Psyllid ID: psy5585


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLVSK
cccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHcccccccccEEEEEc
cccccHHHccccccccccccccccccEEccHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccHHHHHcccEEEEEc
mnqvdrgnfcshnpyldapqsigykvtisaphMHAHALELLREHLENGKraldvgsgsgyLTTCMALMMGehgkavgidhipdlvnsSVKNVEKSHKALLDSGRVLLVSK
mnqvdrgnfcshnpyldaPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHkalldsgrvllvsk
MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPhmhahalellrehleNGKRALDVGSGSGYLTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLVSK
********FCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMGEHGKAVGIDHIPDLVNS***********************
MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLVS*
MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLVSK
*NQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLVSK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLVSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query110 2.2.26 [Sep-21-2011]
Q27873225 Protein-L-isoaspartate O- yes N/A 0.981 0.48 0.574 8e-32
P23506227 Protein-L-isoaspartate(D- no N/A 0.981 0.475 0.592 1e-31
P22062227 Protein-L-isoaspartate(D- yes N/A 0.981 0.475 0.592 2e-31
P15246227 Protein-L-isoaspartate(D- yes N/A 0.981 0.475 0.592 2e-31
Q92047228 Protein-L-isoaspartate(D- no N/A 0.981 0.473 0.574 3e-31
P80895227 Protein-L-isoaspartate(D- yes N/A 0.981 0.475 0.592 3e-31
Q5F3N1228 Protein-L-isoaspartate(D- no N/A 0.981 0.473 0.574 4e-31
P22061227 Protein-L-isoaspartate(D- no N/A 0.981 0.475 0.601 5e-31
Q4R5H0227 Protein-L-isoaspartate(D- N/A N/A 0.981 0.475 0.592 7e-31
Q5RA89227 Protein-L-isoaspartate(D- no N/A 0.981 0.475 0.592 7e-31
>sp|Q27873|PIMT_CAEEL Protein-L-isoaspartate O-methyltransferase OS=Caenorhabditis elegans GN=pcm-1 PE=2 SV=1 Back     alignment and function desciption
 Score =  135 bits (340), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%)

Query: 1   MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGY 60
           M  VDRG+F    PY DAPQ IGY  T+SAPHMHA AL+ L+ HL  G +ALDVGSGSGY
Sbjct: 32  MKSVDRGDFAPRAPYEDAPQRIGYNATVSAPHMHAAALDYLQNHLVAGAKALDVGSGSGY 91

Query: 61  LTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLV 108
           LT CMA+M+G +G  VGI+H+P LV  S KN+ K H   L+ G V+++
Sbjct: 92  LTVCMAMMVGRNGTVVGIEHMPQLVELSEKNIRKHHSEQLERGNVIII 139




Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. This enzyme does not act on D-aspartyl residues.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 7EC: 7
>sp|P23506|PIMT_MOUSE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Mus musculus GN=Pcmt1 PE=1 SV=3 Back     alignment and function description
>sp|P22062|PIMT_RAT Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Rattus norvegicus GN=Pcmt1 PE=1 SV=2 Back     alignment and function description
>sp|P15246|PIMT_BOVIN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2 Back     alignment and function description
>sp|Q92047|PIMT_DANRE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Danio rerio GN=pcmt PE=2 SV=3 Back     alignment and function description
>sp|P80895|PIMT_PIG Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3 Back     alignment and function description
>sp|Q5F3N1|PIMT_CHICK Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 Back     alignment and function description
>sp|Q4R5H0|PIMT_MACFA Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Macaca fascicularis GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|Q5RA89|PIMT_PONAB Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Pongo abelii GN=PCMT1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
260830152 230 hypothetical protein BRAFLDRAFT_284774 [ 0.981 0.469 0.694 7e-39
405977412 251 Protein-L-isoaspartate(D-aspartate) O-me 0.990 0.434 0.693 3e-38
427781597 232 Putative protein-l-isoaspartated-asparta 0.981 0.465 0.675 4e-38
242014348 287 protein-L-isoaspartate O-methyltransfera 0.981 0.376 0.685 9e-38
241566262 277 protein-L-isoaspartate(D-aspartate) O-me 0.981 0.389 0.657 9e-38
328711519 228 PREDICTED: protein-L-isoaspartate(D-aspa 0.972 0.469 0.691 3e-37
91081355 227 PREDICTED: similar to L-isoaspartyl prot 0.981 0.475 0.675 7e-37
291242263 299 PREDICTED: Protein-L-isoaspartate (D-asp 0.990 0.364 0.697 9e-37
443731449 267 hypothetical protein CAPTEDRAFT_159419 [ 0.981 0.404 0.690 2e-36
291222791 257 PREDICTED: Protein-L-isoaspartate (D-asp 0.990 0.424 0.651 2e-36
>gi|260830152|ref|XP_002610025.1| hypothetical protein BRAFLDRAFT_284774 [Branchiostoma floridae] gi|229295388|gb|EEN66035.1| hypothetical protein BRAFLDRAFT_284774 [Branchiostoma floridae] Back     alignment and taxonomy information
 Score =  164 bits (414), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%)

Query: 1   MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGY 60
           M QVDRGN+C  +PY+D+PQSIGY VTISAPHMHAHALE+L++HL+ G RALDVGSGSGY
Sbjct: 32  MKQVDRGNYCRFSPYMDSPQSIGYGVTISAPHMHAHALEILKDHLQEGSRALDVGSGSGY 91

Query: 61  LTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLV 108
           LT CMALM+G  GKAVGIDHI +LVN S+ NV K H  LL +G++ L+
Sbjct: 92  LTACMALMVGPTGKAVGIDHIDELVNMSIANVNKEHPQLLKTGQMKLI 139




Source: Branchiostoma floridae

Species: Branchiostoma floridae

Genus: Branchiostoma

Family: Branchiostomidae

Order:

Class:

Phylum: Chordata

Superkingdom: Eukaryota

>gi|405977412|gb|EKC41868.1| Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Crassostrea gigas] Back     alignment and taxonomy information
>gi|427781597|gb|JAA56250.1| Putative protein-l-isoaspartated-aspartate o-methyltransferase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|242014348|ref|XP_002427853.1| protein-L-isoaspartate O-methyltransferase, putative [Pediculus humanus corporis] gi|212512322|gb|EEB15115.1| protein-L-isoaspartate O-methyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|241566262|ref|XP_002402129.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative [Ixodes scapularis] gi|215499989|gb|EEC09483.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|328711519|ref|XP_001946333.2| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91081355|ref|XP_971086.1| PREDICTED: similar to L-isoaspartyl protein carboxyl methyltransferase [Tribolium castaneum] gi|270005191|gb|EFA01639.1| hypothetical protein TcasGA2_TC007209 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|291242263|ref|XP_002741028.1| PREDICTED: Protein-L-isoaspartate (D-aspartate) O-methyltransferase-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|443731449|gb|ELU16573.1| hypothetical protein CAPTEDRAFT_159419 [Capitella teleta] Back     alignment and taxonomy information
>gi|291222791|ref|XP_002731398.1| PREDICTED: Protein-L-isoaspartate (D-aspartate) O-methyltransferase-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
UNIPROTKB|E1BXJ0228 LOC423008 "Protein-L-isoaspart 0.945 0.456 0.538 2.9e-25
WB|WBGene00003954225 pcm-1 [Caenorhabditis elegans 0.981 0.48 0.490 2.6e-24
ZFIN|ZDB-GENE-040426-1738249 pcmtl "l-isoaspartyl protein c 0.981 0.433 0.537 6.8e-24
MGI|MGI:97502227 Pcmt1 "protein-L-isoaspartate 0.981 0.475 0.5 1.8e-23
RGD|3268227 Pcmt1 "protein-L-isoaspartate 0.981 0.475 0.5 1.8e-23
UNIPROTKB|P22062227 Pcmt1 "Protein-L-isoaspartate( 0.981 0.475 0.5 1.8e-23
UNIPROTKB|E2R3G3286 PCMT1 "Protein-L-isoaspartate 0.981 0.377 0.5 2.3e-23
UNIPROTKB|G3MZZ6228 PCMT1 "Protein-L-isoaspartate 0.981 0.473 0.5 3.8e-23
UNIPROTKB|P15246227 PCMT1 "Protein-L-isoaspartate( 0.981 0.475 0.5 3.8e-23
UNIPROTKB|J9JIK8208 PCMT1 "Protein-L-isoaspartate 0.981 0.519 0.5 3.8e-23
UNIPROTKB|E1BXJ0 LOC423008 "Protein-L-isoaspartate O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 287 (106.1 bits), Expect = 2.9e-25, P = 2.9e-25
 Identities = 56/104 (53%), Positives = 70/104 (67%)

Query:     5 DRGNFCSHNPYLDAPQSIGYKVTISAPXXXXXXXXXXXXXXXNGKRALDVGSGSGYLTTC 64
             DRG++  + PY+D+PQSIGYK TISAP                G +ALDVGSGSGYLT C
Sbjct:    36 DRGHYIKYFPYMDSPQSIGYKATISAPHMHAHALELLKDQLVEGAKALDVGSGSGYLTAC 95

Query:    65 MALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLV 108
              A M+G  GKAVG++HI +LVN S++NV++    LL SGRV LV
Sbjct:    96 FARMVGPTGKAVGVEHIKELVNESIRNVKEDDPTLLSSGRVKLV 139




GO:0004719 "protein-L-isoaspartate (D-aspartate) O-methyltransferase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
WB|WBGene00003954 pcm-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1738 pcmtl "l-isoaspartyl protein carboxyl methyltransferase, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:97502 Pcmt1 "protein-L-isoaspartate (D-aspartate) O-methyltransferase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3268 Pcmt1 "protein-L-isoaspartate (D-aspartate) O-methyltransferase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P22062 Pcmt1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3G3 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZZ6 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P15246 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9JIK8 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q27873PIMT_CAEEL2, ., 1, ., 1, ., 7, 70.57400.98180.48yesN/A
Q42539PIMT_ARATH2, ., 1, ., 1, ., 7, 70.60820.86360.4130yesN/A
P15246PIMT_BOVIN2, ., 1, ., 1, ., 7, 70.59250.98180.4757yesN/A
Q9URZ1PIMT_SCHPO2, ., 1, ., 1, ., 7, 70.56380.85450.4086yesN/A
P80895PIMT_PIG2, ., 1, ., 1, ., 7, 70.59250.98180.4757yesN/A
P22062PIMT_RAT2, ., 1, ., 1, ., 7, 70.59250.98180.4757yesN/A
Q27869PIMT_DROME2, ., 1, ., 1, ., 7, 70.51320.98180.4778yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!
4th Layer2.1.1.77LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 4e-39
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 4e-28
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 3e-19
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 2e-17
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 3e-10
PRK00377198 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltr 4e-09
PRK13944205 PRK13944, PRK13944, protein-L-isoaspartate O-methy 8e-09
TIGR04364 394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 5e-07
COG2264300 COG2264, PrmA, Ribosomal protein L11 methylase [Tr 7e-07
PRK08317 241 PRK08317, PRK08317, hypothetical protein; Provisio 2e-06
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 3e-06
PRK13943 322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 1e-05
TIGR00406288 TIGR00406, prmA, ribosomal protein L11 methyltrans 2e-05
pfam06325294 pfam06325, PrmA, Ribosomal protein L11 methyltrans 3e-05
PRK00517250 PRK00517, prmA, ribosomal protein L11 methyltransf 4e-05
COG2242187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 6e-05
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer 1e-04
PRK14968 188 PRK14968, PRK14968, putative methyltransferase; Pr 2e-04
COG4122219 COG4122, COG4122, Predicted O-methyltransferase [G 3e-04
PRK15068 322 PRK15068, PRK15068, tRNA mo(5)U34 methyltransferas 9e-04
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 0.001
COG2890 280 COG2890, HemK, Methylase of polypeptide chain rele 0.002
TIGR02021 219 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-m 0.002
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
 Score =  129 bits (326), Expect = 4e-39
 Identities = 53/100 (53%), Positives = 62/100 (62%), Gaps = 6/100 (6%)

Query: 1   MNQVDRGNF----CSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGS 56
           M  VDR  F         Y D P SIGY  TISAPHMHA  LELL   L+ G R L++GS
Sbjct: 25  MLAVDREEFVPESFKSYAYEDIPLSIGYGQTISAPHMHAMMLELLE--LKPGMRVLEIGS 82

Query: 57  GSGYLTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSH 96
           GSGYLT C A M+GE G  V I+HIP+LV  + +N+EK  
Sbjct: 83  GSGYLTACFARMVGEVGLVVSIEHIPELVEIARRNLEKLG 122


Length = 210

>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234740 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|140001 PRK13944, PRK13944, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|225173 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|232960 TIGR00406, prmA, ribosomal protein L11 methyltransferase Back     alignment and domain information
>gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>gnl|CDD|234786 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|226607 COG4122, COG4122, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237898 PRK15068, PRK15068, tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233687 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 110
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.79
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.78
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.77
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.76
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.76
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.63
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 99.63
KOG1661|consensus237 99.6
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.44
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.4
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.36
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.35
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.33
TIGR03533 284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.31
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone 99.31
PF01209 233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.29
COG2890 280 HemK Methylase of polypeptide chain release factor 99.29
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.29
PRK07402196 precorrin-6B methylase; Provisional 99.28
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.26
KOG2904|consensus 328 99.26
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.25
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.24
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.23
TIGR02752 231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.23
PRK11805 307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.23
PRK14966 423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.22
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.21
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.21
PLN02233 261 ubiquinone biosynthesis methyltransferase 99.21
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.2
PRK15451 247 tRNA cmo(5)U34 methyltransferase; Provisional 99.19
TIGR03704 251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.19
TIGR00536 284 hemK_fam HemK family putative methylases. The gene 99.18
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 99.16
TIGR00477 195 tehB tellurite resistance protein TehB. Part of a 99.15
PRK11207 197 tellurite resistance protein TehB; Provisional 99.15
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.15
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.14
PF08704 247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.12
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.12
TIGR00740 239 methyltransferase, putative. A simple BLAST search 99.12
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.11
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.11
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.09
PLN02781 234 Probable caffeoyl-CoA O-methyltransferase 99.09
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.08
TIGR03534 251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.08
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 99.07
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.07
COG4123 248 Predicted O-methyltransferase [General function pr 99.07
PRK05785 226 hypothetical protein; Provisional 99.07
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.06
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.06
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.06
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.05
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 99.04
TIGR00091 194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.04
TIGR02021 219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.04
PRK04266226 fibrillarin; Provisional 99.04
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 99.02
PLN02244 340 tocopherol O-methyltransferase 99.02
PF03848 192 TehB: Tellurite resistance protein TehB; InterPro: 99.02
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 99.01
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.01
PLN02585 315 magnesium protoporphyrin IX methyltransferase 99.01
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 99.01
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.0
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.0
PRK12335 287 tellurite resistance protein TehB; Provisional 98.99
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.99
PLN02476278 O-methyltransferase 98.98
PRK06202 232 hypothetical protein; Provisional 98.98
COG2227 243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.98
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.98
PRK09328 275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.97
TIGR00446 264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.97
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 98.96
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.96
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.95
TIGR03438 301 probable methyltransferase. This model represents 98.95
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 98.95
PF07021 193 MetW: Methionine biosynthesis protein MetW; InterP 98.94
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.94
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.94
KOG1541|consensus 270 98.94
PRK14902 444 16S rRNA methyltransferase B; Provisional 98.94
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.93
PRK07580 230 Mg-protoporphyrin IX methyl transferase; Validated 98.93
PRK14904 445 16S rRNA methyltransferase B; Provisional 98.93
PRK08317 241 hypothetical protein; Provisional 98.92
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 98.91
PLN02672 1082 methionine S-methyltransferase 98.91
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.91
PRK14901 434 16S rRNA methyltransferase B; Provisional 98.9
PRK10258 251 biotin biosynthesis protein BioC; Provisional 98.9
PRK14903 431 16S rRNA methyltransferase B; Provisional 98.9
KOG1270|consensus 282 98.9
COG4122219 Predicted O-methyltransferase [General function pr 98.9
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.89
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.88
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.87
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 98.87
PRK14967 223 putative methyltransferase; Provisional 98.86
PRK14968 188 putative methyltransferase; Provisional 98.86
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.86
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.86
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.85
KOG1499|consensus 346 98.85
TIGR00563 426 rsmB ribosomal RNA small subunit methyltransferase 98.85
KOG1271|consensus227 98.84
PLN02589 247 caffeoyl-CoA O-methyltransferase 98.83
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 98.83
PRK00216 239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.83
KOG3420|consensus185 98.82
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.82
PHA03411 279 putative methyltransferase; Provisional 98.81
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.81
COG4976 287 Predicted methyltransferase (contains TPR repeat) 98.81
KOG2187|consensus534 98.8
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 98.8
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 98.79
PTZ00146293 fibrillarin; Provisional 98.79
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.79
PLN02336 475 phosphoethanolamine N-methyltransferase 98.78
PHA03412 241 putative methyltransferase; Provisional 98.78
PRK10901 427 16S rRNA methyltransferase B; Provisional 98.78
PRK06922 677 hypothetical protein; Provisional 98.75
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.75
PLN02490 340 MPBQ/MSBQ methyltransferase 98.75
KOG1540|consensus 296 98.75
TIGR03840 213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.75
TIGR02081 194 metW methionine biosynthesis protein MetW. This pr 98.75
PRK11727 321 23S rRNA mA1618 methyltransferase; Provisional 98.74
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 98.74
PRK00811 283 spermidine synthase; Provisional 98.7
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.69
PRK04148134 hypothetical protein; Provisional 98.69
PRK13255 218 thiopurine S-methyltransferase; Reviewed 98.68
KOG0820|consensus 315 98.68
TIGR00452 314 methyltransferase, putative. Known examples to dat 98.67
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 98.67
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.67
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 98.66
TIGR01934 223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.65
PLN03075 296 nicotianamine synthase; Provisional 98.64
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.63
PRK04457 262 spermidine synthase; Provisional 98.63
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.62
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.61
PF13679141 Methyltransf_32: Methyltransferase domain 98.61
KOG2915|consensus 314 98.6
TIGR00438188 rrmJ cell division protein FtsJ. 98.6
KOG2899|consensus 288 98.59
PF09445 163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.59
KOG3191|consensus 209 98.59
PRK15128 396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.58
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.57
PRK05134 233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.56
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.56
PLN02336 475 phosphoethanolamine N-methyltransferase 98.54
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.54
PF02390 195 Methyltransf_4: Putative methyltransferase ; Inter 98.53
KOG3010|consensus 261 98.51
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.5
TIGR01983 224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.5
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.49
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.49
KOG1663|consensus 237 98.49
KOG1500|consensus 517 98.49
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.48
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.45
PF05724 218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.42
PLN02366 308 spermidine synthase 98.42
TIGR00417 270 speE spermidine synthase. the SpeE subunit of sper 98.4
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 98.39
PRK13256 226 thiopurine S-methyltransferase; Reviewed 98.38
PRK03612 521 spermidine synthase; Provisional 98.37
PRK01581 374 speE spermidine synthase; Validated 98.37
PF08123 205 DOT1: Histone methylation protein DOT1 ; InterPro: 98.34
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.3
COG1092 393 Predicted SAM-dependent methyltransferases [Genera 98.29
COG1041347 Predicted DNA modification methylase [DNA replicat 98.28
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 98.28
COG0220 227 Predicted S-adenosylmethionine-dependent methyltra 98.26
KOG3115|consensus 249 98.25
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.23
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.22
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.2
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 98.18
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.1
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.09
PF11599 246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 98.08
COG2520341 Predicted methyltransferase [General function pred 98.06
PF10672 286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.04
PF06080 204 DUF938: Protein of unknown function (DUF938); Inte 98.01
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.01
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.0
PLN02823 336 spermine synthase 97.98
KOG4300|consensus 252 97.98
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.91
PRK11524284 putative methyltransferase; Provisional 97.91
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.9
KOG2361|consensus 264 97.9
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.9
PF01189 283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.87
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 97.84
PHA01634156 hypothetical protein 97.82
KOG2730|consensus 263 97.81
PF05219 265 DREV: DREV methyltransferase; InterPro: IPR007884 97.78
COG4076 252 Predicted RNA methylase [General function predicti 97.77
PRK13699227 putative methylase; Provisional 97.77
PF04816 205 DUF633: Family of unknown function (DUF633) ; Inte 97.73
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 97.67
KOG1975|consensus 389 97.65
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.65
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.65
PF01564 246 Spermine_synth: Spermine/spermidine synthase; Inte 97.65
PF05971 299 Methyltransf_10: Protein of unknown function (DUF8 97.64
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 97.61
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.6
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 97.58
KOG1501|consensus 636 97.5
COG3897218 Predicted methyltransferase [General function pred 97.46
COG0286 489 HsdM Type I restriction-modification system methyl 97.45
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 97.44
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.43
COG0144 355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 97.4
COG2384 226 Predicted SAM-dependent methyltransferase [General 97.3
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.18
COG0421 282 SpeE Spermidine synthase [Amino acid transport and 97.18
PRK10611 287 chemotaxis methyltransferase CheR; Provisional 97.17
PRK10742 250 putative methyltransferase; Provisional 97.16
PRK00536 262 speE spermidine synthase; Provisional 97.14
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.13
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.09
KOG4589|consensus232 97.08
COG1352 268 CheR Methylase of chemotaxis methyl-accepting prot 97.06
COG1189 245 Predicted rRNA methylase [Translation, ribosomal s 97.05
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 96.95
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.88
PF12147 311 Methyltransf_20: Putative methyltransferase; Inter 96.85
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 96.85
KOG4058|consensus199 96.83
KOG0024|consensus 354 96.78
PF02636 252 Methyltransf_28: Putative S-adenosyl-L-methionine- 96.68
COG0500 257 SmtA SAM-dependent methyltransferases [Secondary m 96.67
KOG3987|consensus 288 96.66
PF07942 270 N2227: N2227-like protein; InterPro: IPR012901 Thi 96.46
KOG1596|consensus317 96.43
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 96.27
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 96.18
KOG2940|consensus 325 96.17
PF04989 206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 96.16
KOG1227|consensus351 96.13
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 96.09
KOG1122|consensus 460 96.03
KOG2651|consensus 476 96.03
PF05891 218 Methyltransf_PK: AdoMet dependent proline di-methy 96.0
COG2521287 Predicted archaeal methyltransferase [General func 95.92
PF05050 167 Methyltransf_21: Methyltransferase FkbM domain; In 95.9
COG4262 508 Predicted spermidine synthase with an N-terminal m 95.8
KOG2360|consensus 413 95.78
COG1565 370 Uncharacterized conserved protein [Function unknow 95.78
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 95.42
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 95.32
COG0863302 DNA modification methylase [DNA replication, recom 95.2
KOG2078|consensus 495 95.17
PF11899 380 DUF3419: Protein of unknown function (DUF3419); In 94.88
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 94.74
PF05206 259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 94.7
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 94.7
KOG2920|consensus 282 94.62
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 94.59
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 94.48
PF01861 243 DUF43: Protein of unknown function DUF43; InterPro 94.35
KOG0022|consensus 375 94.14
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 93.98
PF04672 267 Methyltransf_19: S-adenosyl methyltransferase; Int 93.87
KOG2798|consensus 369 93.85
PF02086 260 MethyltransfD12: D12 class N6 adenine-specific DNA 93.59
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 93.55
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 93.54
COG1062 366 AdhC Zn-dependent alcohol dehydrogenases, class II 93.45
KOG2793|consensus 248 93.38
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 93.04
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 92.74
KOG1098|consensus 780 92.7
KOG3178|consensus 342 92.65
KOG3924|consensus 419 92.6
PF02737 180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.5
COG4798 238 Predicted methyltransferase [General function pred 92.11
KOG2352|consensus 482 92.05
COG3129 292 Predicted SAM-dependent methyltransferase [General 91.91
PRK10458 467 DNA cytosine methylase; Provisional 91.6
cd08237 341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 91.47
PF06962 140 rRNA_methylase: Putative rRNA methylase; InterPro: 91.44
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 91.29
PLN02668 386 indole-3-acetate carboxyl methyltransferase 91.01
KOG2198|consensus 375 90.97
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 90.83
KOG3045|consensus325 90.82
TIGR00497 501 hsdM type I restriction system adenine methylase ( 90.8
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 90.73
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 90.65
PLN02740 381 Alcohol dehydrogenase-like 90.44
TIGR02818 368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 89.98
KOG1709|consensus 271 89.83
KOG2671|consensus 421 89.59
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 89.53
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 89.06
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 88.89
KOG1269|consensus 364 88.83
PF03721 185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 88.52
PF05575 286 V_cholerae_RfbT: Vibrio cholerae RfbT protein; Int 88.23
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 88.0
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.92
cd08239 339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 87.89
TIGR01202 308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 87.73
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 87.65
TIGR03451 358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 87.51
cd08281 371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 87.47
PTZ00357 1072 methyltransferase; Provisional 87.41
KOG1331|consensus 293 87.22
PF01234 256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 87.22
PLN02827 378 Alcohol dehydrogenase-like 86.71
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 86.69
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 86.26
cd08301 369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 86.23
COG5379 414 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3 86.05
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.67
COG3510 237 CmcI Cephalosporin hydroxylase [Defense mechanisms 85.41
cd08300 368 alcohol_DH_class_III class III alcohol dehydrogena 85.2
COG1568 354 Predicted methyltransferases [General function pre 85.09
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 85.08
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 85.06
KOG2782|consensus 303 85.04
KOG0821|consensus 326 85.03
KOG3201|consensus 201 84.84
cd08277 365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 84.49
PRK11730 715 fadB multifunctional fatty acid oxidation complex 84.44
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 84.38
COG4301 321 Uncharacterized conserved protein [Function unknow 84.28
PF12692160 Methyltransf_17: S-adenosyl-L-methionine methyltra 84.06
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 84.02
PF03514 374 GRAS: GRAS domain family; InterPro: IPR005202 Sequ 83.59
cd08254 338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 83.38
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 83.37
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 83.22
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 83.2
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 83.16
KOG2352|consensus 482 82.31
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 82.13
KOG1209|consensus 289 81.92
KOG2912|consensus 419 81.82
KOG1253|consensus 525 81.81
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.79
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 81.6
COG1255129 Uncharacterized protein conserved in archaea [Func 81.41
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 81.31
cd08238 410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 80.98
PRK10309 347 galactitol-1-phosphate dehydrogenase; Provisional 80.62
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 80.13
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 80.09
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 80.04
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
Probab=99.79  E-value=2.6e-19  Score=116.99  Aligned_cols=97  Identities=35%  Similarity=0.583  Sum_probs=83.9

Q ss_pred             CCcCCCCCcccC----CCCCCCCccccccceecChhhHHHHHHHHHhhcCCCCeEEEecCCcChhHHHHHHHhCCCcEEE
Q psy5585           1 MNQVDRGNFCSH----NPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMGEHGKAV   76 (110)
Q Consensus         1 ~~~~~r~~~~~~----~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vldiGcG~G~~~~~l~~~~~~~~~v~   76 (110)
                      |.++||+.|.|.    .+|.|.+++++.+..++.+.+...+++.+.  ++++++|||||||+|+.+..+++..++.++|+
T Consensus        24 ~~~VpR~~Fvp~~~~~~aY~d~~l~i~~~~~is~P~~~a~~l~~L~--l~pg~~VLeIGtGsGY~aAlla~lvg~~g~Vv  101 (209)
T PF01135_consen   24 FRAVPREDFVPPAFRDLAYEDRPLPIGCGQTISAPSMVARMLEALD--LKPGDRVLEIGTGSGYQAALLAHLVGPVGRVV  101 (209)
T ss_dssp             HHHS-GGGCSSCGGGGGTTSSS-EEEETTEEE--HHHHHHHHHHTT--C-TT-EEEEES-TTSHHHHHHHHHHSTTEEEE
T ss_pred             HHhCCHHHhCchhhhcCCCCCCCeeecceeechHHHHHHHHHHHHh--cCCCCEEEEecCCCcHHHHHHHHhcCccceEE
Confidence            568999999999    499999999999999999999999999998  89999999999999999999999998888999


Q ss_pred             EEeCCHHHHHHHHHHHHhhcccc
Q psy5585          77 GIDHIPDLVNSSVKNVEKSHKAL   99 (110)
Q Consensus        77 ~vD~s~~~~~~a~~~~~~~~~~~   99 (110)
                      ++|.++.+++.|++++...+..+
T Consensus       102 ~vE~~~~l~~~A~~~l~~~~~~n  124 (209)
T PF01135_consen  102 SVERDPELAERARRNLARLGIDN  124 (209)
T ss_dssp             EEESBHHHHHHHHHHHHHHTTHS
T ss_pred             EECccHHHHHHHHHHHHHhccCc
Confidence            99999999999999999877654



1.1.77 from EC) (PCMT) [] (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyses the transfer of a methyl group from S-adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerisation of normal L-aspartyl and L-asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process; PDB: 3LBF_A 1DL5_B 1JG3_B 1JG2_A 1JG1_A 1JG4_A 2YXE_A 2PBF_B 1VBF_C 1R18_A ....

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>KOG1501|consensus Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4058|consensus Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG3987|consensus Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>KOG1227|consensus Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>KOG2651|consensus Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG2360|consensus Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2078|consensus Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG2920|consensus Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>KOG2798|consensus Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>KOG2793|consensus Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>KOG1098|consensus Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>KOG3924|consensus Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>KOG1709|consensus Back     alignment and domain information
>KOG2671|consensus Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF05575 V_cholerae_RfbT: Vibrio cholerae RfbT protein; InterPro: IPR008890 This family consists of several RfbT proteins from Vibrio cholerae Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>COG5379 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3-carboxypropyl transferase [Lipid metabolism] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG2782|consensus Back     alignment and domain information
>KOG0821|consensus Back     alignment and domain information
>KOG3201|consensus Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12692 Methyltransf_17: S-adenosyl-L-methionine methyltransferase; PDB: 3IHT_B Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03514 GRAS: GRAS domain family; InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs [] Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>KOG2912|consensus Back     alignment and domain information
>KOG1253|consensus Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
1i1n_A226 Human Protein L-Isoaspartate O-Methyltransferase Wi 6e-24
1r18_A227 Drosophila Protein Isoaspartyl Methyltransferase Wi 7e-18
2pbf_A227 Crystal Structure Of A Putative Protein-L-Isoaspart 3e-17
2yxe_A215 Crystal Structure Of L-Isoaspartyl Protein Carboxyl 9e-06
3dh0_A 219 Crystal Structure Of A Sam Dependent Methyltransfer 8e-04
>pdb|1I1N|A Chain A, Human Protein L-Isoaspartate O-Methyltransferase With S- Adenosyl Homocysteine Length = 226 Back     alignment and structure

Iteration: 1

Score = 105 bits (262), Expect = 6e-24, Method: Compositional matrix adjust. Identities = 55/108 (50%), Positives = 66/108 (61%) Query: 1 MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPXXXXXXXXXXXXXXXNGKRALDVGSGSGY 60 M DR ++ NPY+D+PQSIG++ TISAP G +ALDVGSGSG Sbjct: 31 MLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGI 90 Query: 61 LTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLV 108 LT C A M+G GK +GIDHI +LV+ SV NV K LL SGRV LV Sbjct: 91 LTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLV 138
>pdb|1R18|A Chain A, Drosophila Protein Isoaspartyl Methyltransferase With S-Adenosyl-L- Homocysteine Length = 227 Back     alignment and structure
>pdb|2PBF|A Chain A, Crystal Structure Of A Putative Protein-L-Isoaspartate O- Methyltransferase Beta-Aspartate Methyltransferase (Pcmt) From Plasmodium Falciparum In Complex With S-Adenosyl-L-Homocysteine Length = 227 Back     alignment and structure
>pdb|2YXE|A Chain A, Crystal Structure Of L-Isoaspartyl Protein Carboxyl Methyltranferase Length = 215 Back     alignment and structure
>pdb|3DH0|A Chain A, Crystal Structure Of A Sam Dependent Methyltransferase From Aquifex Aeolicus Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 8e-50
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 5e-48
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 1e-46
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 8e-37
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 2e-36
1vbf_A 231 231AA long hypothetical protein-L-isoaspartate O- 2e-28
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 2e-27
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 1e-24
2b25_A 336 Hypothetical protein; structural genomics, methyl 5e-12
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 7e-11
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 3e-10
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 1e-09
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 3e-08
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 6e-08
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 1e-07
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 2e-07
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 2e-07
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 3e-07
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 6e-07
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 9e-07
3duw_A 223 OMT, O-methyltransferase, putative; alternating of 1e-06
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 1e-06
3c3y_A 237 Pfomt, O-methyltransferase; plant secondary metabo 1e-06
3r3h_A 242 O-methyltransferase, SAM-dependent; structural gen 2e-06
2avd_A229 Catechol-O-methyltransferase; structural genomics, 2e-06
1sui_A 247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 2e-06
3ocj_A 305 Putative exported protein; structural genomics, PS 2e-06
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 2e-06
3tfw_A 248 Putative O-methyltransferase; PSI-biology, nysgrc, 3e-06
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 3e-06
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 4e-06
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 4e-06
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 4e-06
2hnk_A 239 SAM-dependent O-methyltransferase; modified rossma 4e-06
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 8e-06
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 8e-06
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 1e-05
1ne2_A200 Hypothetical protein TA1320; structural genomics, 2e-05
1yb2_A 275 Hypothetical protein TA0852; structural genomics, 2e-05
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 3e-05
3dr5_A 221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 3e-05
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 3e-05
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 9e-05
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 1e-04
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 1e-04
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 1e-04
1xxl_A 239 YCGJ protein; structural genomics, protein structu 1e-04
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 1e-04
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 2e-04
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 2e-04
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 3e-04
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 4e-04
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 4e-04
3cc8_A 230 Putative methyltransferase; structural genomics, j 5e-04
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 6e-04
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 7e-04
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 7e-04
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 7e-04
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 8e-04
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
 Score =  156 bits (397), Expect = 8e-50
 Identities = 65/108 (60%), Positives = 78/108 (72%)

Query: 1   MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGY 60
           M   DR ++   NPY+D+PQSIG++ TISAPHMHA+ALELL + L  G +ALDVGSGSG 
Sbjct: 31  MLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGI 90

Query: 61  LTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLV 108
           LT C A M+G  GK +GIDHI +LV+ SV NV K    LL SGRV LV
Sbjct: 91  LTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLV 138


>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Length = 254 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Length = 223 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Length = 205 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Length = 237 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Length = 242 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Length = 229 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Length = 247 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Length = 248 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} Length = 225 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Length = 232 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Length = 239 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Length = 280 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Length = 232 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.73
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.69
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.68
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.61
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.6
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.58
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.54
1vbf_A 231 231AA long hypothetical protein-L-isoaspartate O- 99.5
4gek_A 261 TRNA (CMO5U34)-methyltransferase; structural genom 99.47
3mti_A 185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.38
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 99.34
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 99.34
3e05_A 204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.34
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.33
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.32
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 99.31
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.31
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 99.31
2b25_A 336 Hypothetical protein; structural genomics, methyl 99.3
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.3
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.3
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.29
3jwg_A 219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.28
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.28
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.28
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.28
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 99.28
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.26
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.26
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 99.26
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.25
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.25
1pjz_A 203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.23
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.23
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.23
1sui_A 247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.22
3dr5_A 221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.22
3dxy_A 218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.21
2hnk_A 239 SAM-dependent O-methyltransferase; modified rossma 99.21
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 99.21
2fca_A 213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.21
2b3t_A 276 Protein methyltransferase HEMK; translation termin 99.2
3c3y_A 237 Pfomt, O-methyltransferase; plant secondary metabo 99.2
3r3h_A 242 O-methyltransferase, SAM-dependent; structural gen 99.2
3duw_A 223 OMT, O-methyltransferase, putative; alternating of 99.2
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.2
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.19
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.19
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 99.18
3tfw_A 248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.18
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 99.18
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.18
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.17
1yzh_A 214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.17
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.16
3g89_A 249 Ribosomal RNA small subunit methyltransferase G; 1 99.16
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 99.16
1xdz_A 240 Methyltransferase GIDB; MCSG, protein structure in 99.16
1u2z_A 433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.16
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 99.16
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.16
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.16
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 99.15
2vdv_E 246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.15
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.15
3evz_A 230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.15
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 99.15
4dzr_A 215 Protein-(glutamine-N5) methyltransferase, release 99.14
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 99.14
2h00_A 254 Methyltransferase 10 domain containing protein; st 99.14
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.14
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.13
2gpy_A 233 O-methyltransferase; structural genomics, PSI, pro 99.13
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.13
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.13
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.13
1xxl_A 239 YCGJ protein; structural genomics, protein structu 99.12
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.12
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.12
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.12
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.12
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.12
2gb4_A 252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.12
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.11
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.11
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 99.11
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.11
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.1
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 99.1
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.1
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 99.1
3gdh_A 241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.1
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.09
3p2e_A 225 16S rRNA methylase; methyltransferase, transferase 99.09
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.09
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.08
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 99.08
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 99.08
3orh_A 236 Guanidinoacetate N-methyltransferase; structura ge 99.08
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.08
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 99.08
3hnr_A 220 Probable methyltransferase BT9727_4108; structural 99.07
3ckk_A 235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.07
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.07
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 99.07
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.07
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.07
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.07
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.06
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.06
3mq2_A 218 16S rRNA methyltransferase; methyltranferase, ribo 99.06
3k6r_A278 Putative transferase PH0793; structural genomics, 99.06
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 99.05
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 99.05
1yb2_A 275 Hypothetical protein TA0852; structural genomics, 99.05
3lpm_A 259 Putative methyltransferase; structural genomics, p 99.05
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.05
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 99.05
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 99.05
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 99.04
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.04
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.03
1zx0_A 236 Guanidinoacetate N-methyltransferase; structural g 99.03
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 99.02
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 99.02
2xvm_A 199 Tellurite resistance protein TEHB; antibiotic resi 99.02
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 99.02
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.02
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.01
3f4k_A 257 Putative methyltransferase; structural genomics, P 99.01
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 99.0
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.0
3ocj_A 305 Putative exported protein; structural genomics, PS 99.0
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 99.0
2pxx_A 215 Uncharacterized protein MGC2408; structural genomi 99.0
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.0
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.0
3m70_A 286 Tellurite resistance protein TEHB homolog; structu 98.99
2p7i_A 250 Hypothetical protein; putative methyltransferase, 98.99
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 98.99
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.99
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.99
1o9g_A 250 RRNA methyltransferase; antibiotic resistance, Se- 98.99
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 98.99
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.98
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 98.98
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.98
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.98
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.98
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.98
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.97
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.97
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.97
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 98.97
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 98.97
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 98.97
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 98.97
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.97
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 98.96
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.96
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.96
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.95
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.95
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.95
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 98.94
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.94
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.93
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.93
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.93
4dmg_A 393 Putative uncharacterized protein TTHA1493; rRNA, m 98.93
3ege_A 261 Putative methyltransferase from antibiotic biosyn 98.93
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.93
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.93
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.93
2igt_A 332 SAM dependent methyltransferase; alpha-beta sandwi 98.92
3ofk_A 216 Nodulation protein S; NODS, N-methyltransferase, S 98.92
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.92
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.92
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 98.91
3lcc_A 235 Putative methyl chloride transferase; halide methy 98.91
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 98.9
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 98.9
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 98.9
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.9
2b78_A 385 Hypothetical protein SMU.776; structure genomics, 98.9
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 98.89
2kw5_A 202 SLR1183 protein; structural genomics, northeast st 98.89
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 98.88
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.88
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.88
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.88
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protei 98.88
2r6z_A 258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.87
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.86
2ex4_A 241 Adrenal gland protein AD-003; methyltransferase, s 98.86
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.86
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 98.86
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 98.86
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 98.85
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 98.85
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.85
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 98.85
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.85
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 98.85
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.84
2pt6_A 321 Spermidine synthase; transferase, structural genom 98.84
3h2b_A 203 SAM-dependent methyltransferase; alpha-beta protei 98.84
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 98.83
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.83
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.82
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.82
1iy9_A 275 Spermidine synthase; rossmann fold, structural gen 98.82
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 98.81
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.81
2as0_A 396 Hypothetical protein PH1915; RNA methyltransferase 98.8
2i7c_A 283 Spermidine synthase; transferase, structural genom 98.8
2qm3_A 373 Predicted methyltransferase; putative methyltransf 98.8
3c0k_A 396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.8
3ou2_A 218 SAM-dependent methyltransferase; O-methyltransfera 98.79
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 98.78
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 98.78
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 98.78
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 98.77
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 98.77
2o07_A 304 Spermidine synthase; structural genomics, structur 98.77
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.76
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 98.75
1sqg_A 429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.75
1wxx_A 382 TT1595, hypothetical protein TTHA1280; thermus the 98.75
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 98.75
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.74
2qe6_A 274 Uncharacterized protein TFU_2867; putative methylt 98.73
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 98.72
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.72
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.72
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.71
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 98.71
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.71
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.7
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.69
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.69
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.69
2plw_A 201 Ribosomal RNA methyltransferase, putative; malaria 98.68
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 98.68
2zig_A297 TTHA0409, putative modification methylase; methylt 98.67
2nyu_A 196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.66
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.63
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.63
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.63
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 98.61
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 98.6
3cc8_A 230 Putative methyltransferase; structural genomics, j 98.59
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.59
2oyr_A 258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.58
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 98.56
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 98.55
3dou_A 191 Ribosomal RNA large subunit methyltransferase J; c 98.55
2cmg_A 262 Spermidine synthase; transferase, putrescine amino 98.53
3giw_A 277 Protein of unknown function DUF574; rossmann-fold 98.52
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 98.5
1vlm_A 219 SAM-dependent methyltransferase; possible histamin 98.46
3lkd_A 542 Type I restriction-modification system methyltrans 98.45
3khk_A 544 Type I restriction-modification system methylation 98.44
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 98.4
2qfm_A 364 Spermine synthase; spermidine aminopropyltransfera 98.39
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.36
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.32
2oxt_A 265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.3
3sso_A 419 Methyltransferase; macrolide, natural product, ros 98.29
2wa2_A 276 Non-structural protein 5; transferase, S-adenosyl- 98.28
3cvo_A 202 Methyltransferase-like protein of unknown functio; 98.23
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 98.23
3ufb_A 530 Type I restriction-modification system methyltran 98.22
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.15
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 98.12
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.09
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.07
4a6d_A 353 Hydroxyindole O-methyltransferase; melatonin, circ 98.06
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.04
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 98.03
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 98.01
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.0
2py6_A 409 Methyltransferase FKBM; YP_546752.1, structural ge 97.95
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.94
4fzv_A 359 Putative methyltransferase NSUN4; mterf fold, meth 97.9
3o4f_A 294 Spermidine synthase; aminopropyltransferase, polya 97.84
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 97.79
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 97.76
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 97.66
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 97.56
2qy6_A 257 UPF0209 protein YFCK; structural genomics, unknown 97.52
4auk_A 375 Ribosomal RNA large subunit methyltransferase M; Y 97.05
3p8z_A 267 Mtase, non-structural protein 5; methyltransferase 96.93
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 96.87
3gcz_A 282 Polyprotein; flavivirus, RNA capping, methyltransf 96.85
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 96.84
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 96.81
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 96.8
3c6k_A 381 Spermine synthase; spermidine aminopropyltransfera 96.72
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 96.58
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 96.37
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 95.78
2px2_A 269 Genome polyprotein [contains: capsid protein C (co 95.77
2ld4_A 176 Anamorsin; methyltransferase-like fold, alpha/beta 95.72
4f3n_A 432 Uncharacterized ACR, COG1565 superfamily; structur 95.71
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 95.68
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 95.59
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 95.37
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 95.24
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 95.16
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 94.91
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.8
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 94.75
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 94.75
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 94.66
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 94.56
3me5_A 482 Cytosine-specific methyltransferase; structural ge 94.37
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 94.17
2oo3_A 283 Protein involved in catabolism of external DNA; st 94.01
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 93.96
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 93.91
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 93.83
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 93.69
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 93.61
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 93.61
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 93.6
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.56
4dkj_A 403 Cytosine-specific methyltransferase; CG-specificit 93.45
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 93.43
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 93.42
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 93.3
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 93.25
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.2
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 93.08
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 93.03
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 93.02
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 92.91
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 92.9
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 92.85
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 92.78
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 92.76
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 92.7
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 92.4
3r24_A 344 NSP16, 2'-O-methyl transferase; methyltransferase, 92.37
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 92.23
1rjd_A 334 PPM1P, carboxy methyl transferase for protein phos 91.8
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 91.68
3gms_A 340 Putative NADPH:quinone reductase; structural genom 91.43
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 91.4
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 91.25
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 91.06
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 91.04
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 90.87
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.84
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 90.59
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 90.51
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 90.46
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 90.31
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 90.19
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 90.17
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 90.01
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 89.58
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 89.55
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 89.51
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 89.38
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 89.35
3iht_A174 S-adenosyl-L-methionine methyl transferase; YP_165 88.98
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 88.86
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 88.62
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 88.46
4eye_A 342 Probable oxidoreductase; structural genomics, niai 88.46
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 88.44
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 88.18
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.07
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 87.79
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 87.78
1lss_A140 TRK system potassium uptake protein TRKA homolog; 87.68
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 87.45
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 86.48
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 86.46
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 86.32
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 86.22
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 86.18
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 86.06
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 85.91
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 85.87
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 85.76
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 85.61
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 85.55
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 85.46
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 85.11
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 84.91
3tos_A 257 CALS11; methyltransferase, calicheamicin, structur 84.72
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 84.6
3vyw_A 308 MNMC2; tRNA wobble uridine, modification enzyme, g 84.6
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 84.19
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 84.14
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 83.99
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 83.93
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 83.78
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 83.65
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 83.39
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 83.23
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 83.09
3nx4_A 324 Putative oxidoreductase; csgid, structural genomic 82.74
4g65_A 461 TRK system potassium uptake protein TRKA; structur 82.3
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 81.75
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 81.74
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 81.5
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 81.26
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 80.65
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
Probab=99.73  E-value=5.2e-17  Score=105.56  Aligned_cols=96  Identities=50%  Similarity=0.831  Sum_probs=84.7

Q ss_pred             CCcCCCCCcccCCCCCCCCccccccceecChhhHHHHHHHHHhhcCCCCeEEEecCCcChhHHHHHHHhC----CCcEEE
Q psy5585           1 MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMG----EHGKAV   76 (110)
Q Consensus         1 ~~~~~r~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vldiGcG~G~~~~~l~~~~~----~~~~v~   76 (110)
                      |..+||+.|.|...|.+.+..++.+..++.+.+...+++.+...+.++.+|||+|||+|..+..+++..+    +.++|+
T Consensus        34 ~~~~~r~~f~p~~~y~d~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~~~VLdiG~G~G~~~~~la~~~~~~~~~~~~v~  113 (227)
T 2pbf_A           34 MLQVDRGKYIKEIPYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVI  113 (227)
T ss_dssp             HHTSCGGGTCSSSTTSSSCEEEETTEEECCHHHHHHHHHHHTTTSCTTCEEEEESCTTSHHHHHHHHHTTTTTCTTCEEE
T ss_pred             HHhCCHHHcCCcccCCCCccccCCCCccCChHHHHHHHHHHHhhCCCCCEEEEECCCCCHHHHHHHHHhcccCCCCCEEE
Confidence            4578999999999999999999999999999888888888843467788999999999999999999875    456899


Q ss_pred             EEeCCHHHHHHHHHHHHhhc
Q psy5585          77 GIDHIPDLVNSSVKNVEKSH   96 (110)
Q Consensus        77 ~vD~s~~~~~~a~~~~~~~~   96 (110)
                      ++|+++.+++.+++++...+
T Consensus       114 ~vD~~~~~~~~a~~~~~~~~  133 (227)
T 2pbf_A          114 GLERVKDLVNFSLENIKRDK  133 (227)
T ss_dssp             EEESCHHHHHHHHHHHHHHC
T ss_pred             EEeCCHHHHHHHHHHHHHcC
Confidence            99999999999999988765



>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 110
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 4e-20
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 2e-16
d2b25a1 324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 1e-11
d1i9ga_ 264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 2e-10
d1jg1a_215 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 2e-08
d1vbfa_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 3e-07
d1yb2a1 250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 3e-06
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 1e-05
d1xxla_ 234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 1e-05
d1u2za_ 406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 3e-05
d1nkva_ 245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 4e-05
d2gh1a1 281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 3e-04
d1nw3a_ 328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 5e-04
d1vl5a_ 231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 5e-04
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 9e-04
d1y8ca_ 246 c.66.1.43 (A:) Putative methyltransferase CAC2371 0.001
d1zx0a1 229 c.66.1.16 (A:8-236) Guanidinoacetate methyltransfe 0.001
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 0.002
d1xvaa_ 292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 0.002
d2p7ia1 225 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 0.002
d1ri5a_ 252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 0.003
d2avna1 246 c.66.1.41 (A:1-246) Hypothetical methyltransferase 0.004
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 79.1 bits (194), Expect = 4e-20
 Identities = 65/108 (60%), Positives = 78/108 (72%)

Query: 1   MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGY 60
           M   DR ++   NPY+D+PQSIG++ TISAPHMHA+ALELL + L  G +ALDVGSGSG 
Sbjct: 30  MLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGI 89

Query: 61  LTTCMALMMGEHGKAVGIDHIPDLVNSSVKNVEKSHKALLDSGRVLLV 108
           LT C A M+G  GK +GIDHI +LV+ SV NV K    LL SGRV LV
Sbjct: 90  LTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLV 137


>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 215 Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Length = 224 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.88
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.82
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.78
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.76
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.69
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.5
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.47
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.47
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.47
d1i9ga_ 264 Probable methyltransferase Rv2118c {Mycobacterium 99.45
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.44
d2b3ta1 274 N5-glutamine methyltransferase, HemK {Escherichia 99.44
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.43
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.42
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.41
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.4
d1pjza_ 201 Thiopurine S-methyltransferase {Pseudomonas syring 99.39
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.39
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 99.35
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.33
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.33
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 99.3
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.29
d2i6ga1 198 Putative methyltransferase TehB {Salmonella typhim 99.29
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.28
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.27
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.27
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.26
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.26
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.25
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 99.25
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.24
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.24
d1u2za_ 406 Catalytic, N-terminal domain of histone methyltran 99.23
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 99.23
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.2
d2h00a1 250 Methyltransferase 10 domain containing protein MET 99.19
d2ex4a1 222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.17
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.16
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.15
d1zx0a1 229 Guanidinoacetate methyltransferase {Human (Homo sa 99.14
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.12
d1nw3a_ 328 Catalytic, N-terminal domain of histone methyltran 99.12
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 99.1
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.09
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.08
d2fcaa1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.08
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.07
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.06
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.05
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.03
d1m6ya2 192 TM0872, methyltransferase domain {Thermotoga marit 99.03
d1yzha1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.03
d2a14a1 257 Indolethylamine N-methyltransferase, INMT {Human ( 99.02
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.02
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.99
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.98
d2as0a2 324 Hypothetical protein PH1915, middle and C-terminal 98.97
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.96
d1susa1 227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.96
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 98.95
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.94
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.9
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 98.9
d1tw3a2 253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.89
d2igta1 309 Putative methyltransferase Atu0340 {Agrobacterium 98.89
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.83
d1wxxa2 318 Hypothetical protein TTHA1280, middle and C-termin 98.82
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.81
d1vlma_ 208 Possible histamine N-methyltransferase TM1293 {The 98.8
d1qzza2 256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.79
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 98.76
d2g72a1 263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.74
d2b78a2 317 Hypothetical protein SMu776, middle and C-terminal 98.73
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.63
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 98.54
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.54
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.52
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 98.22
d2b9ea1 293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.21
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 98.17
d1wg8a2 182 TM0872, methyltransferase domain {Thermus thermoph 98.13
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 98.12
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 98.08
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 98.02
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.96
d1ixka_ 313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.95
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.92
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.84
d1inla_ 295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.83
d1sqga2 284 Ribosomal RNA small subunit methyltransferase B, R 97.81
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.75
d1iy9a_ 274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.64
d1mjfa_ 276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.57
d2b2ca1 312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.55
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.52
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.5
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 97.5
d2o07a1 285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.49
d1xdza_ 239 Glucose-inhibited division protein B (GidB) {Bacil 97.48
d1fp1d2 244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.39
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.36
d2py6a1 395 Methyltransferase FkbM {Methylobacillus flagellatu 97.24
d1fp2a2 244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.18
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.13
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.97
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.95
d2oyra1 250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 96.92
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.9
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.86
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.79
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.72
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.71
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.63
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.59
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 96.25
d1zkda1 365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 96.18
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.15
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.15
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.09
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.99
d2p41a1 257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 95.88
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 95.85
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.25
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.22
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.22
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 95.02
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.7
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.68
d2g5ca2 171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.6
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.34
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.21
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.2
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 93.46
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.46
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 93.27
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.77
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 92.45
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 90.66
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 90.45
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.07
d1e5qa1 182 Saccharopine reductase {Rice blast fungus (Magnapo 89.78
d2f1ka2 165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 89.76
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 89.76
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 89.28
d1o9ga_ 249 rRNA methyltransferase AviRa {Streptomyces viridoc 88.9
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 88.56
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 88.49
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 88.12
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 84.22
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 83.47
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 82.99
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 82.94
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 82.88
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 81.9
d1bg6a2 184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 81.63
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 81.33
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 81.23
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 80.23
d1id1a_153 Rck domain from putative potassium channel Kch {Es 80.02
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=1.7e-22  Score=130.85  Aligned_cols=107  Identities=60%  Similarity=0.953  Sum_probs=95.5

Q ss_pred             CCcCCCCCcccCCCCCCCCccccccceecChhhHHHHHHHHHhhcCCCCeEEEecCCcChhHHHHHHHhCCCcEEEEEeC
Q psy5585           1 MNQVDRGNFCSHNPYLDAPQSIGYKVTISAPHMHAHALELLREHLENGKRALDVGSGSGYLTTCMALMMGEHGKAVGIDH   80 (110)
Q Consensus         1 ~~~~~r~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vldiGcG~G~~~~~l~~~~~~~~~v~~vD~   80 (110)
                      |.++||+.|.|..+|.|.+++++.+..++.+.+...+++.+...++++.+|||+|||+|+.+..+++..++.++|+++|.
T Consensus        30 ~~~vpRe~Fvp~~aY~D~~l~i~~~~~is~P~~~a~~le~L~~~l~~g~~VLdiG~GsGy~ta~la~l~~~~g~V~~ie~  109 (224)
T d1i1na_          30 MLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDH  109 (224)
T ss_dssp             HHTSCGGGTCSSCTTSSSCEEEETTEEECCHHHHHHHHHHTTTTSCTTCEEEEETCTTSHHHHHHHHHHCTTCEEEEEES
T ss_pred             HHhCCHHHcCCcccCCCCCccccchhhhhhhHHHHHHHHHHhhccCCCCeEEEecCCCCHHHHHHHHHhCCCceEEEEcC
Confidence            56899999999999999999999999999999999999998545789999999999999999999999888889999999


Q ss_pred             CHHHHHHHHHHHHhhccccccccceee
Q psy5585          81 IPDLVNSSVKNVEKSHKALLDSGRVLL  107 (110)
Q Consensus        81 s~~~~~~a~~~~~~~~~~~~~~~~~~~  107 (110)
                      ++++++.|+++++..++.++..+.+.+
T Consensus       110 ~~~l~~~a~~~l~~~~~~~~~~~~~~~  136 (224)
T d1i1na_         110 IKELVDDSVNNVRKDDPTLLSSGRVQL  136 (224)
T ss_dssp             CHHHHHHHHHHHHHHCTHHHHTSSEEE
T ss_pred             CHHHHHHHHHhccccCcccccccceEE
Confidence            999999999999987766554444443



>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure