Psyllid ID: psy5557
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 213 | ||||||
| 125811580 | 137 | GA18077 [Drosophila pseudoobscura pseudo | 0.244 | 0.379 | 0.903 | 6e-23 | |
| 195382173 | 137 | GJ21790 [Drosophila virilis] gi|19414460 | 0.244 | 0.379 | 0.903 | 6e-23 | |
| 198437342 | 133 | PREDICTED: similar to U6 snRNA-associate | 0.309 | 0.496 | 0.727 | 1e-22 | |
| 427786347 | 135 | Putative der and-387 small nuclear ribon | 0.272 | 0.429 | 0.775 | 1e-22 | |
| 148298867 | 138 | LSM1-like protein [Bombyx mori] gi|95102 | 0.244 | 0.376 | 0.884 | 1e-22 | |
| 357609556 | 138 | LSM1-like protein [Danaus plexippus] | 0.244 | 0.376 | 0.884 | 1e-22 | |
| 346471247 | 135 | hypothetical protein [Amblyomma maculatu | 0.272 | 0.429 | 0.775 | 2e-22 | |
| 66770685 | 137 | IP04948p [Drosophila melanogaster] | 0.244 | 0.379 | 0.884 | 2e-22 | |
| 194881822 | 137 | GG20797 [Drosophila erecta] gi|190658207 | 0.244 | 0.379 | 0.884 | 2e-22 | |
| 195025615 | 137 | GH21171 [Drosophila grimshawi] gi|193902 | 0.244 | 0.379 | 0.884 | 2e-22 |
| >gi|125811580|ref|XP_001361929.1| GA18077 [Drosophila pseudoobscura pseudoobscura] gi|195170162|ref|XP_002025882.1| GL10169 [Drosophila persimilis] gi|54637105|gb|EAL26508.1| GA18077 [Drosophila pseudoobscura pseudoobscura] gi|194110746|gb|EDW32789.1| GL10169 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
Score = 113 bits (282), Expect = 6e-23, Method: Compositional matrix adjust.
Identities = 47/52 (90%), Positives = 51/52 (98%)
Query: 127 RTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEV 178
RTLIGYLRSVDQFANLVL +TIERIHVGNQYGDIPRG+FIIRGENVVL+GE+
Sbjct: 29 RTLIGYLRSVDQFANLVLQRTIERIHVGNQYGDIPRGVFIIRGENVVLLGEI 80
|
Source: Drosophila pseudoobscura pseudoobscura Species: Drosophila pseudoobscura Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195382173|ref|XP_002049805.1| GJ21790 [Drosophila virilis] gi|194144602|gb|EDW60998.1| GJ21790 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|198437342|ref|XP_002124367.1| PREDICTED: similar to U6 snRNA-associated Sm-like protein LSm1 (Cancer-associated Sm-like) (Small nuclear ribonuclear CaSm) [Ciona intestinalis] | Back alignment and taxonomy information |
|---|
| >gi|427786347|gb|JAA58625.1| Putative der and-387 small nuclear ribonucleoprotein splicing factor [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|148298867|ref|NP_001091827.1| LSM1-like protein [Bombyx mori] gi|95102704|gb|ABF51290.1| LSM1-like protein [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|357609556|gb|EHJ66513.1| LSM1-like protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|346471247|gb|AEO35468.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|66770685|gb|AAY54654.1| IP04948p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194881822|ref|XP_001975020.1| GG20797 [Drosophila erecta] gi|190658207|gb|EDV55420.1| GG20797 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195025615|ref|XP_001986091.1| GH21171 [Drosophila grimshawi] gi|193902091|gb|EDW00958.1| GH21171 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 213 | ||||||
| FB|FBgn0261067 | 137 | LSm1 [Drosophila melanogaster | 0.239 | 0.372 | 0.901 | 1.3e-20 | |
| UNIPROTKB|Q5E9Z8 | 133 | LSM1 "U6 snRNA-associated Sm-l | 0.239 | 0.383 | 0.823 | 7.2e-20 | |
| UNIPROTKB|E2R7S6 | 133 | LSM1 "Uncharacterized protein" | 0.239 | 0.383 | 0.823 | 7.2e-20 | |
| UNIPROTKB|O15116 | 133 | LSM1 "U6 snRNA-associated Sm-l | 0.239 | 0.383 | 0.823 | 7.2e-20 | |
| UNIPROTKB|I3LCU8 | 133 | LSM1 "Uncharacterized protein" | 0.239 | 0.383 | 0.823 | 7.2e-20 | |
| MGI|MGI:1914457 | 133 | Lsm1 "LSM1 homolog, U6 small n | 0.239 | 0.383 | 0.823 | 7.2e-20 | |
| RGD|1304967 | 133 | Lsm1 "LSM1 homolog, U6 small n | 0.239 | 0.383 | 0.823 | 7.2e-20 | |
| ZFIN|ZDB-GENE-040801-68 | 133 | lsm1 "LSM1 homolog, U6 small n | 0.239 | 0.383 | 0.803 | 5.1e-19 | |
| POMBASE|SPBC3D6.08c | 140 | lsm1 "mRNA decapping complex s | 0.239 | 0.364 | 0.686 | 3.8e-14 | |
| UNIPROTKB|E1C962 | 133 | E1C962 "Uncharacterized protei | 0.178 | 0.285 | 0.815 | 1.6e-13 |
| FB|FBgn0261067 LSm1 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 243 (90.6 bits), Expect = 1.3e-20, P = 1.3e-20
Identities = 46/51 (90%), Positives = 50/51 (98%)
Query: 127 RTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGE 177
RTLIGYLRSVDQFANLVL +TIERIHVGN+YGDIPRG+FIIRGENVVL+GE
Sbjct: 29 RTLIGYLRSVDQFANLVLQRTIERIHVGNEYGDIPRGVFIIRGENVVLLGE 79
|
|
| UNIPROTKB|Q5E9Z8 LSM1 "U6 snRNA-associated Sm-like protein LSm1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R7S6 LSM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O15116 LSM1 "U6 snRNA-associated Sm-like protein LSm1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LCU8 LSM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914457 Lsm1 "LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1304967 Lsm1 "LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040801-68 lsm1 "LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC3D6.08c lsm1 "mRNA decapping complex subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C962 E1C962 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 213 | |||
| cd01728 | 74 | cd01728, LSm1, Like-Sm protein 1 | 4e-34 | |
| cd01727 | 91 | cd01727, LSm8, Like-Sm protein 8 | 3e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-09 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-09 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-09 | |
| smart00651 | 67 | smart00651, Sm, snRNP Sm proteins | 4e-09 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-09 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-08 | |
| pfam01423 | 66 | pfam01423, LSM, LSM domain | 1e-08 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-08 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 3e-07 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 3e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-07 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 5e-07 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 9e-07 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-06 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-06 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 1e-06 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-06 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 1e-06 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 2e-06 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 2e-06 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-06 | |
| PRK13735 | 942 | PRK13735, PRK13735, conjugal transfer mating pair | 2e-06 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 2e-06 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-06 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 5e-06 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 5e-06 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 6e-06 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 6e-06 | |
| pfam05087 | 887 | pfam05087, Rota_VP2, Rotavirus VP2 protein | 6e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-06 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 8e-06 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 8e-06 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 9e-06 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-05 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 1e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-05 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 1e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 2e-05 | |
| pfam05087 | 887 | pfam05087, Rota_VP2, Rotavirus VP2 protein | 2e-05 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 3e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-05 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 3e-05 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 3e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-05 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 4e-05 | |
| cd01719 | 70 | cd01719, Sm_G, Sm protein G | 4e-05 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 5e-05 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 5e-05 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 5e-05 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 6e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-05 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 6e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 6e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 6e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 6e-05 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 7e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-05 | |
| PRK13735 | 942 | PRK13735, PRK13735, conjugal transfer mating pair | 8e-05 | |
| COG1958 | 79 | COG1958, LSM1, Small nuclear ribonucleoprotein (sn | 9e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 1e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 1e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 2e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 2e-04 | |
| PRK13735 | 942 | PRK13735, PRK13735, conjugal transfer mating pair | 2e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 2e-04 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 2e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 2e-04 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 2e-04 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 2e-04 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 2e-04 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 2e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 3e-04 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 3e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 3e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 3e-04 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 3e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 3e-04 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 3e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 4e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 4e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-04 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 5e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 6e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 6e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-04 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 7e-04 | |
| PRK00448 | 1437 | PRK00448, polC, DNA polymerase III PolC; Validated | 7e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 8e-04 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 8e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 8e-04 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 8e-04 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 9e-04 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 9e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 9e-04 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 9e-04 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 9e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 9e-04 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.001 | |
| PRK13735 | 942 | PRK13735, PRK13735, conjugal transfer mating pair | 0.001 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.001 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.001 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 0.001 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.001 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.001 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 0.001 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.001 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.001 | |
| PRK00448 | 1437 | PRK00448, polC, DNA polymerase III PolC; Validated | 0.001 | |
| PRK00448 | 1437 | PRK00448, polC, DNA polymerase III PolC; Validated | 0.001 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 0.001 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 0.001 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 0.001 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.001 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.001 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.001 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.001 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.001 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 0.002 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 0.002 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.002 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 0.002 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| smart00786 | 196 | smart00786, SHR3_chaperone, ER membrane protein SH | 0.002 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 0.002 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.003 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 0.003 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 0.003 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.003 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.003 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 0.003 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.003 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.003 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 0.003 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.003 | |
| PRK12705 | 508 | PRK12705, PRK12705, hypothetical protein; Provisio | 0.003 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 0.003 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 0.003 | |
| PRK08451 | 535 | PRK08451, PRK08451, DNA polymerase III subunits ga | 0.003 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 0.004 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 0.004 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.004 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.004 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.004 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.004 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.004 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 0.004 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.004 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.004 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.004 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 0.004 | |
| pfam08229 | 196 | pfam08229, SHR3_chaperone, ER membrane protein SH3 | 0.004 | |
| COG5354 | 561 | COG5354, COG5354, Uncharacterized protein, contain | 0.004 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.004 | |
| pfam10310 | 436 | pfam10310, DUF2413, Protein of unknown function (D | 0.004 |
| >gnl|CDD|212475 cd01728, LSm1, Like-Sm protein 1 | Back alignment and domain information |
|---|
Score = 116 bits (292), Expect = 4e-34
Identities = 42/52 (80%), Positives = 46/52 (88%)
Query: 127 RTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEV 178
R LIG LRS DQFANLVL T+ERI VGNQYGDIPRG+FIIRGENVVL+GE+
Sbjct: 23 RKLIGILRSFDQFANLVLEDTVERIIVGNQYGDIPRGLFIIRGENVVLLGEI 74
|
The eukaryotic LSm proteins (LSm1-7) assemble into a hetero-heptameric ring around the 3'-terminus of the gamma-methyl triphosphate (gamma-m-P3) capped U6 snRNA. Accumulation of uridylated RNAs in an lsm1 mutant suggests an involvement of the LSm1-7 complex in recognition of the 3' uridylation tag and recruitment of the decapping machinery. LSm1-7, together with Pat1, are also called the decapping activator. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 74 |
| >gnl|CDD|212474 cd01727, LSm8, Like-Sm protein 8 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201787 pfam01423, LSM, LSM domain | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|212466 cd01719, Sm_G, Sm protein G | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|129022 smart00786, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|236267 PRK08451, PRK08451, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|149343 pfam08229, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|227657 COG5354, COG5354, Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 213 | |||
| cd01729 | 81 | LSm7 The eukaryotic Sm and Sm-like (LSm) proteins | 99.88 | |
| cd01728 | 74 | LSm1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.87 | |
| cd01727 | 74 | LSm8 The eukaryotic Sm and Sm-like (LSm) proteins | 99.87 | |
| cd01719 | 72 | Sm_G The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01732 | 76 | LSm5 The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01717 | 79 | Sm_B The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01730 | 82 | LSm3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01731 | 68 | archaeal_Sm1 The archaeal sm1 proteins: The Sm pro | 99.84 | |
| PRK00737 | 72 | small nuclear ribonucleoprotein; Provisional | 99.83 | |
| cd06168 | 75 | LSm9 The eukaryotic Sm and Sm-like (LSm) proteins | 99.81 | |
| PF01423 | 67 | LSM: LSM domain ; InterPro: IPR001163 This family | 99.8 | |
| cd01726 | 67 | LSm6 The eukaryotic Sm and Sm-like (LSm) proteins | 99.8 | |
| cd01722 | 68 | Sm_F The eukaryotic Sm and Sm-like (LSm) proteins | 99.8 | |
| smart00651 | 67 | Sm snRNP Sm proteins. small nuclear ribonucleoprot | 99.8 | |
| cd01720 | 87 | Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.79 | |
| cd01718 | 79 | Sm_E The eukaryotic Sm and Sm-like (LSm) proteins | 99.78 | |
| COG1958 | 79 | LSM1 Small nuclear ribonucleoprotein (snRNP) homol | 99.77 | |
| cd00600 | 63 | Sm_like The eukaryotic Sm and Sm-like (LSm) protei | 99.74 | |
| cd01723 | 76 | LSm4 The eukaryotic Sm and Sm-like (LSm) proteins | 99.74 | |
| cd01721 | 70 | Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.72 | |
| KOG1780|consensus | 77 | 99.72 | ||
| cd01724 | 90 | Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.71 | |
| KOG1782|consensus | 129 | 99.68 | ||
| KOG1784|consensus | 96 | 99.68 | ||
| PTZ00138 | 89 | small nuclear ribonucleoprotein; Provisional | 99.67 | |
| cd01733 | 78 | LSm10 The eukaryotic Sm and Sm-like (LSm) proteins | 99.67 | |
| cd01725 | 81 | LSm2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.66 | |
| KOG1781|consensus | 108 | 99.64 | ||
| KOG3482|consensus | 79 | 99.62 | ||
| KOG3460|consensus | 91 | 99.52 | ||
| KOG3168|consensus | 177 | 99.46 | ||
| KOG1783|consensus | 77 | 99.44 | ||
| KOG1775|consensus | 84 | 99.4 | ||
| KOG3293|consensus | 134 | 99.15 | ||
| KOG1774|consensus | 88 | 99.09 | ||
| KOG3448|consensus | 96 | 98.88 | ||
| KOG3428|consensus | 109 | 98.58 | ||
| KOG3172|consensus | 119 | 98.55 | ||
| KOG3459|consensus | 114 | 98.02 | ||
| PF14438 | 77 | SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. | 97.84 | |
| cd01739 | 66 | LSm11_C The eukaryotic Sm and Sm-like (LSm) protei | 97.44 | |
| PF02237 | 48 | BPL_C: Biotin protein ligase C terminal domain; In | 96.87 | |
| PF11095 | 80 | Gemin7: Gem-associated protein 7 (Gemin7); InterPr | 96.47 | |
| PF12701 | 96 | LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC | 96.29 | |
| PF11600 | 216 | CAF-1_p150: Chromatin assembly factor 1 complex p1 | 96.05 | |
| PF06372 | 166 | Gemin6: Gemin6 protein; InterPro: IPR009422 This f | 95.84 | |
| cd01716 | 61 | Hfq Hfq, an abundant, ubiquitous RNA-binding prote | 95.05 | |
| TIGR02383 | 61 | Hfq RNA chaperone Hfq. This model represents the R | 94.81 | |
| PRK00395 | 79 | hfq RNA-binding protein Hfq; Provisional | 94.52 | |
| cd01736 | 74 | LSm14_N LSm14 (also known as RAP55) belongs to a f | 94.35 | |
| cd01735 | 61 | LSm12_N LSm12 belongs to a family of Sm-like prote | 93.93 | |
| PRK14638 | 150 | hypothetical protein; Provisional | 92.68 | |
| COG1923 | 77 | Hfq Uncharacterized host factor I protein [General | 91.76 | |
| PRK14639 | 140 | hypothetical protein; Provisional | 91.69 | |
| PRK02001 | 152 | hypothetical protein; Validated | 90.66 | |
| TIGR02794 | 346 | tolA_full TolA protein. TolA couples the inner mem | 89.37 | |
| cd01734 | 83 | YlxS_C YxlS is a Bacillus subtilis gene of unknown | 89.32 | |
| PF10842 | 66 | DUF2642: Protein of unknown function (DUF2642); In | 88.96 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 88.87 | |
| PRK14644 | 136 | hypothetical protein; Provisional | 88.46 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 88.24 | |
| PRK14640 | 152 | hypothetical protein; Provisional | 87.88 | |
| PRK14633 | 150 | hypothetical protein; Provisional | 87.57 | |
| PF11600 | 216 | CAF-1_p150: Chromatin assembly factor 1 complex p1 | 86.99 | |
| PF02576 | 141 | DUF150: Uncharacterised BCR, YhbC family COG0779; | 86.5 | |
| PRK06955 | 300 | biotin--protein ligase; Provisional | 86.23 | |
| PRK14636 | 176 | hypothetical protein; Provisional | 86.09 | |
| PRK14642 | 197 | hypothetical protein; Provisional | 85.49 | |
| PRK14632 | 172 | hypothetical protein; Provisional | 85.06 | |
| PF03614 | 165 | Flag1_repress: Repressor of phase-1 flagellin; Int | 84.79 | |
| PRK14645 | 154 | hypothetical protein; Provisional | 84.62 | |
| PRK11886 | 319 | bifunctional biotin--[acetyl-CoA-carboxylase] synt | 84.5 | |
| TIGR00121 | 237 | birA_ligase birA, biotin-[acetyl-CoA-carboxylase] | 84.15 | |
| PRK14647 | 159 | hypothetical protein; Provisional | 83.0 | |
| PRK14634 | 155 | hypothetical protein; Provisional | 82.34 | |
| PRK00092 | 154 | ribosome maturation protein RimP; Reviewed | 82.07 | |
| PRK14646 | 155 | hypothetical protein; Provisional | 82.06 | |
| KOG2412|consensus | 591 | 81.86 | ||
| PRK08330 | 236 | biotin--protein ligase; Provisional | 81.3 | |
| PRK14643 | 164 | hypothetical protein; Provisional | 80.89 | |
| COG0340 | 238 | BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenz | 80.87 | |
| COG0779 | 153 | Uncharacterized protein conserved in bacteria [Fun | 80.64 | |
| PRK14631 | 174 | hypothetical protein; Provisional | 80.2 |
| >cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
Probab=99.88 E-value=1.5e-22 Score=151.38 Aligned_cols=74 Identities=26% Similarity=0.326 Sum_probs=65.1
Q ss_pred HHHHHHHhhcCCeEEEEecCCeEEEEEEEEecCcCceEecceEEEeecCC-c----cceeccceeeeecCcEEEEEeec
Q psy5557 106 EKKNKKAEEQNRQQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGN-Q----YGDIPRGIFIIRGENVVLMGEVV 179 (213)
Q Consensus 106 E~~~~L~~~LgKrV~V~LkDGR~~~GtL~gFDq~mNLVLsDavEri~~~n-~----~~er~LGlVlIRGnnIV~I~~iD 179 (213)
|....|.+++|++|+|.|+|||.|.|+|+|||+||||||++|+|+++.++ . ...+.+|+++|||+||++|+++|
T Consensus 2 ~~~~~L~~~i~k~V~V~l~~gr~~~G~L~~~D~~mNlvL~~~~E~~~~~~~~~~~~~~~~~lG~v~iRG~nV~~i~~~~ 80 (81)
T cd01729 2 ESILDLSKYVDKKIRVKFQGGREVTGILKGYDQLLNLVLDDTVEYLRDPDDPYKLTDKTRQLGLVVCRGTSVVLISPVD 80 (81)
T ss_pred cchhhHHHhcCCeEEEEECCCcEEEEEEEEEcCcccEEecCEEEEEccCCcccccccceeEccEEEEcCCEEEEEecCC
Confidence 45677999999999999999999999999999999999999999986432 1 13567999999999999999775
|
Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm7 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure. Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes. |
| >cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences | Back alignment and domain information |
|---|
| >PRK00737 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins | Back alignment and domain information |
|---|
| >cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >smart00651 Sm snRNP Sm proteins | Back alignment and domain information |
|---|
| >cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1780|consensus | Back alignment and domain information |
|---|
| >cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1782|consensus | Back alignment and domain information |
|---|
| >KOG1784|consensus | Back alignment and domain information |
|---|
| >PTZ00138 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1781|consensus | Back alignment and domain information |
|---|
| >KOG3482|consensus | Back alignment and domain information |
|---|
| >KOG3460|consensus | Back alignment and domain information |
|---|
| >KOG3168|consensus | Back alignment and domain information |
|---|
| >KOG1783|consensus | Back alignment and domain information |
|---|
| >KOG1775|consensus | Back alignment and domain information |
|---|
| >KOG3293|consensus | Back alignment and domain information |
|---|
| >KOG1774|consensus | Back alignment and domain information |
|---|
| >KOG3448|consensus | Back alignment and domain information |
|---|
| >KOG3428|consensus | Back alignment and domain information |
|---|
| >KOG3172|consensus | Back alignment and domain information |
|---|
| >KOG3459|consensus | Back alignment and domain information |
|---|
| >PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 | Back alignment and domain information |
|---|
| >cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown | Back alignment and domain information |
|---|
| >PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins | Back alignment and domain information |
|---|
| >PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A | Back alignment and domain information |
|---|
| >PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] | Back alignment and domain information |
|---|
| >PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins | Back alignment and domain information |
|---|
| >cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others | Back alignment and domain information |
|---|
| >TIGR02383 Hfq RNA chaperone Hfq | Back alignment and domain information |
|---|
| >PRK00395 hfq RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PRK14638 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14639 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02001 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02794 tolA_full TolA protein | Back alignment and domain information |
|---|
| >cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold | Back alignment and domain information |
|---|
| >PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PRK14644 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PRK14640 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] | Back alignment and domain information |
|---|
| >PF02576 DUF150: Uncharacterised BCR, YhbC family COG0779; InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [] | Back alignment and domain information |
|---|
| >PRK06955 biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >PRK14636 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14642 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14632 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03614 Flag1_repress: Repressor of phase-1 flagellin; InterPro: IPR003223 Flagellin is the subunit which polymerises to form the filaments of bacterial flagella | Back alignment and domain information |
|---|
| >PRK14645 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional | Back alignment and domain information |
|---|
| >TIGR00121 birA_ligase birA, biotin-[acetyl-CoA-carboxylase] ligase region | Back alignment and domain information |
|---|
| >PRK14647 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14634 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00092 ribosome maturation protein RimP; Reviewed | Back alignment and domain information |
|---|
| >PRK14646 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2412|consensus | Back alignment and domain information |
|---|
| >PRK08330 biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >PRK14643 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0340 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0779 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK14631 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 213 | |||
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 2e-12 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 9e-12 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 6e-12 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 4e-10 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 1e-09 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 1e-09 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 9e-08 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 9e-08 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 1e-06 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 1e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-05 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 6e-06 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 7e-06 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 8e-04 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 9e-06 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 3e-05 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 3e-05 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 7e-05 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 3e-05 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 3e-05 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 1e-04 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 6e-05 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 7e-05 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 8e-05 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 1e-04 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 2e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 2e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 5e-04 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 5e-04 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-04 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 3e-04 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 6e-04 |
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
Score = 64.7 bits (158), Expect = 2e-12
Identities = 7/103 (6%), Positives = 27/103 (26%)
Query: 17 KRKKKKKEEENKKKQKKKEEKKQKKKEEKKQKKKEKKEEKEEKKEKKKEEKKQKKEEEKD 76
+ + Q K + + E + + + + + + E +
Sbjct: 908 YLGSNETGDSITAVQAKLKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTER 967
Query: 77 KKKEEKKQKKKEEKKQKKKEEKKQKKKKEEKKNKKAEEQNRQQ 119
K +Q + + + + + +K + +
Sbjct: 968 KDTFFAQQWTGVKSSAETYKNTLLAELERLQKIEDLHHHHHHH 1010
|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 213 | |||
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 99.88 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 99.88 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 99.86 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 99.85 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 99.85 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 99.84 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 99.84 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 99.84 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 99.84 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 99.84 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 99.84 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 99.83 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 99.83 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.83 | |
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 99.82 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 99.82 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 99.82 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 99.82 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 99.82 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 99.8 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 99.8 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 99.8 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 99.76 | |
| 1m5q_A | 130 | SMAP3, small nuclear ribonucleoprotein homolog, SM | 99.74 | |
| 1y96_A | 86 | Gemin6, SIP2, GEM-associated protein 6; SM fold, p | 98.87 | |
| 1y96_B | 85 | Gemin7, SIP3, GEM-associated protein 7; SM fold, p | 96.25 | |
| 1kq1_A | 77 | HFQ, HOST factor for Q beta; hexamer, RNA binding | 96.05 | |
| 3ahu_A | 78 | Protein HFQ; SM-like motif, protein-RNA complex, t | 95.87 | |
| 2vxe_A | 88 | CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA | 95.66 | |
| 2qtx_A | 71 | Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi | 95.51 | |
| 2y90_A | 104 | Protein HFQ; RNA-binding protein, SM-like, RNA cha | 95.49 | |
| 2ylb_A | 74 | Protein HFQ; RNA-binding protein, LSM protein, RNA | 95.44 | |
| 1u1s_A | 82 | HFQ protein; SM-like bacterial protein, riken stru | 95.42 | |
| 2fb7_A | 95 | SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 | 95.09 | |
| 4a53_A | 125 | EDC3; RNA binding protein; NMR {Schizosaccharomyce | 94.7 | |
| 1ycy_A | 71 | Conserved hypothetical protein; structural genomic | 94.35 | |
| 3sb2_A | 79 | Protein HFQ; SM-like, RNA chaperone, chaperone; 2. | 94.22 | |
| 2vc8_A | 84 | Enhancer of mRNA-decapping protein 3; P-BODY compo | 94.17 | |
| 3hfn_A | 72 | ASL2047 protein; HFQ, SM, RNA-binding protein, sRN | 91.44 | |
| 3hfo_A | 70 | SSR3341 protein; HFQ, SM, RNA-binding protein, sRN | 91.2 | |
| 3rux_A | 270 | BIRA bifunctional protein; biotin-protein ligase, | 89.95 | |
| 2eay_A | 233 | Biotin [acetyl-COA-carboxylase] ligase; biotin bio | 88.82 | |
| 1bia_A | 321 | BIRA bifunctional protein; transcription regulatio | 88.19 | |
| 2dxu_A | 235 | Biotin--[acetyl-COA-carboxylase] ligase; biotin bi | 85.87 | |
| 2ej9_A | 237 | Putative biotin ligase; biotin biosynthesis, monom | 85.55 | |
| 1ib8_A | 164 | Conserved protein SP14.3; nucleic acid binding pro | 85.47 |
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C | Back alignment and structure |
|---|
Probab=99.88 E-value=3.9e-23 Score=162.09 Aligned_cols=83 Identities=20% Similarity=0.280 Sum_probs=57.5
Q ss_pred hhhhHHHHHHHHhhcCCeEEEEecCCeEEEEEEEEecCcCceEecceEEEeecCC----ccceeccceeeeecCcEEEEE
Q psy5557 101 KKKKEEKKNKKAEEQNRQQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGN----QYGDIPRGIFIIRGENVVLMG 176 (213)
Q Consensus 101 ~~~keE~~~~L~~~LgKrV~V~LkDGR~~~GtL~gFDq~mNLVLsDavEri~~~n----~~~er~LGlVlIRGnnIV~I~ 176 (213)
.+.+.+.+..|..|+|++|+|.|+|||.|.|+|+|||+||||||+||+|++..++ ....+++|++||||+||++|+
T Consensus 18 ~~~kke~i~~L~~~l~k~V~V~L~dGr~~~G~L~~fD~~mNLVL~d~~E~~~~~~~~~~~~~~r~lG~v~IRG~nIv~I~ 97 (113)
T 4emk_C 18 ERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTTLVLIA 97 (113)
T ss_dssp --------------CCSEEEEEETTSCEEEEEEEEECTTCCEEEEEEEEEC---------CCEEEEEEEEECTTTEEEEE
T ss_pred cCCccchHHHHHHHcCCcEEEEEeCCeEEEEEEEEEcCcccEEEeeEEEEEcCCCCcccccceeEccEEEECCCeEEEEE
Confidence 3556789999999999999999999999999999999999999999999986432 134678999999999999999
Q ss_pred eeccccc
Q psy5557 177 EVVTVVN 183 (213)
Q Consensus 177 ~iD~~~d 183 (213)
++|....
T Consensus 98 ~~d~~ee 104 (113)
T 4emk_C 98 PMDGSEE 104 (113)
T ss_dssp ECC----
T ss_pred ecCcccc
Confidence 9986644
|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A | Back alignment and structure |
|---|
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B | Back alignment and structure |
|---|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D | Back alignment and structure |
|---|
| >1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A | Back alignment and structure |
|---|
| >3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A | Back alignment and structure |
|---|
| >2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A | Back alignment and structure |
|---|
| >2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* | Back alignment and structure |
|---|
| >1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A | Back alignment and structure |
|---|
| >2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A | Back alignment and structure |
|---|
| >4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A | Back alignment and structure |
|---|
| >1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 | Back alignment and structure |
|---|
| >3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 | Back alignment and structure |
|---|
| >2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} | Back alignment and structure |
|---|
| >3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} | Back alignment and structure |
|---|
| >3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A | Back alignment and structure |
|---|
| >2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* | Back alignment and structure |
|---|
| >1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* | Back alignment and structure |
|---|
| >2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... | Back alignment and structure |
|---|
| >2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 213 | ||||
| d1i8fa_ | 71 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 3e-10 | |
| d1d3bb_ | 81 | b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa | 9e-10 | |
| d1i4k1_ | 72 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 5e-09 | |
| d1ljoa_ | 75 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 1e-08 | |
| d1th7a1 | 76 | b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote | 1e-08 | |
| d2fwka1 | 92 | b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr | 1e-08 | |
| d1n9ra_ | 68 | b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S | 2e-08 | |
| d1h641_ | 71 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 1e-07 | |
| d1mgqa_ | 74 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 2e-07 | |
| d1b34b_ | 93 | b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s | 3e-05 |
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: Archaeal homoheptameric Sm protein species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]
Score = 52.4 bits (126), Expect = 3e-10
Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 4/52 (7%)
Query: 127 RTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEV 178
+ G LRS DQ NL+L E I RG ++RGENV+ + V
Sbjct: 23 HEIRGILRSFDQHVNLLLEDAEEIIDGNV----YKRGTMVVRGENVLFISPV 70
|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 | Back information, alignment and structure |
|---|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 213 | |||
| d1d3bb_ | 81 | B core SNRNP protein {Human (Homo sapiens) [TaxId: | 99.85 | |
| d1i8fa_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyrob | 99.84 | |
| d1i4k1_ | 72 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.84 | |
| d1h641_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyroc | 99.84 | |
| d2fwka1 | 92 | U6 snRNA-associated sm-like protein LSM5 {Cryptosp | 99.83 | |
| d1th7a1 | 76 | Archaeal homoheptameric Sm protein {Sulfolobus sol | 99.83 | |
| d1mgqa_ | 74 | Archaeal homoheptameric Sm protein {Archaeon Metha | 99.82 | |
| d1n9ra_ | 68 | Small nuclear ribonucleoprotein F, Smf {Baker's ye | 99.81 | |
| d1ljoa_ | 75 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.81 | |
| d1b34b_ | 93 | D2 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.8 | |
| d1d3ba_ | 72 | D3 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.76 | |
| d1b34a_ | 80 | D1 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.67 | |
| d1m5q1_ | 127 | Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul | 99.64 | |
| d1biaa2 | 47 | Biotin repressor/biotin holoenzyme synthetase, C-t | 96.72 | |
| d2vxfa1 | 80 | LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) | 95.54 | |
| d1kq1a_ | 60 | Pleiotropic translational regulator Hfq {Staphyloc | 94.49 | |
| d1u1sa1 | 66 | Pleiotropic translational regulator Hfq {Pseudomon | 93.48 | |
| d1ycya1 | 66 | Hypothetical protein PF1955 {Pyrococcus furiosus [ | 93.24 | |
| d1ib8a1 | 74 | Hypothetical protein SP14.3 (SP0552) {Streptococcu | 90.61 |
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: B core SNRNP protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.85 E-value=6.1e-22 Score=144.36 Aligned_cols=69 Identities=23% Similarity=0.295 Sum_probs=60.2
Q ss_pred HHHhhcCCeEEEEecCCeEEEEEEEEecCcCceEecceEEEeecCC-------ccceeccceeeeecCcEEEEEee
Q psy5557 110 KKAEEQNRQQGLYPNQKRTLIGYLRSVDQFANLVLHKTIERIHVGN-------QYGDIPRGIFIIRGENVVLMGEV 178 (213)
Q Consensus 110 ~L~~~LgKrV~V~LkDGR~~~GtL~gFDq~mNLVLsDavEri~~~n-------~~~er~LGlVlIRGnnIV~I~~i 178 (213)
.|.+|||++|+|.|+|||.|.|+|.|||+||||||+||.|++.... ....+.+|++||||+||++|+..
T Consensus 2 ~L~~~l~~rv~V~l~dgR~~~G~L~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~r~lG~v~IRG~~Iv~i~~~ 77 (81)
T d1d3bb_ 2 KMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVE 77 (81)
T ss_dssp CCGGGTTSEEEEEETTCCEEEEEEEECCTTCCEEEEEEEEEEEECCSSTTSCCEEEEEEEEEEEECGGGEEEEEEE
T ss_pred hhHHHCCCEEEEEEcCCCEEEEEEEEECCccCEEEcCEEEEEeecCccccccccceEEEeeeEEEeCCEEEEEEcc
Confidence 4789999999999999999999999999999999999999874322 12357899999999999999743
|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|