDKQKAVGSHLYPIITKLYQAWLVHQANSLVGTKTRHDTC   85 (183)
Q Consensus         6 ~~~~itR~~fe~l~~~l~~~~~~~~~~~l~~~~~~~~~~i~~ViLvGGss~iP~V~~~l~~~f~~~~~~~~~~~~~~~p~   85 (183)
                      ...+|||++||++++|+++++.++++++|+++++. +.+|+.|+||||+|++|.|++.++++|++.++..+     +||+
T Consensus       105 ~~~~itr~~~e~~~~~~~~~~~~~i~~~l~~~~~~-~~~i~~V~lvGG~sr~p~v~~~i~~~f~~~~i~~~-----~~p~  178 (193)
T d1bupa2         105 FYTSITRARFEELNADLFRGTLDPVEKALRDAKLD-KSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKS-----INPD  178 (193)
T ss_dssp             EEEEEEHHHHHHHTHHHHHHTHHHHHHHHHHHTCC-GGGCCEEEEESGGGGCHHHHHHHHHHTTTCCCBCS-----SCGG
T ss_pred             cceEEcHHHHHHHHHHHHHHHHHHHHHHHHHcCCC-HHHCCEEEEECCccccHHHHHHHHHHcCCCCCCCC-----CChH
Confidence            35689999999999999999999999999999874 88999999999999999999999999987777777     8999


Q ss_pred             hHHhhhHHHHHHHHh
Q psy5548          86 EAVAYGAAVQAAILH  100 (183)
Q Consensus        86 eaVA~GAa~~a~~l~  100 (183)
                      +|||+|||++|+.++
T Consensus       179 ~aVa~GaA~~aa~ls  193 (193)
T d1bupa2         179 EAVAYGAAVQAAILS  193 (193)
T ss_dssp             GHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHhhC
Confidence            999999999999875
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1z05a2 c.55.1.10 (A:209-405) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ap1a1 c.55.1.10 (A:118-303) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2aa4a2 c.55.1.10 (A:120-289) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure