Psyllid ID: psy5600

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
MEASSTGDNIDENGGASSLIDSMGDHIPSLNNGVDEALFHDNNNASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSDIVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDEKKFRFQNKIEEFKDRSKRVMENIGERRVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKGKFLQAFSPPASPTRSRGRDSSSPEINYEATRFSS
ccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHccccccccHHHHHHHHHccccccEEEccccccccHHHHHHcccccEEEcccccccccccHHHHHHccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHHHHHccccHHHccccccHHHHcccccccEEcccccHHHHHHHHHHHHcccccccccEEccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccEEEEEcccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHccccccccHHHHHHHHHHHcHHHHcccccccEccHHHHHHccccEEEEccccccccccccccccccHHHHHHcccEEEEccccccccccEEEEEEEccccccccccccHHHHHHHcccEEEEEccccccHHHHHHHHHHcHHHHHHHHHcccccHcHcccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHcccEEEEEccccccHHHHHHHHHHHccccccHHHHHHHcccEEEEEcccccccccccccccccccccccccccc
measstgdnidenggasslidsmgdhipslnngvdealfhdnnnasrkvRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCsdalthrkkgrtVMNDIERYEAVRHcryvdevvrdapwetdDEFLAKHkestssisitkpapfsdepeaveERNQcnyeqrityddakqgkgkaweridfiahddipymsefgTDVYAHLKARGMFvatqrtegvstsdIVARIVRDYDIYVRRNlargytakdlnvsflNVTSRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCsdalthrkkgrtvmndekkfRFQNKIEEFKDRSKRVMENIGERRVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKgkflqafsppasptrsrgrdssspeinyeatrfss
measstgdnidengGASSLIDSMGDHIPSLNNGVDEALFHDNNNASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCsdalthrkkgrtvmndieryeavrhcryvdevvrdapWETDDEFLAkhkestssisitkpapfsdepeaVEERNQCNYEQrityddakqgkgKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVatqrtegvstsdivarivrdydiYVRRNlargytakdlnvsflnvtsRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDAlthrkkgrtvmndekkfrfqnkieefkdrskrvmenigerRVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKGKflqafsppasptrsrgrdssspeinyeatrfss
MEASSTGDNIDENGGASSLIDSMGDHIPSLNNGVDEALFHDNNNASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSDIVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDEKKFRFQNKIEEFKDRSKRVMENIGERRVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKGKFLQAFSPPASPTRSRGRDSSSPEINYEATRFSS
***********************************EALFHDNNNASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWETDD***********************************YEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSDIVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRK*******************************IGERRVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKGKFL*******************************
*************************************************RVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSDIVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDEKKFRFQNKIEEFKDRSKRVMENIGERRVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEG************************************
**********DENGGASSLIDSMGDHIPSLNNGVDEALFHDNNNASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPA**********ERNQCNYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSDIVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDEKKFRFQNKIEEFKDRSKRVMENIGERRVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKGKFLQAFS*****************INYEATRFSS
***********************GDHIPSLNNGVDEALFHDNNNASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSDIVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDEKKFRFQNKIEEFKDRSKRVMENIGERRVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKGKFLQAFSP**************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEASSTGDNIDENGGASSLIDSMGDHIPSLNNGVDEALFHDNNNASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSDIVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDEKKFRFQNKIEEFKDRSKRVMENIGERRVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKGKFLQAFSPPASPTRSRGRDSSSPEINYEATRFSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query413 2.2.26 [Sep-21-2011]
Q9Y5K3369 Choline-phosphate cytidyl no N/A 0.600 0.672 0.449 6e-76
Q9QZC4369 Choline-phosphate cytidyl yes N/A 0.595 0.666 0.455 1e-75
Q811Q9369 Choline-phosphate cytidyl yes N/A 0.595 0.666 0.455 1e-75
P49585367 Choline-phosphate cytidyl no N/A 0.569 0.640 0.413 8e-64
P19836367 Choline-phosphate cytidyl no N/A 0.569 0.640 0.413 1e-63
P49586367 Choline-phosphate cytidyl no N/A 0.569 0.640 0.413 2e-63
P49584367 Choline-phosphate cytidyl no N/A 0.569 0.640 0.410 1e-62
P49583362 Putative choline-phosphat yes N/A 0.433 0.494 0.471 2e-53
O74975362 Probable choline-phosphat yes N/A 0.433 0.494 0.466 8e-52
P13259424 Choline-phosphate cytidyl yes N/A 0.445 0.433 0.409 1e-47
>sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 Back     alignment and function desciption
 Score =  285 bits (728), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 156/347 (44%), Positives = 187/347 (53%), Gaps = 99/347 (28%)

Query: 45  ASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIER 104
           A R VRVYADGI+D+FH GH+R LMQAK +FPN YL+VGVCSD LTH+ KG TVMN+ ER
Sbjct: 73  ADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAER 132

Query: 105 YEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYE 164
           YEA+RHCRYVDEV+RDAPW    EFL KHK                              
Sbjct: 133 YEALRHCRYVDEVIRDAPWTLTPEFLEKHK------------------------------ 162

Query: 165 QRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSD 224
                             IDF+AHDDIPY S    DVY H+K  GMFV TQRTEG+STSD
Sbjct: 163 ------------------IDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSD 204

Query: 225 IVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQLMQA 284
           I+ RIVRDYD+Y RRNL RGYTAK+LNVSF+N    + +   D + +           + 
Sbjct: 205 IITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKE-----------KV 253

Query: 285 KNVFPNVYLIVGVCSDALTHRKKGRTVMNDEKKFRFQNKIEEFKDRSKRVMENIGERRVD 344
           KNV                                        ++RSK  +  + E+  D
Sbjct: 254 KNV----------------------------------------EERSKEFVNRVEEKSHD 273

Query: 345 MIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKGKFLQAFSPPASP 391
           +IQKWEEKSR+ I  FL LFG +G  K M+ E   + LQA SP  SP
Sbjct: 274 LIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSP 320
Controls phosphatidylcholine synthesis.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 1EC: 5
>sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=2 SV=1 Back     alignment and function description
>sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 Back     alignment and function description
>sp|P49585|PCY1A_HUMAN Choline-phosphate cytidylyltransferase A OS=Homo sapiens GN=PCYT1A PE=1 SV=2 Back     alignment and function description
>sp|P19836|PCY1A_RAT Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus GN=Pcyt1a PE=1 SV=2 Back     alignment and function description
>sp|P49586|PCY1A_MOUSE Choline-phosphate cytidylyltransferase A OS=Mus musculus GN=Pcyt1a PE=1 SV=1 Back     alignment and function description
>sp|P49584|PCY1A_CRIGR Choline-phosphate cytidylyltransferase A OS=Cricetulus griseus GN=PCYT1A PE=2 SV=1 Back     alignment and function description
>sp|P49583|PCY1_CAEEL Putative choline-phosphate cytidylyltransferase OS=Caenorhabditis elegans GN=F08C6.2 PE=2 SV=2 Back     alignment and function description
>sp|O74975|PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.02c PE=1 SV=3 Back     alignment and function description
>sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCT1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
383864137403 PREDICTED: choline-phosphate cytidylyltr 0.595 0.610 0.548 2e-98
350421004403 PREDICTED: choline-phosphate cytidylyltr 0.595 0.610 0.545 3e-98
340727324403 PREDICTED: choline-phosphate cytidylyltr 0.588 0.602 0.550 5e-98
380025551403 PREDICTED: choline-phosphate cytidylyltr 0.588 0.602 0.550 7e-98
66509679403 PREDICTED: choline-phosphate cytidylyltr 0.588 0.602 0.547 2e-97
307187371370 Choline-phosphate cytidylyltransferase B 0.583 0.651 0.550 2e-96
322795704415 hypothetical protein SINV_06737 [Solenop 0.583 0.580 0.547 3e-96
307196333364 Choline-phosphate cytidylyltransferase B 0.583 0.662 0.547 3e-96
332027054437 Choline-phosphate cytidylyltransferase B 0.583 0.551 0.538 9e-96
345493749373 PREDICTED: choline-phosphate cytidylyltr 0.607 0.672 0.536 2e-95
>gi|383864137|ref|XP_003707536.1| PREDICTED: choline-phosphate cytidylyltransferase B-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  365 bits (937), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 193/352 (54%), Positives = 221/352 (62%), Gaps = 106/352 (30%)

Query: 42  NNNASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMND 101
           N  A RK+RVYADGIYD+FHQGH+RQL+QAKN+FPNVYLIVGVC+D LTH KKGRTVM D
Sbjct: 107 NGKAPRKIRVYADGIYDLFHQGHARQLLQAKNIFPNVYLIVGVCNDELTHSKKGRTVMTD 166

Query: 102 IERYEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQC 161
           IERY+AVRHCRYVDEVVRDAPWE DDEFL KHK                           
Sbjct: 167 IERYDAVRHCRYVDEVVRDAPWELDDEFLTKHK--------------------------- 199

Query: 162 NYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVS 221
                                IDF+AHDDIPYM++  TDVYA LKA+GMFVATQRTEGVS
Sbjct: 200 ---------------------IDFVAHDDIPYMTDDSTDVYAALKAKGMFVATQRTEGVS 238

Query: 222 TSDIVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQL 281
           TSDIVARIV+DYDIYVRRNLARGY+AK+LNVSFL  + +K R+                 
Sbjct: 239 TSDIVARIVKDYDIYVRRNLARGYSAKELNVSFL--SEKKFRL----------------- 279

Query: 282 MQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDEKKFRFQNKIEEFKDRSKRVMENIGER 341
              +N F ++             + KG+                       RVMENIGE+
Sbjct: 280 ---QNKFDDL-------------KDKGK-----------------------RVMENIGEK 300

Query: 342 RVDMIQKWEEKSRDIIDTFLLLFGREGRLKHMWNEGKGKFLQAFSPPASPTR 393
           R+D+I KWEEKSRD ID FLLLFGREGRL  +WNE KG+ +QA SPPASP R
Sbjct: 301 RMDIISKWEEKSRDFIDAFLLLFGREGRLSTIWNESKGRLMQALSPPASPKR 352

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350421004|ref|XP_003492697.1| PREDICTED: choline-phosphate cytidylyltransferase B-like isoform 1 [Bombus impatiens] gi|350421006|ref|XP_003492698.1| PREDICTED: choline-phosphate cytidylyltransferase B-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340727324|ref|XP_003401996.1| PREDICTED: choline-phosphate cytidylyltransferase B-like isoform 1 [Bombus terrestris] gi|340727326|ref|XP_003401997.1| PREDICTED: choline-phosphate cytidylyltransferase B-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380025551|ref|XP_003696534.1| PREDICTED: choline-phosphate cytidylyltransferase B-like [Apis florea] Back     alignment and taxonomy information
>gi|66509679|ref|XP_395764.2| PREDICTED: choline-phosphate cytidylyltransferase B-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307187371|gb|EFN72494.1| Choline-phosphate cytidylyltransferase B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322795704|gb|EFZ18383.1| hypothetical protein SINV_06737 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307196333|gb|EFN77943.1| Choline-phosphate cytidylyltransferase B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332027054|gb|EGI67150.1| Choline-phosphate cytidylyltransferase B [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345493749|ref|XP_003427147.1| PREDICTED: choline-phosphate cytidylyltransferase B-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
FB|FBgn0035231381 Cct2 "CTP:phosphocholine cytid 0.215 0.233 0.775 1.8e-90
UNIPROTKB|B4E322328 PCYT1A "Choline-phosphate cyti 0.254 0.320 0.644 1.2e-85
UNIPROTKB|Q2KIR5406 PCYT1A "PCYT1A protein" [Bos t 0.213 0.216 0.738 4.1e-85
UNIPROTKB|C9JEJ2380 PCYT1A "Choline-phosphate cyti 0.213 0.231 0.738 4.1e-85
UNIPROTKB|P49585367 PCYT1A "Choline-phosphate cyti 0.213 0.239 0.738 4.1e-85
UNIPROTKB|F1SQV8368 PCYT1A "Uncharacterized protei 0.213 0.239 0.738 4.1e-85
UNIPROTKB|E1C4K8367 PCYT1A "Uncharacterized protei 0.213 0.239 0.738 6.6e-85
UNIPROTKB|E2RBM2367 PCYT1A "Uncharacterized protei 0.213 0.239 0.738 8.4e-85
RGD|70515367 Pcyt1a "phosphate cytidylyltra 0.213 0.239 0.738 1.4e-84
MGI|MGI:88557367 Pcyt1a "phosphate cytidylyltra 0.213 0.239 0.738 1.7e-84
FB|FBgn0035231 Cct2 "CTP:phosphocholine cytidylyltransferase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 386 (140.9 bits), Expect = 1.8e-90, Sum P(3) = 1.8e-90
 Identities = 69/89 (77%), Positives = 80/89 (89%)

Query:    46 SRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERY 105
             +R+VRVYADGIYD+FHQGH+RQLMQAKNVFPNVYLIVGVC+D LT R KGRTVMN  ERY
Sbjct:    76 TRRVRVYADGIYDLFHQGHARQLMQAKNVFPNVYLIVGVCNDELTLRMKGRTVMNGFERY 135

Query:   106 EAVRHCRYVDEVVRDAPWETDDEFLAKHK 134
             EAVRHCRYVDE+V +APW  ++EF+ +HK
Sbjct:   136 EAVRHCRYVDEIVPNAPWTLNEEFIEEHK 164
GO:0004105 "choline-phosphate cytidylyltransferase activity" evidence=ISS;IDA
GO:0009058 "biosynthetic process" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
UNIPROTKB|B4E322 PCYT1A "Choline-phosphate cytidylyltransferase A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIR5 PCYT1A "PCYT1A protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9JEJ2 PCYT1A "Choline-phosphate cytidylyltransferase A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P49585 PCYT1A "Choline-phosphate cytidylyltransferase A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQV8 PCYT1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4K8 PCYT1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBM2 PCYT1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|70515 Pcyt1a "phosphate cytidylyltransferase 1, choline, alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:88557 Pcyt1a "phosphate cytidylyltransferase 1, choline, alpha isoform" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.7.150.824
3rd Layer2.7.70.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
cd02174150 cd02174, CCT, CTP:phosphocholine cytidylyltransfer 3e-77
PLN02413294 PLN02413, PLN02413, choline-phosphate cytidylyltra 3e-69
PTZ00308353 PTZ00308, PTZ00308, ethanolamine-phosphate cytidyl 3e-34
COG0615140 COG0615, TagD, Cytidylyltransferase [Cell envelope 3e-34
PLN02406418 PLN02406, PLN02406, ethanolamine-phosphate cytidyl 9e-30
cd02174150 cd02174, CCT, CTP:phosphocholine cytidylyltransfer 1e-27
PLN02413 294 PLN02413, PLN02413, choline-phosphate cytidylyltra 2e-23
cd02173152 cd02173, ECT, CTP:phosphoethanolamine cytidylyltra 8e-22
TIGR0012566 TIGR00125, cyt_tran_rel, cytidyltransferase-like d 9e-18
cd02170136 cd02170, cytidylyltransferase, cytidylyltransferas 3e-16
PTZ00308353 PTZ00308, PTZ00308, ethanolamine-phosphate cytidyl 4e-16
PLN02406418 PLN02406, PLN02406, ethanolamine-phosphate cytidyl 5e-14
pfam01467148 pfam01467, CTP_transf_2, Cytidylyltransferase 5e-13
COG0615140 COG0615, TagD, Cytidylyltransferase [Cell envelope 8e-12
TIGR0012566 TIGR00125, cyt_tran_rel, cytidyltransferase-like d 2e-11
cd02171129 cd02171, G3P_Cytidylyltransferase, glycerol-3-phos 2e-09
cd02172144 cd02172, RfaE_N, N-terminal domain of RfaE 5e-08
TIGR01518125 TIGR01518, g3p_cytidyltrns, glycerol-3-phosphate c 5e-07
cd02170136 cd02170, cytidylyltransferase, cytidylyltransferas 9e-07
TIGR01518125 TIGR01518, g3p_cytidyltrns, glycerol-3-phosphate c 1e-06
PTZ00308 353 PTZ00308, PTZ00308, ethanolamine-phosphate cytidyl 2e-06
cd02171129 cd02171, G3P_Cytidylyltransferase, glycerol-3-phos 4e-06
cd02173152 cd02173, ECT, CTP:phosphoethanolamine cytidylyltra 9e-06
pfam01467148 pfam01467, CTP_transf_2, Cytidylyltransferase 2e-05
TIGR02199144 TIGR02199, rfaE_dom_II, rfaE bifunctional protein, 5e-05
TIGR02199144 TIGR02199, rfaE_dom_II, rfaE bifunctional protein, 6e-04
cd02172144 cd02172, RfaE_N, N-terminal domain of RfaE 0.001
>gnl|CDD|173925 cd02174, CCT, CTP:phosphocholine cytidylyltransferase Back     alignment and domain information 
 Score =  235 bits (603), Expect = 3e-77
 Identities = 83/198 (41%), Positives = 102/198 (51%), Gaps = 48/198 (24%)

Query: 47  RKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYE 106
           R VRVY DG +D+FH GH+  L QAK + PN YLIVGV SD   H+ KG  VM + ERYE
Sbjct: 1   RPVRVYVDGCFDLFHYGHANALRQAKKLGPNDYLIVGVHSDEEIHKHKGPPVMTEEERYE 60

Query: 107 AVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYEQR 166
           AVRHC++VDEVV  AP+ T  EFL K+K                                
Sbjct: 61  AVRHCKWVDEVVEGAPYVTTPEFLDKYK-------------------------------- 88

Query: 167 ITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSDIV 226
                            D++AH D  Y+   G D Y  +K  G F   +RTEGVST+D++
Sbjct: 89  ----------------CDYVAHGDDIYLDADGEDCYQEVKDAGRFKEVKRTEGVSTTDLI 132

Query: 227 ARIVRDYDIYVRRNLARG 244
            RI+ DY  Y RRNL RG
Sbjct: 133 GRILLDYRDYHRRNLQRG 150

CTP:phosphocholine cytidylyltransferase (CCT) catalyzes the condensation of CTP and phosphocholine to form CDP-choline as the rate-limiting and regulatory step in the CDP-choline pathway. CCT is unique in that its enzymatic activity is regulated by the extent of its association with membrane structures. A current model posts that the elastic stress of the bilayer curvature is sensed by CCT and this governs the degree of membrane association, thus providing a mechanism for both positive and negative regulation of activity. Length = 150
>gnl|CDD|215229 PLN02413, PLN02413, choline-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|140329 PTZ00308, PTZ00308, ethanolamine-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223688 COG0615, TagD, Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|215227 PLN02406, PLN02406, ethanolamine-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|173925 cd02174, CCT, CTP:phosphocholine cytidylyltransferase Back     alignment and domain information
>gnl|CDD|215229 PLN02413, PLN02413, choline-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|173924 cd02173, ECT, CTP:phosphoethanolamine cytidylyltransferase (ECT) Back     alignment and domain information
>gnl|CDD|232837 TIGR00125, cyt_tran_rel, cytidyltransferase-like domain Back     alignment and domain information
>gnl|CDD|173921 cd02170, cytidylyltransferase, cytidylyltransferase Back     alignment and domain information
>gnl|CDD|140329 PTZ00308, PTZ00308, ethanolamine-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215227 PLN02406, PLN02406, ethanolamine-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|216517 pfam01467, CTP_transf_2, Cytidylyltransferase Back     alignment and domain information
>gnl|CDD|223688 COG0615, TagD, Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|232837 TIGR00125, cyt_tran_rel, cytidyltransferase-like domain Back     alignment and domain information
>gnl|CDD|173922 cd02171, G3P_Cytidylyltransferase, glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|173923 cd02172, RfaE_N, N-terminal domain of RfaE Back     alignment and domain information
>gnl|CDD|130581 TIGR01518, g3p_cytidyltrns, glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|173921 cd02170, cytidylyltransferase, cytidylyltransferase Back     alignment and domain information
>gnl|CDD|130581 TIGR01518, g3p_cytidyltrns, glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|140329 PTZ00308, PTZ00308, ethanolamine-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|173922 cd02171, G3P_Cytidylyltransferase, glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|173924 cd02173, ECT, CTP:phosphoethanolamine cytidylyltransferase (ECT) Back     alignment and domain information
>gnl|CDD|216517 pfam01467, CTP_transf_2, Cytidylyltransferase Back     alignment and domain information
>gnl|CDD|131254 TIGR02199, rfaE_dom_II, rfaE bifunctional protein, domain II Back     alignment and domain information
>gnl|CDD|131254 TIGR02199, rfaE_dom_II, rfaE bifunctional protein, domain II Back     alignment and domain information
>gnl|CDD|173923 cd02172, RfaE_N, N-terminal domain of RfaE Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 413
KOG2804|consensus348 100.0
KOG2803|consensus358 100.0
PLN02406418 ethanolamine-phosphate cytidylyltransferase 100.0
PTZ00308353 ethanolamine-phosphate cytidylyltransferase; Provi 100.0
PLN02413294 choline-phosphate cytidylyltransferase 100.0
cd02174150 CCT CTP:phosphocholine cytidylyltransferase. CTP:p 100.0
cd02173152 ECT CTP:phosphoethanolamine cytidylyltransferase ( 100.0
PLN02406418 ethanolamine-phosphate cytidylyltransferase 100.0
PTZ00308353 ethanolamine-phosphate cytidylyltransferase; Provi 100.0
COG0615140 TagD Cytidylyltransferase [Cell envelope biogenesi 100.0
KOG2803|consensus358 99.96
COG0615140 TagD Cytidylyltransferase [Cell envelope biogenesi 99.93
cd02174150 CCT CTP:phosphocholine cytidylyltransferase. CTP:p 99.92
cd02172144 RfaE_N N-terminal domain of RfaE. RfaE is a protei 99.91
cd02170136 cytidylyltransferase cytidylyltransferase. The cyt 99.91
PLN02413 294 choline-phosphate cytidylyltransferase 99.9
TIGR02199144 rfaE_dom_II rfaE bifunctional protein, domain II. 99.89
TIGR01518125 g3p_cytidyltrns glycerol-3-phosphate cytidylyltran 99.88
cd02173152 ECT CTP:phosphoethanolamine cytidylyltransferase ( 99.88
COG2870467 RfaE ADP-heptose synthase, bifunctional sugar kina 99.87
cd02171129 G3P_Cytidylyltransferase glycerol-3-phosphate cyti 99.86
PRK11316473 bifunctional heptose 7-phosphate kinase/heptose 1- 99.86
COG2870467 RfaE ADP-heptose synthase, bifunctional sugar kina 99.82
TIGR01518125 g3p_cytidyltrns glycerol-3-phosphate cytidylyltran 99.74
TIGR02199144 rfaE_dom_II rfaE bifunctional protein, domain II. 99.74
cd02170136 cytidylyltransferase cytidylyltransferase. The cyt 99.74
PRK00777153 phosphopantetheine adenylyltransferase; Provisiona 99.72
cd02172144 RfaE_N N-terminal domain of RfaE. RfaE is a protei 99.72
PRK11316473 bifunctional heptose 7-phosphate kinase/heptose 1- 99.71
KOG2804|consensus 348 99.7
cd02171129 G3P_Cytidylyltransferase glycerol-3-phosphate cyti 99.68
PF01467157 CTP_transf_2: Cytidylyltransferase; InterPro: IPR0 99.62
PRK00777153 phosphopantetheine adenylyltransferase; Provisiona 99.61
PRK00168159 coaD phosphopantetheine adenylyltransferase; Provi 99.6
COG0669159 CoaD Phosphopantetheine adenylyltransferase [Coenz 99.58
PRK01170 322 phosphopantetheine adenylyltransferase/unknown dom 99.53
TIGR01527165 arch_NMN_Atrans nicotinamide-nucleotide adenylyltr 99.53
TIGR0012566 cyt_tran_rel cytidyltransferase-related domain. Pr 99.52
PRK01170322 phosphopantetheine adenylyltransferase/unknown dom 99.51
cd02163153 PPAT Phosphopantetheine adenylyltransferase. Phosp 99.5
PRK13964140 coaD phosphopantetheine adenylyltransferase; Provi 99.47
cd02039143 cytidylyltransferase_like Cytidylyltransferase-lik 99.43
cd02064180 FAD_synthetase_N FAD synthetase, N-terminal domain 99.43
cd02166163 NMNAT_Archaea Nicotinamide/nicotinate mononucleoti 99.37
TIGR0012566 cyt_tran_rel cytidyltransferase-related domain. Pr 99.37
TIGR01510155 coaD_prev_kdtB pantetheine-phosphate adenylyltrans 99.35
PRK05627305 bifunctional riboflavin kinase/FMN adenylyltransfe 99.3
cd02164143 PPAT_CoAS phosphopantetheine adenylyltransferase d 99.12
PRK00168159 coaD phosphopantetheine adenylyltransferase; Provi 99.08
PRK01153174 nicotinamide-nucleotide adenylyltransferase; Provi 99.08
cd02039143 cytidylyltransferase_like Cytidylyltransferase-lik 99.07
COG1019158 Predicted nucleotidyltransferase [General function 99.05
TIGR01527165 arch_NMN_Atrans nicotinamide-nucleotide adenylyltr 99.05
PF01467157 CTP_transf_2: Cytidylyltransferase; InterPro: IPR0 99.04
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 99.04
cd02168181 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide 99.01
cd02165192 NMNAT Nicotinamide/nicotinate mononucleotide adeny 98.99
PRK07143279 hypothetical protein; Provisional 98.99
PRK08887174 nicotinic acid mononucleotide adenylyltransferase; 98.98
PRK00071203 nadD nicotinic acid mononucleotide adenylyltransfe 98.97
cd02164143 PPAT_CoAS phosphopantetheine adenylyltransferase d 98.95
cd02064180 FAD_synthetase_N FAD synthetase, N-terminal domain 98.9
COG1019158 Predicted nucleotidyltransferase [General function 98.89
cd02167158 NMNAT_NadR Nicotinamide/nicotinate mononucleotide 98.87
cd02163153 PPAT Phosphopantetheine adenylyltransferase. Phosp 98.86
smart00764182 Citrate_ly_lig Citrate lyase ligase C-terminal dom 98.85
cd02166163 NMNAT_Archaea Nicotinamide/nicotinate mononucleoti 98.84
TIGR00482193 nicotinate (nicotinamide) nucleotide adenylyltrans 98.8
COG1057197 NadD Nicotinic acid mononucleotide adenylyltransfe 98.8
cd02156105 nt_trans nucleotidyl transferase superfamily. nt_t 98.79
PRK07152342 nadD putative nicotinate-nucleotide adenylyltransf 98.77
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 98.76
TIGR01510155 coaD_prev_kdtB pantetheine-phosphate adenylyltrans 98.76
PRK05627 305 bifunctional riboflavin kinase/FMN adenylyltransfe 98.74
cd02156105 nt_trans nucleotidyl transferase superfamily. nt_t 98.74
TIGR00124332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 98.72
cd02169297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 98.68
PRK06973243 nicotinic acid mononucleotide adenylyltransferase; 98.65
PLN02388177 phosphopantetheine adenylyltransferase 98.65
PLN02388177 phosphopantetheine adenylyltransferase 98.64
PRK13964140 coaD phosphopantetheine adenylyltransferase; Provi 98.6
cd02165192 NMNAT Nicotinamide/nicotinate mononucleotide adeny 98.56
PRK08099399 bifunctional DNA-binding transcriptional repressor 98.55
PRK05379 340 bifunctional nicotinamide mononucleotide adenylylt 98.5
PRK07143 279 hypothetical protein; Provisional 98.46
PRK13671298 hypothetical protein; Provisional 98.45
PRK13793196 nicotinamide-nucleotide adenylyltransferase; Provi 98.38
cd02168181 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide 98.35
PRK00071203 nadD nicotinic acid mononucleotide adenylyltransfe 98.33
cd02167158 NMNAT_NadR Nicotinamide/nicotinate mononucleotide 98.31
COG0669159 CoaD Phosphopantetheine adenylyltransferase [Coenz 98.29
COG1056172 NadR Nicotinamide mononucleotide adenylyltransfera 98.26
TIGR00083288 ribF riboflavin kinase/FMN adenylyltransferase. mu 98.2
TIGR01526 325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 98.15
KOG3351|consensus293 98.13
cd09286225 NMNAT_Eukarya Nicotinamide/nicotinate mononucleoti 98.12
KOG3351|consensus293 98.09
TIGR00482193 nicotinate (nicotinamide) nucleotide adenylyltrans 98.04
PRK08887174 nicotinic acid mononucleotide adenylyltransferase; 98.03
PRK13671 298 hypothetical protein; Provisional 98.0
PF06574157 FAD_syn: FAD synthetase; InterPro: IPR015864 Ribof 97.99
PRK01153174 nicotinamide-nucleotide adenylyltransferase; Provi 97.96
PRK06973243 nicotinic acid mononucleotide adenylyltransferase; 97.96
PRK07152 342 nadD putative nicotinate-nucleotide adenylyltransf 97.96
COG0196304 RibF FAD synthase [Coenzyme metabolism] 97.92
PLN02945236 nicotinamide-nucleotide adenylyltransferase/nicoti 97.87
PRK08099 399 bifunctional DNA-binding transcriptional repressor 97.84
COG1057197 NadD Nicotinic acid mononucleotide adenylyltransfe 97.79
PRK13793196 nicotinamide-nucleotide adenylyltransferase; Provi 97.69
PRK13670388 hypothetical protein; Provisional 97.65
TIGR00124332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 97.61
PF06574157 FAD_syn: FAD synthetase; InterPro: IPR015864 Ribof 97.42
TIGR00083 288 ribF riboflavin kinase/FMN adenylyltransferase. mu 97.32
COG1056172 NadR Nicotinamide mononucleotide adenylyltransfera 97.3
cd09286225 NMNAT_Eukarya Nicotinamide/nicotinate mononucleoti 97.24
cd02169297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 97.2
PF08218182 Citrate_ly_lig: Citrate lyase ligase C-terminal do 97.08
PLN02945236 nicotinamide-nucleotide adenylyltransferase/nicoti 97.03
smart00764182 Citrate_ly_lig Citrate lyase ligase C-terminal dom 96.87
COG1323358 Predicted nucleotidyltransferase [General function 96.83
PF05636388 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPr 96.82
PRK13670 388 hypothetical protein; Provisional 96.21
COG0196 304 RibF FAD synthase [Coenzyme metabolism] 96.17
COG3053352 CitC Citrate lyase synthetase [Energy production a 96.09
PF05636 388 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPr 95.4
PRK00380281 panC pantoate--beta-alanine ligase; Reviewed 95.29
COG1323 358 Predicted nucleotidyltransferase [General function 95.24
TIGR00018282 panC pantoate--beta-alanine ligase. This family is 94.64
PLN02660284 pantoate--beta-alanine ligase 94.04
cd00560277 PanC Pantoate-beta-alanine ligase. PanC Pantoate-b 93.06
PRK00380 281 panC pantoate--beta-alanine ligase; Reviewed 92.52
TIGR00018 282 panC pantoate--beta-alanine ligase. This family is 92.11
cd00560 277 PanC Pantoate-beta-alanine ligase. PanC Pantoate-b 91.33
KOG3199|consensus234 90.45
PLN02660 284 pantoate--beta-alanine ligase 90.12
TIGR00339383 sopT ATP sulphurylase. Members of this family also 89.66
PLN02341470 pfkB-type carbohydrate kinase family protein 89.24
PF08218182 Citrate_ly_lig: Citrate lyase ligase C-terminal do 89.12
COG0414285 PanC Panthothenate synthetase [Coenzyme metabolism 88.79
PF02569 280 Pantoate_ligase: Pantoate-beta-alanine ligase; Int 87.91
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 87.8
COG0414 285 PanC Panthothenate synthetase [Coenzyme metabolism 86.67
PF02569280 Pantoate_ligase: Pantoate-beta-alanine ligase; Int 85.86
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 83.32
KOG3042|consensus283 80.07
>KOG2804|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.6e-61  Score=466.08  Aligned_cols=257  Identities=64%  Similarity=1.027  Sum_probs=241.1

Q ss_pred             CCCCeEEEEcCccCCCChHHHHHHHHHhhcCCCCEEEEEEecCcccccCCCCCCCCHHHHHHHHHhccccCceeecCCCC
Q psy5600          45 ASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWE  124 (413)
Q Consensus        45 ~~~~~~V~~~G~FDlfH~GHi~~L~qAk~lf~gd~LIVGV~sDe~v~~~Kg~Pv~~~eER~~~V~a~r~VDeVvi~ap~~  124 (413)
                      ..|+.|||+||.|||||.||++.|+|||++||+.||||||++|+.+++.||++||+++||++.|++|||||||+.+|||.
T Consensus        60 ~~RPVRVYADGIyDLFH~GHarqL~QaK~~FPNvyLiVGvc~De~Thk~KG~TVm~e~ERyE~lrHCryVDEVi~~APW~  139 (348)
T KOG2804|consen   60 TDRPVRVYADGIYDLFHYGHARQLEQAKKLFPNVYLIVGVCSDELTHKFKGRTVMNENERYEALRHCRYVDEVIPNAPWT  139 (348)
T ss_pred             CCCceEEEccchHHHhhhhHHHHHHHHHHhCCCeEEEEeecCchhhhhccCceecChHHHHHHhhhhhhhhhhccCCCcc
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ChHHHHHHhccCCCcccccCCCCCCCChhHHHhhhccccccccccccccccCCCccceeeeeecCCCCccCccccchHHH
Q psy5600         125 TDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAH  204 (413)
Q Consensus       125 l~~dfi~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kg~~~~~~~~~~~~~~~~~~~~~~d~y~~  204 (413)
                      ++.+||++|+                                                ||||+|||+||.+++..|+|+.
T Consensus       140 lt~EFL~~HK------------------------------------------------IDfVAHDdIPY~s~gsdDiY~~  171 (348)
T KOG2804|consen  140 LTPEFLEKHK------------------------------------------------IDFVAHDDIPYVSAGSDDIYKP  171 (348)
T ss_pred             ccHHHHHhcc------------------------------------------------cceeeccCccccCCCchhHHHH
Confidence            9999999999                                                9999999999999888999999


Q ss_pred             HHhCCeEEEcCCCCCCCHHHHHHHHHhchhhhhhhhcccCCCcccccchheeeeccceEEEEccccccCChhHHHHHHHH
Q psy5600         205 LKARGMFVATQRTEGVSTSDIVARIVRDYDIYVRRNLARGYTAKDLNVSFLNVTSRKVRVYADGIYDMFHQGHSRQLMQA  284 (413)
Q Consensus       205 ~ke~Gi~v~i~RT~gVSTSdII~RI~~~~~~~~~Rn~~rg~s~k~l~v~~~~~~~~~~iV~~~G~FDl~H~GHi~~L~~A  284 (413)
                      +|++|+|+.++||+|||||+||.||+++|+.|++||++||+++++||++|++                            
T Consensus       172 vK~~G~F~~T~RTeGvSTSDiI~rIVrDYD~YvrRNL~RGys~keLnVsfl~----------------------------  223 (348)
T KOG2804|consen  172 VKEAGMFLPTQRTEGVSTSDIITRIVRDYDVYVRRNLARGYSAKELNVSFLK----------------------------  223 (348)
T ss_pred             HHHhcccccccccCCccHHHHHHHHHHhHHHHHHhhhcccCCHHhcchHHHH----------------------------
Confidence            9999999999999999999999999999999999999999999999999988                            


Q ss_pred             HhcCCCcEEEEEEcchhhhhhcCCCCCCCHHHHHHHHhhHHHHHhhhhhHHHHhccchhhhhHhHHhhchhhhccceeee
Q psy5600         285 KNVFPNVYLIVGVCSDALTHRKKGRTVMNDEKKFRFQNKIEEFKDRSKRVMENIGERRVDMIQKWEEKSRDIIDTFLLLF  364 (413)
Q Consensus       285 k~l~~gd~LIVGV~sD~~v~~~Kg~Pi~~~~eR~~~v~~i~~v~e~~k~Vd~vv~~~~~d~~~~~e~~~~Dii~~f~~~~  364 (413)
                                                    +.|+++-..|+++++.+|.+.+.+.....+++..|++.+.++|..|+.+|
T Consensus       224 ------------------------------~kk~~~~~k~~~lk~~vk~~~e~~~~~~~~l~~kW~e~s~e~i~~fle~f  273 (348)
T KOG2804|consen  224 ------------------------------EKKLRLQNKVDELKEKVKEQQEKVKEFSRDLIQKWEEKSREFIAGFLELF  273 (348)
T ss_pred             ------------------------------hHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhHHHHHHHHHHHh
Confidence                                          66777777888888888877777766677899999999999999999999


Q ss_pred             ecCCCccchhhhhHHHhhhhcCCCCCCCCCCCCC----CCCCcccee
Q psy5600         365 GREGRLKHMWNEGKGKFLQAFSPPASPTRSRGRD----SSSPEINYE  407 (413)
Q Consensus       365 G~Dw~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~  407 (413)
                      |.+..++.+|+++++++.+..|||.||+.+++..    +++++++|.
T Consensus       274 ~~~~~~n~~~~~~~~rl~~~~Sp~~sp~~~~~g~~~~~~~~~~~~~~  320 (348)
T KOG2804|consen  274 GKGGALNAFDDELKGRLLQALSPPQSPSGSTNGRDTDKSDDDSEEEF  320 (348)
T ss_pred             ccccchhhhHhHHHHHHHhhcCCCCCCCCCCCCCCCCCCCccccchh
Confidence            9999999999999999999999999996666632    567777873

>KOG2803|consensus Back     alignment and domain information
>PLN02406 ethanolamine-phosphate cytidylyltransferase Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>PLN02413 choline-phosphate cytidylyltransferase Back     alignment and domain information
>cd02174 CCT CTP:phosphocholine cytidylyltransferase Back     alignment and domain information
>cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) Back     alignment and domain information
>PLN02406 ethanolamine-phosphate cytidylyltransferase Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>KOG2803|consensus Back     alignment and domain information
>COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>cd02174 CCT CTP:phosphocholine cytidylyltransferase Back     alignment and domain information
>cd02172 RfaE_N N-terminal domain of RfaE Back     alignment and domain information
>cd02170 cytidylyltransferase cytidylyltransferase Back     alignment and domain information
>PLN02413 choline-phosphate cytidylyltransferase Back     alignment and domain information
>TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II Back     alignment and domain information
>TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02171 G3P_Cytidylyltransferase glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II Back     alignment and domain information
>cd02170 cytidylyltransferase cytidylyltransferase Back     alignment and domain information
>PRK00777 phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>cd02172 RfaE_N N-terminal domain of RfaE Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>KOG2804|consensus Back     alignment and domain information
>cd02171 G3P_Cytidylyltransferase glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>PF01467 CTP_transf_2: Cytidylyltransferase; InterPro: IPR004820 This family includes []: Cholinephosphate cytidyltransferase (P49585 from SWISSPROT) Back     alignment and domain information
>PRK00777 phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase Back     alignment and domain information
>TIGR00125 cyt_tran_rel cytidyltransferase-related domain Back     alignment and domain information
>PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd02163 PPAT Phosphopantetheine adenylyltransferase Back     alignment and domain information
>PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain Back     alignment and domain information
>cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme Back     alignment and domain information
>cd02166 NMNAT_Archaea Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal Back     alignment and domain information
>TIGR00125 cyt_tran_rel cytidyltransferase-related domain Back     alignment and domain information
>TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase, bacterial Back     alignment and domain information
>PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes Back     alignment and domain information
>PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain Back     alignment and domain information
>COG1019 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase Back     alignment and domain information
>PF01467 CTP_transf_2: Cytidylyltransferase; InterPro: IPR004820 This family includes []: Cholinephosphate cytidyltransferase (P49585 from SWISSPROT) Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd02168 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain Back     alignment and domain information
>cd02165 NMNAT Nicotinamide/nicotinate mononucleotide adenylyltransferase Back     alignment and domain information
>PRK07143 hypothetical protein; Provisional Back     alignment and domain information
>PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes Back     alignment and domain information
>cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme Back     alignment and domain information
>COG1019 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>cd02167 NMNAT_NadR Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins Back     alignment and domain information
>cd02163 PPAT Phosphopantetheine adenylyltransferase Back     alignment and domain information
>smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>cd02166 NMNAT_Archaea Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal Back     alignment and domain information
>TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase Back     alignment and domain information
>COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd02156 nt_trans nucleotidyl transferase superfamily Back     alignment and domain information
>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase, bacterial Back     alignment and domain information
>PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>cd02156 nt_trans nucleotidyl transferase superfamily Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PLN02388 phosphopantetheine adenylyltransferase Back     alignment and domain information
>PLN02388 phosphopantetheine adenylyltransferase Back     alignment and domain information
>PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>cd02165 NMNAT Nicotinamide/nicotinate mononucleotide adenylyltransferase Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>PRK07143 hypothetical protein; Provisional Back     alignment and domain information
>PRK13671 hypothetical protein; Provisional Back     alignment and domain information
>PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02168 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain Back     alignment and domain information
>PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02167 NMNAT_NadR Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins Back     alignment and domain information
>COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>KOG3351|consensus Back     alignment and domain information
>cd09286 NMNAT_Eukarya Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic Back     alignment and domain information
>KOG3351|consensus Back     alignment and domain information
>TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase Back     alignment and domain information
>PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK13671 hypothetical protein; Provisional Back     alignment and domain information
>PF06574 FAD_syn: FAD synthetase; InterPro: IPR015864 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 Back     alignment and domain information
>PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>COG0196 RibF FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PLN02945 nicotinamide-nucleotide adenylyltransferase/nicotinate-nucleotide adenylyltransferase Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK13670 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>PF06574 FAD_syn: FAD synthetase; InterPro: IPR015864 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 Back     alignment and domain information
>TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase Back     alignment and domain information
>COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd09286 NMNAT_Eukarya Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PF08218 Citrate_ly_lig: Citrate lyase ligase C-terminal domain; InterPro: IPR013166 [Citrate (pro-3S)-lyase] ligase (6 Back     alignment and domain information
>PLN02945 nicotinamide-nucleotide adenylyltransferase/nicotinate-nucleotide adenylyltransferase Back     alignment and domain information
>smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>COG1323 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PF05636 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPro: IPR008513 This family consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK13670 hypothetical protein; Provisional Back     alignment and domain information
>COG0196 RibF FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>PF05636 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPro: IPR008513 This family consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK00380 panC pantoate--beta-alanine ligase; Reviewed Back     alignment and domain information
>COG1323 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00018 panC pantoate--beta-alanine ligase Back     alignment and domain information
>PLN02660 pantoate--beta-alanine ligase Back     alignment and domain information
>cd00560 PanC Pantoate-beta-alanine ligase Back     alignment and domain information
>PRK00380 panC pantoate--beta-alanine ligase; Reviewed Back     alignment and domain information
>TIGR00018 panC pantoate--beta-alanine ligase Back     alignment and domain information
>cd00560 PanC Pantoate-beta-alanine ligase Back     alignment and domain information
>KOG3199|consensus Back     alignment and domain information
>PLN02660 pantoate--beta-alanine ligase Back     alignment and domain information
>TIGR00339 sopT ATP sulphurylase Back     alignment and domain information
>PLN02341 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PF08218 Citrate_ly_lig: Citrate lyase ligase C-terminal domain; InterPro: IPR013166 [Citrate (pro-3S)-lyase] ligase (6 Back     alignment and domain information
>COG0414 PanC Panthothenate synthetase [Coenzyme metabolism] Back     alignment and domain information
>PF02569 Pantoate_ligase: Pantoate-beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis [] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>COG0414 PanC Panthothenate synthetase [Coenzyme metabolism] Back     alignment and domain information
>PF02569 Pantoate_ligase: Pantoate-beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis [] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>KOG3042|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
3hl4_A236 Crystal Structure Of A Mammalian Ctp:phosphocholine 8e-64
3hl4_A236 Crystal Structure Of A Mammalian Ctp:phosphocholine 9e-21
3elb_A341 Human Ctp: Phosphoethanolamine Cytidylyltransferase 2e-16
3elb_A 341 Human Ctp: Phosphoethanolamine Cytidylyltransferase 9e-07
1coz_A129 Ctp:glycerol-3-Phosphate Cytidylyltransferase From 2e-04
>pdb|3HL4|A Chain A, Crystal Structure Of A Mammalian Ctp:phosphocholine Cytidylyltransferase With Cdp-Choline Length = 236 Back     alignment and structure 
Iteration: 1

 Score =  241 bits (614), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 120/212 (56%), Positives = 136/212 (64%), Gaps = 48/212 (22%)
Query: 45  ASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIER 104
             R VRVYADGI+D+FH GH+R LMQAKN+FPN YLIVGVCSD LTH  KG TVMN+ ER
Sbjct: 73  CERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENER 132
Query: 105 YEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYE 164
           Y+AV+HCRYVDEVVR+APW    EFLA+H                               
Sbjct: 133 YDAVQHCRYVDEVVRNAPWTLTPEFLAEH------------------------------- 161
Query: 165 QRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVSTSD 224
                            RIDF+AHDDIPY S    DVY H+K  GMF  TQRTEG+STSD
Sbjct: 162 -----------------RIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSD 204
Query: 225 IVARIVRDYDIYVRRNLARGYTAKDLNVSFLN 256
           I+ RIVRDYD+Y RRNL RGYTAK+LNVSF+N
Sbjct: 205 IITRIVRDYDVYARRNLQRGYTAKELNVSFIN 236
>pdb|3HL4|A Chain A, Crystal Structure Of A Mammalian Ctp:phosphocholine Cytidylyltransferase With Cdp-Choline Length = 236 Back     alignment and structure
>pdb|3ELB|A Chain A, Human Ctp: Phosphoethanolamine Cytidylyltransferase In Complex With Cmp Length = 341 Back     alignment and structure
>pdb|3ELB|A Chain A, Human Ctp: Phosphoethanolamine Cytidylyltransferase In Complex With Cmp Length = 341 Back     alignment and structure
>pdb|1COZ|A Chain A, Ctp:glycerol-3-Phosphate Cytidylyltransferase From Bacillus Subtilis Length = 129 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kenne 2e-79
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kenne 1e-52
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann 1e-67
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann 3e-21
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase 3e-43
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase 2e-18
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossman 1e-41
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossman 8e-18
3glv_A143 Lipopolysaccharide core biosynthesis protein; stru 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3do8_A148 Phosphopantetheine adenylyltransferase; protein wi 1e-05
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Length = 341 Back     alignment and structure
 Score =  248 bits (634), Expect = 2e-79
 Identities = 78/304 (25%), Positives = 114/304 (37%), Gaps = 80/304 (26%)

Query: 42  NNNASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMND 101
           +    R VRV+ DG YDM H GHS QL QA+ +    YLIVGV +D    + KG  V   
Sbjct: 1   SMGGRRAVRVWCDGCYDMVHYGHSNQLRQARAM--GDYLIVGVHTDEEIAKHKGPPVFTQ 58

Query: 102 IERYEAVRHCRYVDEVVRDAPWETDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQC 161
            ERY+ V+  ++VDEVV  AP+ T  E L K+                            
Sbjct: 59  EERYKMVQAIKWVDEVVPAAPYVTTLETLDKYN--------------------------- 91

Query: 162 NYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKARGMFVATQRTEGVS 221
                                 DF  H +   ++  G D Y  +K  G +   +RT+GVS
Sbjct: 92  ---------------------CDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVS 130

Query: 222 TSDIVARIVRDYDIYVRRNLAR---------------GYTAKDLNVSFLNVTSR------ 260
           T+D+V R++     +                      G         FL  + +      
Sbjct: 131 TTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFAS 190

Query: 261 -------KVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKG--RTV 311
                  +  +Y  G +D+FH GH   L +   +    Y+I G+  D   +  KG    +
Sbjct: 191 GKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPI 250

Query: 312 MNDE 315
           MN  
Sbjct: 251 MNLH 254
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Length = 341 Back     alignment and structure
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Length = 236 Back     alignment and structure
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Length = 236 Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Length = 129 Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Length = 129 Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Length = 132 Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Length = 132 Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Length = 143 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kenne 100.0
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann 100.0
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kenne 99.97
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann 99.86
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossman 99.81
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase 99.81
3glv_A143 Lipopolysaccharide core biosynthesis protein; stru 99.79
3nv7_A157 Phosphopantetheine adenylyltransferase; helicobact 99.74
4f3r_A162 Phosphopantetheine adenylyltransferase; phosphopan 99.71
3k9w_A187 Phosphopantetheine adenylyltransferase; niaid, ssg 99.66
3nbk_A177 Phosphopantetheine adenylyltransferase; PPAT, PHP; 99.66
3nd5_A171 Phosphopantetheine adenylyltransferase; PPAT, coen 99.62
3f3m_A168 Phosphopantetheine adenylyltransferase; PPAT, coen 99.61
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossman 99.59
1vlh_A173 Phosphopantetheine adenylyltransferase; TM0741, st 99.58
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase 99.57
3glv_A143 Lipopolysaccharide core biosynthesis protein; stru 99.56
1qjc_A158 Phosphopantetheine adenylyltransferase; coenzyme A 99.55
1o6b_A169 Phosphopantetheine adenylyltransferase; structural 99.48
3nv7_A157 Phosphopantetheine adenylyltransferase; helicobact 99.47
1od6_A160 PPAT, phosphopantetheine adenylyltransferase; coen 99.43
2qtr_A189 Nicotinate (nicotinamide) nucleotide adenylyltran; 99.42
1kam_A194 Deamido-NAD(+), nicotinate-nucleotide adenylyltran 99.39
4f3r_A162 Phosphopantetheine adenylyltransferase; phosphopan 99.37
3do8_A148 Phosphopantetheine adenylyltransferase; protein wi 99.36
3k9w_A187 Phosphopantetheine adenylyltransferase; niaid, ssg 99.28
1yum_A242 'probable nicotinate-nucleotide adenylyltransferas 99.27
3h05_A177 Uncharacterized protein VPA0413; nucleotidylyl, tr 99.26
1k4m_A213 NAMN adenylyltransferase; nucleotidyltransferase; 99.25
1mrz_A293 Riboflavin kinase/FMN adenylyltransferase; rossman 99.25
3f3m_A168 Phosphopantetheine adenylyltransferase; PPAT, coen 99.19
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.19
3nd5_A171 Phosphopantetheine adenylyltransferase; PPAT, coen 99.18
1f9a_A168 Hypothetical protein MJ0541; alpha/beta, transfera 99.17
2h29_A189 Probable nicotinate-nucleotide adenylyltransferase 99.17
1ej2_A181 Nicotinamide mononucleotide adenylyltransferase; d 99.15
1qjc_A158 Phosphopantetheine adenylyltransferase; coenzyme A 99.06
3nbk_A177 Phosphopantetheine adenylyltransferase; PPAT, PHP; 99.06
1vlh_A173 Phosphopantetheine adenylyltransferase; TM0741, st 99.06
2x0k_A338 Riboflavin biosynthesis protein RIBF; riboflavin k 98.97
3do8_A148 Phosphopantetheine adenylyltransferase; protein wi 98.95
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 98.93
1kam_A194 Deamido-NAD(+), nicotinate-nucleotide adenylyltran 98.89
1o6b_A169 Phosphopantetheine adenylyltransferase; structural 98.89
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 98.87
1od6_A160 PPAT, phosphopantetheine adenylyltransferase; coen 98.8
1mrz_A 293 Riboflavin kinase/FMN adenylyltransferase; rossman 98.78
2qtr_A189 Nicotinate (nicotinamide) nucleotide adenylyltran; 98.78
3op1_A308 Macrolide-efflux protein; structural genomics, PSI 98.77
2h29_A189 Probable nicotinate-nucleotide adenylyltransferase 98.72
1nup_A252 FKSG76; NAD biosynthesis, mitochondria, pyridine a 98.72
3h05_A177 Uncharacterized protein VPA0413; nucleotidylyl, tr 98.71
1k4m_A213 NAMN adenylyltransferase; nucleotidyltransferase; 98.7
1yum_A242 'probable nicotinate-nucleotide adenylyltransferas 98.66
1kqn_A279 Nmnat, nicotinamide mononucleotide adenylyl transf 98.64
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.55
1ej2_A181 Nicotinamide mononucleotide adenylyltransferase; d 98.45
2ejc_A280 Pantoate--beta-alanine ligase; X-RAY diffraction, 98.42
1f9a_A168 Hypothetical protein MJ0541; alpha/beta, transfera 98.42
2qjo_A 341 Bifunctional NMN adenylyltransferase/nudix hydrol; 98.41
2qjt_B 352 Nicotinamide-nucleotide adenylyltransferase; two i 98.39
2x0k_A 338 Riboflavin biosynthesis protein RIBF; riboflavin k 98.36
3op1_A 308 Macrolide-efflux protein; structural genomics, PSI 98.32
2ejc_A 280 Pantoate--beta-alanine ligase; X-RAY diffraction, 98.27
3gmi_A357 UPF0348 protein MJ0951; protein with unknown funct 98.22
1nup_A252 FKSG76; NAD biosynthesis, mitochondria, pyridine a 97.98
1kqn_A 279 Nmnat, nicotinamide mononucleotide adenylyl transf 97.81
3gmi_A 357 UPF0348 protein MJ0951; protein with unknown funct 97.11
1v8f_A276 Pantoate-beta-alanine ligase; rossmann fold, dimer 96.66
3ag6_A283 Pantothenate synthetase; ATP-dependent enzyme, ATP 96.02
3q12_A 287 Pantoate--beta-alanine ligase; structural genomics 95.95
1v8f_A 276 Pantoate-beta-alanine ligase; rossmann fold, dimer 95.71
3cov_A301 Pantothenate synthetase; pantothenate biosynthesis 95.49
1jhd_A396 Sulfate adenylyltransferase; sulfurylase, APS, che 95.37
3q12_A287 Pantoate--beta-alanine ligase; structural genomics 95.2
1v47_A349 ATP sulfurylase; product binding complex, zinc, ri 94.96
3ag6_A 283 Pantothenate synthetase; ATP-dependent enzyme, ATP 94.29
3inn_A314 Pantothenate synthetase; ssgcid, SBRI, UW, decode, 94.26
3inn_A 314 Pantothenate synthetase; ssgcid, SBRI, UW, decode, 93.26
3mxt_A 285 Pantothenate synthetase; alpha-beta-alpha, structu 92.07
3uk2_A283 Pantothenate synthetase; AMP, structural genomics, 91.98
3cov_A 301 Pantothenate synthetase; pantothenate biosynthesis 91.81
1jhd_A396 Sulfate adenylyltransferase; sulfurylase, APS, che 89.39
3uk2_A 283 Pantothenate synthetase; AMP, structural genomics, 89.28
3n8h_A264 Pantothenate synthetase; alpha-beta sandwich, liga 89.05
1v47_A349 ATP sulfurylase; product binding complex, zinc, ri 88.22
3mxt_A285 Pantothenate synthetase; alpha-beta-alpha, structu 87.99
3n8h_A264 Pantothenate synthetase; alpha-beta sandwich, liga 87.81
1pei_A26 PEPC22; transferase, nucleotidyltransferase, repea 85.51
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.4e-53  Score=422.74  Aligned_cols=288  Identities=28%  Similarity=0.377  Sum_probs=234.4

Q ss_pred             CCCCeEEEEcCccCCCChHHHHHHHHHhhcCCCCEEEEEEecCcccccCCCCCCCCHHHHHHHHHhccccCceeecCCCC
Q psy5600          45 ASRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWE  124 (413)
Q Consensus        45 ~~~~~~V~~~G~FDlfH~GHi~~L~qAk~lf~gd~LIVGV~sDe~v~~~Kg~Pv~~~eER~~~V~a~r~VDeVvi~ap~~  124 (413)
                      .++|++||++||||+||.||+++|+||+++|  |+|+|||++|+.+.++|++|+++++||+++|++|+|||+|++.+||.
T Consensus         4 ~~~~~~v~~~G~FD~lH~GH~~lL~~A~~l~--d~LiVgV~~d~~v~~~K~~pi~s~eER~~~l~~l~~VD~Vv~f~~~~   81 (341)
T 3elb_A            4 GRRAVRVWCDGCYDMVHYGHSNQLRQARAMG--DYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYV   81 (341)
T ss_dssp             CCCCCEEEEEECCCSCCHHHHHHHHHHHHTS--SEEEEEECCHHHHHHHSSCCSSCHHHHHHHHHHBTTCCEEEETCCSS
T ss_pred             CCCceEEEEEeeCCCCCHHHHHHHHHHHHhC--CcCEEEeecCHHHhccCCCCCCCHHHHHHHHHHcCCCCEEEecCCCC
Confidence            4678999999999999999999999999996  79999999999888778889999999999999999999999999998


Q ss_pred             ChHHHHHHhccCCCcccccCCCCCCCChhHHHhhhccccccccccccccccCCCccceeeeeecCCCCccCccccchHHH
Q psy5600         125 TDDEFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAH  204 (413)
Q Consensus       125 l~~dfi~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kg~~~~~~~~~~~~~~~~~~~~~~d~y~~  204 (413)
                      ++.+|+++++                                                +|++++|+||....++.+.|+.
T Consensus        82 ~~~efi~~~~------------------------------------------------~d~vV~G~D~~~g~~~~~~~~~  113 (341)
T 3elb_A           82 TTLETLDKYN------------------------------------------------CDFCVHGNDITLTVDGRDTYEE  113 (341)
T ss_dssp             CCHHHHHHTT------------------------------------------------CSEEEECSCCCBCTTSCBTTHH
T ss_pred             CHHHHHHHhC------------------------------------------------CCEEEECCCCCCCCCCcchHHH
Confidence            8999999999                                                8899999999887788899999


Q ss_pred             HHhCCeEEEcCCCCCCCHHHHHHHHHhchhhh-h---------hh--hccc---CCCccccc---------chhee----
Q psy5600         205 LKARGMFVATQRTEGVSTSDIVARIVRDYDIY-V---------RR--NLAR---GYTAKDLN---------VSFLN----  256 (413)
Q Consensus       205 ~ke~Gi~v~i~RT~gVSTSdII~RI~~~~~~~-~---------~R--n~~r---g~s~k~l~---------v~~~~----  256 (413)
                      +|+.|.++.++||+|+|||+|++||+...... .         ++  +...   +.++..-.         +.++.    
T Consensus       114 ~k~~G~~~~~~~t~g~STT~ii~ri~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~g~~  193 (341)
T 3elb_A          114 VKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKE  193 (341)
T ss_dssp             HHHTTCEEECCCCTTCCHHHHHHHHHC-------------------------------CCCCCCCCCCHHHHHHHCCCCC
T ss_pred             HHhCCEEEEeCCCCCCCHHHHHHHHHHhccccccccccchhhHHHHHhhccCccccCCCcceecccCCcceeeeeccCCC
Confidence            99999999999999999999999999754321 1         00  0111   11111000         01111    


Q ss_pred             eeccceEEEEccccccCChhHHHHHHHHHhcCCCc--EEEEEEcchhhhhhcCC--CCCCCHHHHHHHHhhHHHHHhhhh
Q psy5600         257 VTSRKVRVYADGIYDMFHQGHSRQLMQAKNVFPNV--YLIVGVCSDALTHRKKG--RTVMNDEKKFRFQNKIEEFKDRSK  332 (413)
Q Consensus       257 ~~~~~~iV~~~G~FDl~H~GHi~~L~~Ak~l~~gd--~LIVGV~sD~~v~~~Kg--~Pi~~~~eR~~~v~~i~~v~e~~k  332 (413)
                      +.+++++||++||||+||.||+++|++|+++  +|  +|||||++|++++++||  +|+++++||+++++       +++
T Consensus       194 ~~~~~~iv~~~GsFD~~h~GHl~~L~rA~~l--~D~~~LiVgV~~d~~v~~~Kg~~~pi~~~~ER~~~v~-------~~~  264 (341)
T 3elb_A          194 PQPGETVIYVAGAFDLFHIGHVDFLEKVHRL--AERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVL-------ACR  264 (341)
T ss_dssp             CCTTCEEEEEEECCTTCCHHHHHHHHHHHTT--SSSEEEEEEEECHHHHHHHHCTTCCSSCHHHHHHHHH-------TBT
T ss_pred             CCCCCEEEEEecccCCCCHHHHHHHHHHHHh--CCCCEEEEEEccCHhhHhhcCCCCCCCCHHHHHHHHH-------HcC
Confidence            2346789999999999999999999999999  68  99999999999999888  59999999999998       899


Q ss_pred             hHHHHhccchhhh-hHhHHhhchhhhccceeeeecCCCccchh--h--hhHHHhhhhcCCCCCCCCCCC
Q psy5600         333 RVMENIGERRVDM-IQKWEEKSRDIIDTFLLLFGREGRLKHMW--N--EGKGKFLQAFSPPASPTRSRG  396 (413)
Q Consensus       333 ~Vd~vv~~~~~d~-~~~~e~~~~Dii~~f~~~~G~Dw~~~~~~--~--~~k~~~~~~~~~~~~~~~~~~  396 (413)
                      +||+|+.....+. .+-++++++|+     ++.|+||......  +  +...+.-.+...|.++..||+
T Consensus       265 ~vd~V~v~~~~~l~~~~~~~~~~~~-----iv~G~d~~~~~~~g~d~y~~~k~~G~~~~i~~~~~~STt  328 (341)
T 3elb_A          265 YVSEVVIGAPYAVTAELLSHFKVDL-----VCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTD  328 (341)
T ss_dssp             TCCEEEEEECSSCCHHHHHHTTCSE-----EEECSSCCCCCTTSCCTTHHHHHHTCEEECCCSCCCCHH
T ss_pred             CCCCEEECCCCcchHHHHHhcCCcE-----EEECCCCccccCCccchHHHHHhCCEEEEcCCCCCCCHH
Confidence            9999998665443 46678889999     9999999865322  1  234455666777777777765
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3nv7_A Phosphopantetheine adenylyltransferase; helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopa adenylyltransferase; 1.75A {Helicobacter pylori} PDB: 3otw_A* Back     alignment and structure
>4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} Back     alignment and structure
>3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infect disease, coenzyme A, COA; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei} PDB: 3ikz_A* 3pxu_A* Back     alignment and structure
>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3pnb_A* 4e1a_A 3lcj_A 3rba_A* 1tfu_A* 3rff_A 3rhs_A* 3uc5_A* Back     alignment and structure
>3nd5_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway; 2.30A {Enterococcus faecalis} SCOP: c.26.1.0 PDB: 3nd6_A* 3nd7_A* Back     alignment and structure
>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway, coenzyme A biosynthesis, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} SCOP: c.26.1.0 Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Back     alignment and structure
>1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A Back     alignment and structure
>1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Back     alignment and structure
>3nv7_A Phosphopantetheine adenylyltransferase; helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopa adenylyltransferase; 1.75A {Helicobacter pylori} PDB: 3otw_A* Back     alignment and structure
>1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltran; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesi transferase; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* Back     alignment and structure
>1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Back     alignment and structure
>4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} Back     alignment and structure
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Back     alignment and structure
>3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infect disease, coenzyme A, COA; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei} PDB: 3ikz_A* 3pxu_A* Back     alignment and structure
>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Back     alignment and structure
>3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structu genomics, PSI; 1.65A {Vibrio parahaemolyticus} Back     alignment and structure
>1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Back     alignment and structure
>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway, coenzyme A biosynthesis, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} SCOP: c.26.1.0 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3nd5_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway; 2.30A {Enterococcus faecalis} SCOP: c.26.1.0 PDB: 3nd6_A* 3nd7_A* Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Back     alignment and structure
>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Back     alignment and structure
>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A Back     alignment and structure
>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3pnb_A* 4e1a_A 3lcj_A 3rba_A* 1tfu_A* 3rff_A 3rhs_A* 3uc5_A* Back     alignment and structure
>1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Back     alignment and structure
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Back     alignment and structure
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Back     alignment and structure
>1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltran; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesi transferase; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* Back     alignment and structure
>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Back     alignment and structure
>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Back     alignment and structure
>1nup_A FKSG76; NAD biosynthesis, mitochondria, pyridine adenylyltransferase catalysis, transferase; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Back     alignment and structure
>3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structu genomics, PSI; 1.65A {Vibrio parahaemolyticus} Back     alignment and structure
>1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Back     alignment and structure
>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Back     alignment and structure
>1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Back     alignment and structure
>2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Back     alignment and structure
>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Back     alignment and structure
>2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} Back     alignment and structure
>3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; 1.91A {Methanocaldococcus jannaschii} Back     alignment and structure
>1nup_A FKSG76; NAD biosynthesis, mitochondria, pyridine adenylyltransferase catalysis, transferase; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Back     alignment and structure
>1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Back     alignment and structure
>3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; 1.91A {Methanocaldococcus jannaschii} Back     alignment and structure
>1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken STR genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A Back     alignment and structure
>3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* Back     alignment and structure
>3q12_A Pantoate--beta-alanine ligase; structural genomics, center for structural genomics of infec diseases, csgid; HET: PAF; 1.58A {Yersinia pestis} SCOP: c.26.1.4 PDB: 3q10_A* 3mue_A 1iho_A 3guz_A* Back     alignment and structure
>1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken STR genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A Back     alignment and structure
>3cov_A Pantothenate synthetase; pantothenate biosynthesis, enzym ligase, drug design, ATP-binding, magnesium, metal-binding; 1.50A {Mycobacterium tuberculosis} SCOP: c.26.1.4 PDB: 3cow_A* 3coy_A* 3coz_A* 3imc_A* 3ime_A* 3img_A* 3iob_A* 3ioc_A* 3iod_A* 3ioe_A* 3iub_A* 3iue_A* 3ivc_A* 3ivg_A* 3ivx_A* 2a84_A* 1n2b_A* 1n2e_A* 1n2g_A* 1n2h_A* ... Back     alignment and structure
>1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>3q12_A Pantoate--beta-alanine ligase; structural genomics, center for structural genomics of infec diseases, csgid; HET: PAF; 1.58A {Yersinia pestis} SCOP: c.26.1.4 PDB: 3q10_A* 3mue_A 1iho_A 3guz_A* Back     alignment and structure
>1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* Back     alignment and structure
>3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} Back     alignment and structure
>3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} Back     alignment and structure
>3mxt_A Pantothenate synthetase; alpha-beta-alpha, structural genomics, center for structural of infectious diseases, csgid, ligase; HET: MSE; 1.85A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3uy4_A* Back     alignment and structure
>3uk2_A Pantothenate synthetase; AMP, structural genomics, seattle S genomics center for infectious disease, ssgcid, ligase; HET: AMP; 2.25A {Burkholderia thailandensis} SCOP: c.26.1.0 Back     alignment and structure
>3cov_A Pantothenate synthetase; pantothenate biosynthesis, enzym ligase, drug design, ATP-binding, magnesium, metal-binding; 1.50A {Mycobacterium tuberculosis} SCOP: c.26.1.4 PDB: 3cow_A* 3coy_A* 3coz_A* 3imc_A* 3ime_A* 3img_A* 3iob_A* 3ioc_A* 3iod_A* 3ioe_A* 3iub_A* 3iue_A* 3ivc_A* 3ivg_A* 3ivx_A* 2a84_A* 1n2b_A* 1n2e_A* 1n2g_A* 1n2h_A* ... Back     alignment and structure
>1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>3uk2_A Pantothenate synthetase; AMP, structural genomics, seattle S genomics center for infectious disease, ssgcid, ligase; HET: AMP; 2.25A {Burkholderia thailandensis} SCOP: c.26.1.0 Back     alignment and structure
>3n8h_A Pantothenate synthetase; alpha-beta sandwich, ligase, structural genomics, structural of infectious diseases; HET: MSE AMP GOL; 2.00A {Francisella tularensis subsp} PDB: 3qtt_A* Back     alignment and structure
>1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>3mxt_A Pantothenate synthetase; alpha-beta-alpha, structural genomics, center for structural of infectious diseases, csgid, ligase; HET: MSE; 1.85A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3uy4_A* Back     alignment and structure
>3n8h_A Pantothenate synthetase; alpha-beta sandwich, ligase, structural genomics, structural of infectious diseases; HET: MSE AMP GOL; 2.00A {Francisella tularensis subsp} PDB: 3qtt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 413
d1coza_126 c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltr 5e-08
d1coza_126 c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltr 1e-04
d1coza_126 c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltr 4e-04
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Cytidylyltransferase
domain: CTP:glycerol-3-phosphate cytidylyltransferase
species: Bacillus subtilis [TaxId: 1423]

 Score = 49.1 bits (116), Expect = 5e-08
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 50  RVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVR 109
           +V   G +D+ H GH + L +AK +    YL+V + +D    +K+ +   +   R   + 
Sbjct: 3   KVITYGTFDLLHWGHIKLLERAKQLGD--YLVVAISTDEFNLQKQKKAYHSYEHRKLILE 60

Query: 110 HCRYVDEVVRDAPWETDDEFLAKHK 134
             RYVDEV+ +  WE   + +  H 
Sbjct: 61  TIRYVDEVIPEKNWEQKKQDIIDHN 85
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 126 Back     information, alignment and structure
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 126 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
d1coza_126 CTP:glycerol-3-phosphate cytidylyltransferase {Bac 99.97
d1coza_126 CTP:glycerol-3-phosphate cytidylyltransferase {Bac 99.92
d1f9aa_164 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.33
d1lw7a1163 Transcriptional regulator NadR, NMN-adenylyltransf 99.22
d1ej2a_167 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.16
d1tfua_157 Phosphopantetheine adenylyltransferase {Mycobacter 99.09
d1qjca_157 Phosphopantetheine adenylyltransferase {Escherichi 99.09
d1o6ba_163 Phosphopantetheine adenylyltransferase {Bacillus s 99.03
d1od6a_160 Phosphopantetheine adenylyltransferase {Thermus th 98.96
d1vlha_157 Phosphopantetheine adenylyltransferase {Thermotoga 98.88
d1lw7a1163 Transcriptional regulator NadR, NMN-adenylyltransf 98.79
d1kama_189 Nicotinamide mononucleotide (NMN) adenylyltransfer 98.66
d1k4ma_213 Nicotinamide mononucleotide (NMN) adenylyltransfer 98.65
d1f9aa_164 Nicotinamide mononucleotide (NMN) adenylyltransfer 98.62
d1mrza2157 FMN adenylyltransferase domain of bifunctional FAD 98.58
d1ej2a_167 Nicotinamide mononucleotide (NMN) adenylyltransfer 98.5
d1kr2a_271 Nicotinamide mononucleotide (NMN) adenylyltransfer 98.39
d1nuua_233 Cytosolic NMN/NAMN adenylyltransferase {Human (Hom 98.29
d1jhda2223 ATP sulfurylase catalytic domain {Sulfur-oxidizing 98.1
d1o6ba_163 Phosphopantetheine adenylyltransferase {Bacillus s 98.04
d1qjca_157 Phosphopantetheine adenylyltransferase {Escherichi 97.95
d1od6a_160 Phosphopantetheine adenylyltransferase {Thermus th 97.89
d1tfua_157 Phosphopantetheine adenylyltransferase {Mycobacter 97.78
d1mrza2157 FMN adenylyltransferase domain of bifunctional FAD 97.72
d1kama_189 Nicotinamide mononucleotide (NMN) adenylyltransfer 97.65
d1kr2a_ 271 Nicotinamide mononucleotide (NMN) adenylyltransfer 97.62
d1vlha_157 Phosphopantetheine adenylyltransferase {Thermotoga 97.48
d1k4ma_213 Nicotinamide mononucleotide (NMN) adenylyltransfer 97.39
d1nuua_233 Cytosolic NMN/NAMN adenylyltransferase {Human (Hom 97.16
d1jhda2223 ATP sulfurylase catalytic domain {Sulfur-oxidizing 96.81
d2a84a1286 Pantothenate synthetase (Pantoate-beta-alanine lig 92.95
d1v8fa_276 Pantothenate synthetase (Pantoate-beta-alanine lig 89.02
d1v8fa_ 276 Pantothenate synthetase (Pantoate-beta-alanine lig 88.89
d1ihoa_ 282 Pantothenate synthetase (Pantoate-beta-alanine lig 87.84
d2a84a1 286 Pantothenate synthetase (Pantoate-beta-alanine lig 87.25
d1ihoa_282 Pantothenate synthetase (Pantoate-beta-alanine lig 85.44
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Cytidylyltransferase
domain: CTP:glycerol-3-phosphate cytidylyltransferase
species: Bacillus subtilis [TaxId: 1423]

Probab=99.97  E-value=8.2e-32  Score=230.84  Aligned_cols=126  Identities=30%  Similarity=0.440  Sum_probs=115.2

Q ss_pred             CeEEEEcCccCCCChHHHHHHHHHhhcCCCCEEEEEEecCcccccCCCCCCCCHHHHHHHHHhccccCceeecCCCCChH
Q psy5600          48 KVRVYADGIYDMFHQGHSRQLMQAKNVFPNVYLIVGVCSDALTHRKKGRTVMNDIERYEAVRHCRYVDEVVRDAPWETDD  127 (413)
Q Consensus        48 ~~~V~~~G~FDlfH~GHi~~L~qAk~lf~gd~LIVGV~sDe~v~~~Kg~Pv~~~eER~~~V~a~r~VDeVvi~ap~~l~~  127 (413)
                      |++|++.|+||+||.||+++|++|+++|  |+|+|||++|+.+.++|++|++|++||+++|++|+|||+|++..||..+.
T Consensus         1 Mk~V~~~G~FD~lH~GH~~~l~~Ak~~g--d~liV~v~sD~~~~~~k~~pi~~~~eR~~~l~~~~~Vd~v~~~~~~~~~~   78 (126)
T d1coza_           1 MKKVITYGTFDLLHWGHIKLLERAKQLG--DYLVVAISTDEFNLQKQKKAYHSYEHRKLILETIRYVDEVIPEKNWEQKK   78 (126)
T ss_dssp             CCEEEEEECCCSCCHHHHHHHHHHHTTS--SEEEEEEECHHHHHHHTCCCSSCHHHHHHHHTTBTTCCEEEEECCSTTHH
T ss_pred             CcEEEEeeEeCCCCHHHHHHHHHHHhhC--ceeeeeeeccchhhhccCcccCCHHHHHHHhhhhcccceeeecccccccH
Confidence            7899999999999999999999999995  89999999999998889999999999999999999999999999999988


Q ss_pred             HHHHHhccCCCcccccCCCCCCCChhHHHhhhccccccccccccccccCCCccceeeeeecCCCCccCccccchHHHHHh
Q psy5600         128 EFLAKHKESTSSISITKPAPFSDEPEAVEERNQCNYEQRITYDDAKQGKGKAWERIDFIAHDDIPYMSEFGTDVYAHLKA  207 (413)
Q Consensus       128 dfi~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kg~~~~~~~~~~~~~~~~~~~~~~d~y~~~ke  207 (413)
                      +++.+++                                                +|++++|+++..      .+..++.
T Consensus        79 ~~i~~~~------------------------------------------------~d~~v~G~D~~~------~~~~~~~  104 (126)
T d1coza_          79 QDIIDHN------------------------------------------------IDVFVMGDDWEG------KFDFLKD  104 (126)
T ss_dssp             HHHHHTT------------------------------------------------CSEEEEEGGGTT------TTGGGTT
T ss_pred             hhhhccC------------------------------------------------CCEeeecccccc------chHHHHc
Confidence            9999988                                                788888887632      2446777


Q ss_pred             CCeEEEcCCCCCCCHHHHHHHH
Q psy5600         208 RGMFVATQRTEGVSTSDIVARI  229 (413)
Q Consensus       208 ~Gi~v~i~RT~gVSTSdII~RI  229 (413)
                      .|.++.++|++++|||.|++||
T Consensus       105 ~~~~i~~~~~~~iSST~i~~~I  126 (126)
T d1coza_         105 QCEVVYLPRTEGISTTKIKEEI  126 (126)
T ss_dssp             TSEEEEECCCTTCCHHHHHHTC
T ss_pred             CCEEEEECCCCCccHHHHHHhC
Confidence            8889999999999999999986
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} Back     information, alignment and structure
>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Back     information, alignment and structure
>d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} Back     information, alignment and structure
>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Back     information, alignment and structure
>d2a84a1 c.26.1.4 (A:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a84a1 c.26.1.4 (A:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure