Psyllid ID: psy5557


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MKISIAPKGAISPRIGKRKKKKKEEENKKKQKKKEEKKQKKKEEKKQKKKEKKEEKEEKKEKKKEEKKQKKEEEKDKKKEEKKQKKKEEKKQKKKEEKKQKKKKEEKKNKKAEEQNRQQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEVVTVVNVKVIKGGDSGKKWLRGVKQGVDQLSLAKER
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcEEcccccEEEEEHHHHHHHHHHHHHHHHHHEEEcccccccccEEEEEEEccEEEEccccccHHHHHHccccccHHHHHHHHHccccccccccc
ccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHHHHHEEcccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mkisiapkgaisprigkrkkkKKEEENKKKQKKKEEKKQKKKEEKKQKKKEKKEEKEEKKEKKKEEKKQKKEEEKDKKKEEKKQKKKEEKKQKKKEEKKQKKKKEEKKNKKAEEQNrqqglypnqkrTLIGYLRSVDQFANLVLHKTIErihvgnqygdiprgifiiRGENVVLMGEVVTVVNVKVIkggdsgkkWLRGVKQGVDQLSLAKER
mkisiapkgaisprigkrkkkkkeeenkkkqkkkeekkqkkkeekkqkkkekkeekeekkekkkeekkqkkeeekdkkkeekkqkkkeekkqkkkeekkqkkkkeekknkkaeeqnrqqglypnqkRTLIGYLRSVDQFANLVLHKTIERihvgnqygdiprGIFIIRGENVVLMGEVVTVVNVKVikggdsgkkwlrgvkqgvdqlslaker
MKISIAPKGAISPRIGKRkkkkkeeenkkkqkkkeekkqkkkeekkqkkkekkeekeekkekkkeekkqkkeeekdkkkeekkqkkkeekkqkkkeekkqkkkkeekknkkaeeqNRQQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEvvtvvnvkvIKGGDSGKKWLRGVKQGVDQLSLAKER
*****************************************************************************************************************************KRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEVVTVVNVKVIKGGDSGKKWLRGVK************
***********************************************************************************************************************GLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEVVTVVNVKV**************KQGVDQLSLA***
MKISIAPKGAISP*********************************************************************************************************QGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEVVTVVNVKVIKGGDSGKKWLRGVKQGVDQLSLAKER
********GAIS*RIG*RKKKKKE********************************************************************KK*EEKKQKKKKEEKKNKKAEEQNRQQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEVVTVVNVKVIKGGDSGKKWLRGVKQGVDQLSL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKISIAPKGAISPRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEVVTVVNVKVIKGGDSGKKWLRGVKQGVDQLSLAKER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query213 2.2.26 [Sep-21-2011]
Q5E9Z8133 U6 snRNA-associated Sm-li yes N/A 0.244 0.390 0.807 4e-23
O15116133 U6 snRNA-associated Sm-li yes N/A 0.244 0.390 0.807 4e-23
Q8VC85133 U6 snRNA-associated Sm-li yes N/A 0.244 0.390 0.807 5e-23
P87173140 U6 snRNA-associated Sm-li yes N/A 0.234 0.357 0.7 9e-16
>sp|Q5E9Z8|LSM1_BOVIN U6 snRNA-associated Sm-like protein LSm1 OS=Bos taurus GN=LSM1 PE=2 SV=1 Back     alignment and function desciption
 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 51/52 (98%)

Query: 127 RTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEV 178
           RTLIG+LRS+DQFANLVLH+T+ERIHVG +YGDIPRGIF++RGENVVL+GE+
Sbjct: 26  RTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEI 77




Plays a role in replication-dependent histone mRNA degradation. Binds specifically to the 3'-terminal U-tract of U6 snRNA.
Bos taurus (taxid: 9913)
>sp|O15116|LSM1_HUMAN U6 snRNA-associated Sm-like protein LSm1 OS=Homo sapiens GN=LSM1 PE=1 SV=1 Back     alignment and function description
>sp|Q8VC85|LSM1_MOUSE U6 snRNA-associated Sm-like protein LSm1 OS=Mus musculus GN=Lsm1 PE=2 SV=1 Back     alignment and function description
>sp|P87173|LSM1_SCHPO U6 snRNA-associated Sm-like protein LSm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsm1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
125811580137 GA18077 [Drosophila pseudoobscura pseudo 0.244 0.379 0.903 6e-23
195382173137 GJ21790 [Drosophila virilis] gi|19414460 0.244 0.379 0.903 6e-23
198437342133 PREDICTED: similar to U6 snRNA-associate 0.309 0.496 0.727 1e-22
427786347135 Putative der and-387 small nuclear ribon 0.272 0.429 0.775 1e-22
148298867138 LSM1-like protein [Bombyx mori] gi|95102 0.244 0.376 0.884 1e-22
357609556138 LSM1-like protein [Danaus plexippus] 0.244 0.376 0.884 1e-22
346471247135 hypothetical protein [Amblyomma maculatu 0.272 0.429 0.775 2e-22
66770685137 IP04948p [Drosophila melanogaster] 0.244 0.379 0.884 2e-22
194881822137 GG20797 [Drosophila erecta] gi|190658207 0.244 0.379 0.884 2e-22
195025615137 GH21171 [Drosophila grimshawi] gi|193902 0.244 0.379 0.884 2e-22
>gi|125811580|ref|XP_001361929.1| GA18077 [Drosophila pseudoobscura pseudoobscura] gi|195170162|ref|XP_002025882.1| GL10169 [Drosophila persimilis] gi|54637105|gb|EAL26508.1| GA18077 [Drosophila pseudoobscura pseudoobscura] gi|194110746|gb|EDW32789.1| GL10169 [Drosophila persimilis] Back     alignment and taxonomy information
 Score =  113 bits (282), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%)

Query: 127 RTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEV 178
           RTLIGYLRSVDQFANLVL +TIERIHVGNQYGDIPRG+FIIRGENVVL+GE+
Sbjct: 29  RTLIGYLRSVDQFANLVLQRTIERIHVGNQYGDIPRGVFIIRGENVVLLGEI 80




Source: Drosophila pseudoobscura pseudoobscura

Species: Drosophila pseudoobscura

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195382173|ref|XP_002049805.1| GJ21790 [Drosophila virilis] gi|194144602|gb|EDW60998.1| GJ21790 [Drosophila virilis] Back     alignment and taxonomy information
>gi|198437342|ref|XP_002124367.1| PREDICTED: similar to U6 snRNA-associated Sm-like protein LSm1 (Cancer-associated Sm-like) (Small nuclear ribonuclear CaSm) [Ciona intestinalis] Back     alignment and taxonomy information
>gi|427786347|gb|JAA58625.1| Putative der and-387 small nuclear ribonucleoprotein splicing factor [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|148298867|ref|NP_001091827.1| LSM1-like protein [Bombyx mori] gi|95102704|gb|ABF51290.1| LSM1-like protein [Bombyx mori] Back     alignment and taxonomy information
>gi|357609556|gb|EHJ66513.1| LSM1-like protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|346471247|gb|AEO35468.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|66770685|gb|AAY54654.1| IP04948p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194881822|ref|XP_001975020.1| GG20797 [Drosophila erecta] gi|190658207|gb|EDV55420.1| GG20797 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195025615|ref|XP_001986091.1| GH21171 [Drosophila grimshawi] gi|193902091|gb|EDW00958.1| GH21171 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
FB|FBgn0261067137 LSm1 [Drosophila melanogaster 0.239 0.372 0.901 1.3e-20
UNIPROTKB|Q5E9Z8133 LSM1 "U6 snRNA-associated Sm-l 0.239 0.383 0.823 7.2e-20
UNIPROTKB|E2R7S6133 LSM1 "Uncharacterized protein" 0.239 0.383 0.823 7.2e-20
UNIPROTKB|O15116133 LSM1 "U6 snRNA-associated Sm-l 0.239 0.383 0.823 7.2e-20
UNIPROTKB|I3LCU8133 LSM1 "Uncharacterized protein" 0.239 0.383 0.823 7.2e-20
MGI|MGI:1914457133 Lsm1 "LSM1 homolog, U6 small n 0.239 0.383 0.823 7.2e-20
RGD|1304967133 Lsm1 "LSM1 homolog, U6 small n 0.239 0.383 0.823 7.2e-20
ZFIN|ZDB-GENE-040801-68133 lsm1 "LSM1 homolog, U6 small n 0.239 0.383 0.803 5.1e-19
POMBASE|SPBC3D6.08c140 lsm1 "mRNA decapping complex s 0.239 0.364 0.686 3.8e-14
UNIPROTKB|E1C962133 E1C962 "Uncharacterized protei 0.178 0.285 0.815 1.6e-13
FB|FBgn0261067 LSm1 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 1.3e-20, P = 1.3e-20
 Identities = 46/51 (90%), Positives = 50/51 (98%)

Query:   127 RTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGE 177
             RTLIGYLRSVDQFANLVL +TIERIHVGN+YGDIPRG+FIIRGENVVL+GE
Sbjct:    29 RTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPRGVFIIRGENVVLLGE 79




GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0006396 "RNA processing" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=ISS
GO:0033962 "cytoplasmic mRNA processing body assembly" evidence=IMP
UNIPROTKB|Q5E9Z8 LSM1 "U6 snRNA-associated Sm-like protein LSm1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7S6 LSM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O15116 LSM1 "U6 snRNA-associated Sm-like protein LSm1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LCU8 LSM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1914457 Lsm1 "LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304967 Lsm1 "LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-68 lsm1 "LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBC3D6.08c lsm1 "mRNA decapping complex subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|E1C962 E1C962 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
cd0172874 cd01728, LSm1, Like-Sm protein 1 4e-34
cd0172791 cd01727, LSm8, Like-Sm protein 8 3e-10
PRK04195482 PRK04195, PRK04195, replication factor C large sub 6e-10
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-10
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-10
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-09
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-09
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-09
smart0065167 smart00651, Sm, snRNP Sm proteins 4e-09
PRK04195482 PRK04195, PRK04195, replication factor C large sub 6e-09
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-08
pfam0142366 pfam01423, LSM, LSM domain 1e-08
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-08
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-08
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 3e-07
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 3e-07
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-07
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-07
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 5e-07
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 9e-07
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-06
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-06
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 1e-06
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 1e-06
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 1e-06
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 2e-06
PTZ00053 470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 2e-06
TIGR02794346 TIGR02794, tolA_full, TolA protein 2e-06
PRK13735942 PRK13735, PRK13735, conjugal transfer mating pair 2e-06
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 2e-06
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 3e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-06
CHL00204 1832 CHL00204, ycf1, Ycf1; Provisional 5e-06
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 5e-06
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 6e-06
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 6e-06
pfam05087 887 pfam05087, Rota_VP2, Rotavirus VP2 protein 6e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-06
TIGR02794346 TIGR02794, tolA_full, TolA protein 8e-06
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 8e-06
CHL00204 1832 CHL00204, ycf1, Ycf1; Provisional 9e-06
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 1e-05
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 1e-05
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 1e-05
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 1e-05
TIGR01554 384 TIGR01554, major_cap_HK97, phage major capsid prot 1e-05
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 2e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-05
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 2e-05
pfam05087 887 pfam05087, Rota_VP2, Rotavirus VP2 protein 2e-05
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 2e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-05
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 3e-05
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 3e-05
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 3e-05
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 3e-05
TIGR02794346 TIGR02794, tolA_full, TolA protein 4e-05
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 4e-05
cd0171970 cd01719, Sm_G, Sm protein G 4e-05
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 5e-05
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 5e-05
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 5e-05
PTZ00053 470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 6e-05
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 6e-05
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 6e-05
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 6e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-05
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 7e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-05
PRK13735942 PRK13735, PRK13735, conjugal transfer mating pair 8e-05
COG195879 COG1958, LSM1, Small nuclear ribonucleoprotein (sn 9e-05
TIGR02794346 TIGR02794, tolA_full, TolA protein 1e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 1e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 1e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 1e-04
pfam05758 832 pfam05758, Ycf1, Ycf1 1e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 2e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 2e-04
PRK13735942 PRK13735, PRK13735, conjugal transfer mating pair 2e-04
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 2e-04
TIGR01554 384 TIGR01554, major_cap_HK97, phage major capsid prot 2e-04
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 2e-04
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 2e-04
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 2e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 2e-04
pfam05758 832 pfam05758, Ycf1, Ycf1 2e-04
pfam05758 832 pfam05758, Ycf1, Ycf1 2e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 2e-04
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 2e-04
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 2e-04
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 2e-04
COG5116926 COG5116, RPN2, 26S proteasome regulatory complex c 2e-04
PRK05035695 PRK05035, PRK05035, electron transport complex pro 2e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 2e-04
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 3e-04
TIGR01554 384 TIGR01554, major_cap_HK97, phage major capsid prot 3e-04
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 3e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 3e-04
COG5116926 COG5116, RPN2, 26S proteasome regulatory complex c 3e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 3e-04
PLN02967 581 PLN02967, PLN02967, kinase 3e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 4e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 4e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 5e-04
TIGR01554 384 TIGR01554, major_cap_HK97, phage major capsid prot 5e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 5e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 5e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 6e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 6e-04
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 6e-04
pfam05758 832 pfam05758, Ycf1, Ycf1 6e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 6e-04
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 7e-04
PRK00448 1437 PRK00448, polC, DNA polymerase III PolC; Validated 7e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 8e-04
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 8e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 8e-04
smart00435391 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota 8e-04
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 9e-04
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 9e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 9e-04
COG5116926 COG5116, RPN2, 26S proteasome regulatory complex c 9e-04
smart00435391 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota 9e-04
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 9e-04
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 0.001
PRK13735942 PRK13735, PRK13735, conjugal transfer mating pair 0.001
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 0.001
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.001
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.001
pfam05758 832 pfam05758, Ycf1, Ycf1 0.001
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 0.001
PRK05035695 PRK05035, PRK05035, electron transport complex pro 0.001
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.001
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.001
PRK00448 1437 PRK00448, polC, DNA polymerase III PolC; Validated 0.001
PRK00448 1437 PRK00448, polC, DNA polymerase III PolC; Validated 0.001
smart00435391 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota 0.001
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 0.001
PRK12903925 PRK12903, secA, preprotein translocase subunit Sec 0.001
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 0.001
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 0.001
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 0.001
PRK10811 1068 PRK10811, rne, ribonuclease E; Reviewed 0.001
PRK10811 1068 PRK10811, rne, ribonuclease E; Reviewed 0.001
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.002
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 0.002
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.002
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.002
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.002
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 0.002
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.002
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.002
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 0.002
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 0.002
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.002
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.002
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 0.002
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.002
pfam00183 529 pfam00183, HSP90, Hsp90 protein 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
smart00786196 smart00786, SHR3_chaperone, ER membrane protein SH 0.002
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 0.002
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.003
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.003
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.003
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.003
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.003
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.003
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.003
pfam05758 832 pfam05758, Ycf1, Ycf1 0.003
smart00435391 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota 0.003
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.003
PRK12705 508 PRK12705, PRK12705, hypothetical protein; Provisio 0.003
TIGR01069771 TIGR01069, mutS2, MutS2 family protein 0.003
TIGR01069771 TIGR01069, mutS2, MutS2 family protein 0.003
PRK08451535 PRK08451, PRK08451, DNA polymerase III subunits ga 0.003
PTZ00053 470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 0.004
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.004
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.004
TIGR01554 384 TIGR01554, major_cap_HK97, phage major capsid prot 0.004
pfam05758 832 pfam05758, Ycf1, Ycf1 0.004
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 0.004
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.004
pfam00183 529 pfam00183, HSP90, Hsp90 protein 0.004
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.004
PRK12585197 PRK12585, PRK12585, putative monovalent cation/H+ 0.004
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 0.004
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 0.004
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 0.004
pfam06375 561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 0.004
pfam08229196 pfam08229, SHR3_chaperone, ER membrane protein SH3 0.004
COG5354561 COG5354, COG5354, Uncharacterized protein, contain 0.004
pfam09731 493 pfam09731, Mitofilin, Mitochondrial inner membrane 0.004
pfam10310 436 pfam10310, DUF2413, Protein of unknown function (D 0.004
>gnl|CDD|212475 cd01728, LSm1, Like-Sm protein 1 Back     alignment and domain information
 Score =  116 bits (292), Expect = 4e-34
 Identities = 42/52 (80%), Positives = 46/52 (88%)

Query: 127 RTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEV 178
           R LIG LRS DQFANLVL  T+ERI VGNQYGDIPRG+FIIRGENVVL+GE+
Sbjct: 23  RKLIGILRSFDQFANLVLEDTVERIIVGNQYGDIPRGLFIIRGENVVLLGEI 74


The eukaryotic LSm proteins (LSm1-7) assemble into a hetero-heptameric ring around the 3'-terminus of the gamma-methyl triphosphate (gamma-m-P3) capped U6 snRNA. Accumulation of uridylated RNAs in an lsm1 mutant suggests an involvement of the LSm1-7 complex in recognition of the 3' uridylation tag and recruitment of the decapping machinery. LSm1-7, together with Pat1, are also called the decapping activator. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 74

>gnl|CDD|212474 cd01727, LSm8, Like-Sm protein 8 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|201787 pfam01423, LSM, LSM domain Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|212466 cd01719, Sm_G, Sm protein G Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional Back     alignment and domain information
>gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|215521 PLN02967, PLN02967, kinase Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated Back     alignment and domain information
>gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated Back     alignment and domain information
>gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|129022 smart00786, SHR3_chaperone, ER membrane protein SH3 Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|236267 PRK08451, PRK08451, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|149343 pfam08229, SHR3_chaperone, ER membrane protein SH3 Back     alignment and domain information
>gnl|CDD|227657 COG5354, COG5354, Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein Back     alignment and domain information
>gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
cd0172981 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins 99.88
cd0172874 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins 99.87
cd0172774 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins 99.87
cd0171972 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0173276 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0171779 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0173082 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0173168 archaeal_Sm1 The archaeal sm1 proteins: The Sm pro 99.84
PRK0073772 small nuclear ribonucleoprotein; Provisional 99.83
cd0616875 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins 99.81
PF0142367 LSM: LSM domain ; InterPro: IPR001163 This family 99.8
cd0172667 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins 99.8
cd0172268 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins 99.8
smart0065167 Sm snRNP Sm proteins. small nuclear ribonucleoprot 99.8
cd0172087 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins 99.79
cd0171879 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins 99.78
COG195879 LSM1 Small nuclear ribonucleoprotein (snRNP) homol 99.77
cd0060063 Sm_like The eukaryotic Sm and Sm-like (LSm) protei 99.74
cd0172376 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins 99.74
cd0172170 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins 99.72
KOG1780|consensus77 99.72
cd0172490 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins 99.71
KOG1782|consensus129 99.68
KOG1784|consensus96 99.68
PTZ0013889 small nuclear ribonucleoprotein; Provisional 99.67
cd0173378 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins 99.67
cd0172581 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins 99.66
KOG1781|consensus108 99.64
KOG3482|consensus79 99.62
KOG3460|consensus91 99.52
KOG3168|consensus177 99.46
KOG1783|consensus77 99.44
KOG1775|consensus84 99.4
KOG3293|consensus134 99.15
KOG1774|consensus88 99.09
KOG3448|consensus96 98.88
KOG3428|consensus109 98.58
KOG3172|consensus119 98.55
KOG3459|consensus114 98.02
PF1443877 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. 97.84
cd0173966 LSm11_C The eukaryotic Sm and Sm-like (LSm) protei 97.44
PF0223748 BPL_C: Biotin protein ligase C terminal domain; In 96.87
PF1109580 Gemin7: Gem-associated protein 7 (Gemin7); InterPr 96.47
PF1270196 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC 96.29
PF11600216 CAF-1_p150: Chromatin assembly factor 1 complex p1 96.05
PF06372166 Gemin6: Gemin6 protein; InterPro: IPR009422 This f 95.84
cd0171661 Hfq Hfq, an abundant, ubiquitous RNA-binding prote 95.05
TIGR0238361 Hfq RNA chaperone Hfq. This model represents the R 94.81
PRK0039579 hfq RNA-binding protein Hfq; Provisional 94.52
cd0173674 LSm14_N LSm14 (also known as RAP55) belongs to a f 94.35
cd0173561 LSm12_N LSm12 belongs to a family of Sm-like prote 93.93
PRK14638150 hypothetical protein; Provisional 92.68
COG192377 Hfq Uncharacterized host factor I protein [General 91.76
PRK14639140 hypothetical protein; Provisional 91.69
PRK02001152 hypothetical protein; Validated 90.66
TIGR02794346 tolA_full TolA protein. TolA couples the inner mem 89.37
cd0173483 YlxS_C YxlS is a Bacillus subtilis gene of unknown 89.32
PF1084266 DUF2642: Protein of unknown function (DUF2642); In 88.96
PRK14091165 RNA-binding protein Hfq; Provisional 88.87
PRK14644136 hypothetical protein; Provisional 88.46
PRK14091165 RNA-binding protein Hfq; Provisional 88.24
PRK14640152 hypothetical protein; Provisional 87.88
PRK14633150 hypothetical protein; Provisional 87.57
PF11600216 CAF-1_p150: Chromatin assembly factor 1 complex p1 86.99
PF02576141 DUF150: Uncharacterised BCR, YhbC family COG0779; 86.5
PRK06955300 biotin--protein ligase; Provisional 86.23
PRK14636176 hypothetical protein; Provisional 86.09
PRK14642197 hypothetical protein; Provisional 85.49
PRK14632172 hypothetical protein; Provisional 85.06
PF03614165 Flag1_repress: Repressor of phase-1 flagellin; Int 84.79
PRK14645154 hypothetical protein; Provisional 84.62
PRK11886319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 84.5
TIGR00121237 birA_ligase birA, biotin-[acetyl-CoA-carboxylase] 84.15
PRK14647159 hypothetical protein; Provisional 83.0
PRK14634155 hypothetical protein; Provisional 82.34
PRK00092154 ribosome maturation protein RimP; Reviewed 82.07
PRK14646155 hypothetical protein; Provisional 82.06
KOG2412|consensus 591 81.86
PRK08330236 biotin--protein ligase; Provisional 81.3
PRK14643164 hypothetical protein; Provisional 80.89
COG0340238 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenz 80.87
COG0779153 Uncharacterized protein conserved in bacteria [Fun 80.64
PRK14631174 hypothetical protein; Provisional 80.2
>cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
Probab=99.88  E-value=1.5e-22  Score=151.38  Aligned_cols=74  Identities=26%  Similarity=0.326  Sum_probs=65.1

Q ss_pred             HHHHHHHhhcCCeEEEEecCCeEEEEEEEEecCcCceEecceEEEeecCC-c----cceeccceeeeecCcEEEEEeec
Q psy5557         106 EKKNKKAEEQNRQQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGN-Q----YGDIPRGIFIIRGENVVLMGEVV  179 (213)
Q Consensus       106 E~~~~L~~~LgKrV~V~LkDGR~~~GtL~gFDq~mNLVLsDavEri~~~n-~----~~er~LGlVlIRGnnIV~I~~iD  179 (213)
                      |....|.+++|++|+|.|+|||.|.|+|+|||+||||||++|+|+++.++ .    ...+.+|+++|||+||++|+++|
T Consensus         2 ~~~~~L~~~i~k~V~V~l~~gr~~~G~L~~~D~~mNlvL~~~~E~~~~~~~~~~~~~~~~~lG~v~iRG~nV~~i~~~~   80 (81)
T cd01729           2 ESILDLSKYVDKKIRVKFQGGREVTGILKGYDQLLNLVLDDTVEYLRDPDDPYKLTDKTRQLGLVVCRGTSVVLISPVD   80 (81)
T ss_pred             cchhhHHHhcCCeEEEEECCCcEEEEEEEEEcCcccEEecCEEEEEccCCcccccccceeEccEEEEcCCEEEEEecCC
Confidence            45677999999999999999999999999999999999999999986432 1    13567999999999999999775



Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm7 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure. Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.

>cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences Back     alignment and domain information
>PRK00737 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins Back     alignment and domain information
>cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>smart00651 Sm snRNP Sm proteins Back     alignment and domain information
>cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1780|consensus Back     alignment and domain information
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1782|consensus Back     alignment and domain information
>KOG1784|consensus Back     alignment and domain information
>PTZ00138 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1781|consensus Back     alignment and domain information
>KOG3482|consensus Back     alignment and domain information
>KOG3460|consensus Back     alignment and domain information
>KOG3168|consensus Back     alignment and domain information
>KOG1783|consensus Back     alignment and domain information
>KOG1775|consensus Back     alignment and domain information
>KOG3293|consensus Back     alignment and domain information
>KOG1774|consensus Back     alignment and domain information
>KOG3448|consensus Back     alignment and domain information
>KOG3428|consensus Back     alignment and domain information
>KOG3172|consensus Back     alignment and domain information
>KOG3459|consensus Back     alignment and domain information
>PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 Back     alignment and domain information
>cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown Back     alignment and domain information
>PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins Back     alignment and domain information
>PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A Back     alignment and domain information
>PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] Back     alignment and domain information
>PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins Back     alignment and domain information
>cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others Back     alignment and domain information
>TIGR02383 Hfq RNA chaperone Hfq Back     alignment and domain information
>PRK00395 hfq RNA-binding protein Hfq; Provisional Back     alignment and domain information
>cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PRK14638 hypothetical protein; Provisional Back     alignment and domain information
>COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] Back     alignment and domain information
>PRK14639 hypothetical protein; Provisional Back     alignment and domain information
>PRK02001 hypothetical protein; Validated Back     alignment and domain information
>TIGR02794 tolA_full TolA protein Back     alignment and domain information
>cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold Back     alignment and domain information
>PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK14644 hypothetical protein; Provisional Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK14640 hypothetical protein; Provisional Back     alignment and domain information
>PRK14633 hypothetical protein; Provisional Back     alignment and domain information
>PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] Back     alignment and domain information
>PF02576 DUF150: Uncharacterised BCR, YhbC family COG0779; InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [] Back     alignment and domain information
>PRK06955 biotin--protein ligase; Provisional Back     alignment and domain information
>PRK14636 hypothetical protein; Provisional Back     alignment and domain information
>PRK14642 hypothetical protein; Provisional Back     alignment and domain information
>PRK14632 hypothetical protein; Provisional Back     alignment and domain information
>PF03614 Flag1_repress: Repressor of phase-1 flagellin; InterPro: IPR003223 Flagellin is the subunit which polymerises to form the filaments of bacterial flagella Back     alignment and domain information
>PRK14645 hypothetical protein; Provisional Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>TIGR00121 birA_ligase birA, biotin-[acetyl-CoA-carboxylase] ligase region Back     alignment and domain information
>PRK14647 hypothetical protein; Provisional Back     alignment and domain information
>PRK14634 hypothetical protein; Provisional Back     alignment and domain information
>PRK00092 ribosome maturation protein RimP; Reviewed Back     alignment and domain information
>PRK14646 hypothetical protein; Provisional Back     alignment and domain information
>KOG2412|consensus Back     alignment and domain information
>PRK08330 biotin--protein ligase; Provisional Back     alignment and domain information
>PRK14643 hypothetical protein; Provisional Back     alignment and domain information
>COG0340 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism] Back     alignment and domain information
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14631 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-12
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 9e-12
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 6e-12
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-11
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 4e-10
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 1e-09
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 1e-09
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 9e-08
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 9e-08
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 1e-06
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 1e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 5e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 9e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-04
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-05
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 6e-06
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 7e-06
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 8e-04
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 9e-06
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 3e-05
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 3e-05
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 7e-05
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 3e-05
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 3e-05
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 1e-04
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 6e-05
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 7e-05
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 8e-05
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 1e-04
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 2e-04
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 2e-04
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 5e-04
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 5e-04
3pgw_B 231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-04
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 3e-04
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 6e-04
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
 Score = 64.7 bits (158), Expect = 2e-12
 Identities = 7/103 (6%), Positives = 27/103 (26%)

Query: 17   KRKKKKKEEENKKKQKKKEEKKQKKKEEKKQKKKEKKEEKEEKKEKKKEEKKQKKEEEKD 76
                 +  +     Q K +  +    E +  + +   +      +  +       E  + 
Sbjct: 908  YLGSNETGDSITAVQAKLKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTER 967

Query: 77   KKKEEKKQKKKEEKKQKKKEEKKQKKKKEEKKNKKAEEQNRQQ 119
            K     +Q    +   +  +     + +  +K +     +   
Sbjct: 968  KDTFFAQQWTGVKSSAETYKNTLLAELERLQKIEDLHHHHHHH 1010


>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 99.88
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 99.88
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 99.86
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 99.85
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 99.85
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 99.84
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 99.84
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 99.84
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 99.84
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 99.84
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 99.84
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 99.83
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 99.83
3pgw_B 231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 99.83
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 99.82
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 99.82
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 99.82
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 99.82
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 99.82
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 99.8
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 99.8
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 99.8
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 99.76
1m5q_A130 SMAP3, small nuclear ribonucleoprotein homolog, SM 99.74
1y96_A86 Gemin6, SIP2, GEM-associated protein 6; SM fold, p 98.87
1y96_B85 Gemin7, SIP3, GEM-associated protein 7; SM fold, p 96.25
1kq1_A77 HFQ, HOST factor for Q beta; hexamer, RNA binding 96.05
3ahu_A78 Protein HFQ; SM-like motif, protein-RNA complex, t 95.87
2vxe_A88 CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA 95.66
2qtx_A71 Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi 95.51
2y90_A104 Protein HFQ; RNA-binding protein, SM-like, RNA cha 95.49
2ylb_A74 Protein HFQ; RNA-binding protein, LSM protein, RNA 95.44
1u1s_A82 HFQ protein; SM-like bacterial protein, riken stru 95.42
2fb7_A95 SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 95.09
4a53_A125 EDC3; RNA binding protein; NMR {Schizosaccharomyce 94.7
1ycy_A71 Conserved hypothetical protein; structural genomic 94.35
3sb2_A79 Protein HFQ; SM-like, RNA chaperone, chaperone; 2. 94.22
2vc8_A84 Enhancer of mRNA-decapping protein 3; P-BODY compo 94.17
3hfn_A72 ASL2047 protein; HFQ, SM, RNA-binding protein, sRN 91.44
3hfo_A70 SSR3341 protein; HFQ, SM, RNA-binding protein, sRN 91.2
3rux_A270 BIRA bifunctional protein; biotin-protein ligase, 89.95
2eay_A233 Biotin [acetyl-COA-carboxylase] ligase; biotin bio 88.82
1bia_A321 BIRA bifunctional protein; transcription regulatio 88.19
2dxu_A235 Biotin--[acetyl-COA-carboxylase] ligase; biotin bi 85.87
2ej9_A237 Putative biotin ligase; biotin biosynthesis, monom 85.55
1ib8_A164 Conserved protein SP14.3; nucleic acid binding pro 85.47
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Back     alignment and structure
Probab=99.88  E-value=3.9e-23  Score=162.09  Aligned_cols=83  Identities=20%  Similarity=0.280  Sum_probs=57.5

Q ss_pred             hhhhHHHHHHHHhhcCCeEEEEecCCeEEEEEEEEecCcCceEecceEEEeecCC----ccceeccceeeeecCcEEEEE
Q psy5557         101 KKKKEEKKNKKAEEQNRQQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGN----QYGDIPRGIFIIRGENVVLMG  176 (213)
Q Consensus       101 ~~~keE~~~~L~~~LgKrV~V~LkDGR~~~GtL~gFDq~mNLVLsDavEri~~~n----~~~er~LGlVlIRGnnIV~I~  176 (213)
                      .+.+.+.+..|..|+|++|+|.|+|||.|.|+|+|||+||||||+||+|++..++    ....+++|++||||+||++|+
T Consensus        18 ~~~kke~i~~L~~~l~k~V~V~L~dGr~~~G~L~~fD~~mNLVL~d~~E~~~~~~~~~~~~~~r~lG~v~IRG~nIv~I~   97 (113)
T 4emk_C           18 ERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTTLVLIA   97 (113)
T ss_dssp             --------------CCSEEEEEETTSCEEEEEEEEECTTCCEEEEEEEEEC---------CCEEEEEEEEECTTTEEEEE
T ss_pred             cCCccchHHHHHHHcCCcEEEEEeCCeEEEEEEEEEcCcccEEEeeEEEEEcCCCCcccccceeEccEEEECCCeEEEEE
Confidence            3556789999999999999999999999999999999999999999999986432    134678999999999999999


Q ss_pred             eeccccc
Q psy5557         177 EVVTVVN  183 (213)
Q Consensus       177 ~iD~~~d  183 (213)
                      ++|....
T Consensus        98 ~~d~~ee  104 (113)
T 4emk_C           98 PMDGSEE  104 (113)
T ss_dssp             ECC----
T ss_pred             ecCcccc
Confidence            9986644



>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Back     alignment and structure
>1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Back     alignment and structure
>1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A Back     alignment and structure
>3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A Back     alignment and structure
>2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A Back     alignment and structure
>2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* Back     alignment and structure
>1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A Back     alignment and structure
>2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A Back     alignment and structure
>4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A Back     alignment and structure
>1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 Back     alignment and structure
>3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 Back     alignment and structure
>2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} Back     alignment and structure
>3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} Back     alignment and structure
>3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} Back     alignment and structure
>3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A Back     alignment and structure
>2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Back     alignment and structure
>2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 213
d1i8fa_71 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 3e-10
d1d3bb_81 b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa 9e-10
d1i4k1_72 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 5e-09
d1ljoa_75 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 1e-08
d1th7a176 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote 1e-08
d2fwka192 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr 1e-08
d1n9ra_68 b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S 2e-08
d1h641_71 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 1e-07
d1mgqa_74 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 2e-07
d1b34b_93 b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s 3e-05
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 Back     information, alignment and structure

class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: Archaeal homoheptameric Sm protein
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]
 Score = 52.4 bits (126), Expect = 3e-10
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 4/52 (7%)

Query: 127 RTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEV 178
             + G LRS DQ  NL+L    E I          RG  ++RGENV+ +  V
Sbjct: 23  HEIRGILRSFDQHVNLLLEDAEEIIDGNV----YKRGTMVVRGENVLFISPV 70


>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d1d3bb_81 B core SNRNP protein {Human (Homo sapiens) [TaxId: 99.85
d1i8fa_71 Archaeal homoheptameric Sm protein {Archaeon Pyrob 99.84
d1i4k1_72 Archaeal homoheptameric Sm protein {Archaeon Archa 99.84
d1h641_71 Archaeal homoheptameric Sm protein {Archaeon Pyroc 99.84
d2fwka192 U6 snRNA-associated sm-like protein LSM5 {Cryptosp 99.83
d1th7a176 Archaeal homoheptameric Sm protein {Sulfolobus sol 99.83
d1mgqa_74 Archaeal homoheptameric Sm protein {Archaeon Metha 99.82
d1n9ra_68 Small nuclear ribonucleoprotein F, Smf {Baker's ye 99.81
d1ljoa_75 Archaeal homoheptameric Sm protein {Archaeon Archa 99.81
d1b34b_93 D2 core SNRNP protein {Human (Homo sapiens) [TaxId 99.8
d1d3ba_72 D3 core SNRNP protein {Human (Homo sapiens) [TaxId 99.76
d1b34a_80 D1 core SNRNP protein {Human (Homo sapiens) [TaxId 99.67
d1m5q1_127 Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul 99.64
d1biaa247 Biotin repressor/biotin holoenzyme synthetase, C-t 96.72
d2vxfa180 LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) 95.54
d1kq1a_60 Pleiotropic translational regulator Hfq {Staphyloc 94.49
d1u1sa166 Pleiotropic translational regulator Hfq {Pseudomon 93.48
d1ycya166 Hypothetical protein PF1955 {Pyrococcus furiosus [ 93.24
d1ib8a174 Hypothetical protein SP14.3 (SP0552) {Streptococcu 90.61
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: B core SNRNP protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.85  E-value=6.1e-22  Score=144.36  Aligned_cols=69  Identities=23%  Similarity=0.295  Sum_probs=60.2

Q ss_pred             HHHhhcCCeEEEEecCCeEEEEEEEEecCcCceEecceEEEeecCC-------ccceeccceeeeecCcEEEEEee
Q psy5557         110 KKAEEQNRQQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGN-------QYGDIPRGIFIIRGENVVLMGEV  178 (213)
Q Consensus       110 ~L~~~LgKrV~V~LkDGR~~~GtL~gFDq~mNLVLsDavEri~~~n-------~~~er~LGlVlIRGnnIV~I~~i  178 (213)
                      .|.+|||++|+|.|+|||.|.|+|.|||+||||||+||.|++....       ....+.+|++||||+||++|+..
T Consensus         2 ~L~~~l~~rv~V~l~dgR~~~G~L~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~r~lG~v~IRG~~Iv~i~~~   77 (81)
T d1d3bb_           2 KMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVE   77 (81)
T ss_dssp             CCGGGTTSEEEEEETTCCEEEEEEEECCTTCCEEEEEEEEEEEECCSSTTSCCEEEEEEEEEEEECGGGEEEEEEE
T ss_pred             hhHHHCCCEEEEEEcCCCEEEEEEEEECCccCEEEcCEEEEEeecCccccccccceEEEeeeEEEeCCEEEEEEcc
Confidence            4789999999999999999999999999999999999999874322       12357899999999999999743



>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure