Psyllid ID: psy5670


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------127
MMVCPGSVFITVLISALGLVSASISKALRYQAPDECKWFAVTSEGAEIEVPSAAEPDQEVALVCKLRTINSEIENTNFSIIQAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIGNLSAGSFRGLRKLKTLTLRTHNTDWSTMSLDISHNVFTDELQSLESLDLSMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNNSFDSLPAEGFSRLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPELFNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQSYSVNKERNKPNLVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNKTFNGLKELIILRLDDNRLTEIRGYEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQSITLTSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIRCMTGSEVGFTIMRTVIPSCNVVSTNVSSHSNNNNNTTTTTTTTTIFIPEHSPMNGSFILSELQPQQDYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLGEVPQKDLDPDIRLYLKSNTYLQWGDKLFWEKLKFALPDVPNNQRNNNNRNQVRHLNHSAHHHNHNHRHHQHHHNNTSQEKIPGMGISS
ccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccccccccccccccEEEEEEEEcccccccccccccccccccEEEcccccccccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEEEccccccccHHHccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHccccccccEEEccccccccccHHccccccccEEEccccccccccHHHHcccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccEEEEcccccccccEEEccccccccccccHHHHHHHHHHcccccccccccEEccccccccEEcEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccccccccccccEEEEcccccHHHHHHHHHHHHccccccccEEEccccccccccHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHcccccEEEccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccHHHHccccccEEEccccccccccccHHHHHccEEEccccccccccccccccccccccEEEEEccccccccccccHcccccHHHHHHHHHccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEEcccccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEcccccccccHHHccccccEEEEcccccccccccHHHHHHccEEEccccccccccccHHHccccccEEEEcccccccccccHHHHHHcEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccccccccEEEcccccccccccHHHHHHHHHHHHHcccccccccccccccccHcccccccEEEccccccccccccHHHHHHHHccccccccccccccccccccccccccEEEEEccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEcccHHHHHcccEEEccccccccccHHHHHHHHHHHHcccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccccccccHHcccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHHccEEEEEcHHHHHHHHcHHHHHHHHHHHHHccccEEEEEEccccHHHccHHHHHHHHcccEEEEccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccc
MMVCPGSVFITVLISALGLVSASISKALryqapdeckwFAVTsegaeievpsaaepdQEVALVCKLRTINSEIENTNFSIIQAQYTVRLRIECgdmlffqsslspgsfqtlidlkDLSVEFCKignlsagsfrglrKLKTLTLrthntdwstmsldISHNVFTDELQslesldlsmnsiwtlpdaifcplqslsyLNLTQNklsnvatfsfsnydtarcginlrvldlsnnsfdslpaegfSRLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVnnlvnippelfnqsrdLKEVYlqnnsinvlapGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNkmnkldssiFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNklkriesnsldslTALSVLSLDNNELEYIEENALknstslqdfhlngnklteiPKVLRNLhslktldlgdNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKiqkveagtfdnnsnLVAIrldgnyltdigglfpklpnlvWLNISENLLEWFdyalipadlqwldihgnqiselgnYFEIESQLRLTyfdassnklteltgnaiphsvenlfltnnliskvqpytffmkpnltrvdLVGNRlkninqtalrisplpshknipdfyigenpfqcdcnmqwlqsysvnkernkpnlvdldtVTCKLLYNRANPAILLKEAHSNQFlceyetncaplchccdfdacdcemtcpnnctcyhdvsweanvidcstggydnqlppripmdatelyldgnripvvgshsfigrKKLQILFLNSSHVETIHNKTFNGLKELIILRlddnrlteirGYEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQsitltsnpwscdcdfteKFRDYLQRsrssvhdisqircmtgsevGFTIMRTVIPScnvvstnvsshsnnnnntttttttttifipehspmngsfilselqpqqDYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLfyksseiemddRDKLFDAFVSYSSKDEAFVAEELApilengdpayKLCLhyrefpvggyiGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLgevpqkdldpdirlYLKSNTYLQWGDKLFWEKLKFalpdvpnnqrnnnnrnqvrhlnhsahhhnhnhrhhqhhhnntsqekipgmgiss
MMVCPGSVFITVLISALGLVSASISKALRYQAPDECKWFAVTSEGAEIevpsaaepdqEVALVCKLRTInseientnfsiiqAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIgnlsagsfrglrkLKTLTLRTHNTDWSTMSLDISHNVFTDELQSLESLDLSMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNNSFDSLPAEGFSRLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPELFNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQkveagtfdnnsnLVAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINqtalrisplpsHKNIPDFYIGENPFQCDCNMQWLQSYSVnkernkpnlVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNktfnglkeliilrlddnrlTEIRGYEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQSITLTSNPWSCDCDFTEKFRDYLQRsrssvhdisqirCMTGSEVGFTIMRTVIPSCNVVSTnvsshsnnnnnttttTTTTTIFIPEHSPMNGSFILSELQPQQDYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLgevpqkdldpdiRLYLKSNTYLQWGDKLFWEKLKFALPDVPNNQRNNNNRNQVRHLNHSAHHHNHNHRHHqhhhnntsqekipgmgiss
MMVCPGSVFITVLISALGLVSASISKALRYQAPDECKWFAVTSEGAEIEVPSAAEPDQEVALVCKLRTINSEIENTNFSIIQAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIGNLSAGSFRGlrklktltlrtHNTDWSTMSLDISHNVFTdelqslesldlsMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNNSFDSLPAEGFSRLSRLQELYLQGNILTFLADHALDGlnsltvlnlsvnnlvnIPPELFNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQSYSVNKERNKPNLVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNKTFNGLKELIILRLDDNRLTEIRGYEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQSITLTSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIRCMTGSEVGFTIMRTVIPSCnvvstnvsshsnnnnntttttttttIFIPEHSPMNGSFILSELQPQQDYVFlliilvsasfvlvllliliiiYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLGEVPQKDLDPDIRLYLKSNTYLQWGDKLFWEKLKFALPDVPnnqrnnnnrnqVRhlnhsahhhnhnhrhhqhhhnnTSQEKIPGMGISS
**VCPGSVFITVLISALGLVSASISKALRYQAPDECKWFAVTSEGAEIEV*******QEVALVCKLRTINSEIENTNFSIIQAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIGNLSAGSFRGLRKLKTLTLRTHNTDWSTMSLDISHNVFTDELQSLESLDLSMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNNSFDSLPAEGFSRLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPELFNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQSYSVNKERNKPNLVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNKTFNGLKELIILRLDDNRLTEIRGYEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQSITLTSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIRCMTGSEVGFTIMRTVIPSCNVVS*********************************FILSELQPQQDYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLGEVPQKDLDPDIRLYLKSNTYLQWGDKLFWEKLKFALP***************************************************
****PGSVFITVLISALGLVSASISKALRYQAPDECKWFAVTSEGAEIEVPSAAEPDQEVALVCKLRTINSEIENTNFSIIQAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIGNLSAGSFRGLRKLKTLTLRTHNTDWSTMSLDISHNVFTDELQSLESLDLSMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNNSFDSLPAEGFSRLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPELFNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQSYSVNKERNKPNLVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNKTFNGLKELIILRLDDNRLTEIRGYEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQSITLTSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIRCMTGSEVGFTIMRTVIPSCNVVSTNVSSHSNNNNNTTTTTTTTTIFIPEHSPMNGSFILSELQPQQDYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLGEVPQKDLDPDIRLYLKSNTYLQWGDKLFWEKLKFAL****************************************************
MMVCPGSVFITVLISALGLVSASISKALRYQAPDECKWFAVTSEGAEIEVPSAAEPDQEVALVCKLRTINSEIENTNFSIIQAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIGNLSAGSFRGLRKLKTLTLRTHNTDWSTMSLDISHNVFTDELQSLESLDLSMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNNSFDSLPAEGFSRLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPELFNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQSYSVNKERNKPNLVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNKTFNGLKELIILRLDDNRLTEIRGYEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQSITLTSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIRCMTGSEVGFTIMRTVIPSCNVVSTNVSSHSNNNNNTTTTTTTTTIFIPEHSPMNGSFILSELQPQQDYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLGEVPQKDLDPDIRLYLKSNTYLQWGDKLFWEKLKFALPDVPNNQRNNNNRNQVRHLNHS******************************
MMVCPGSVFITVLISALGLVSASISKALRYQAPDECKWFAVTSEGAEIEVPSAAEPDQEVALVCKLRTINSEIENTNFSIIQAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIGNLSAGSFRGLRKLKTLTLRTHNTDWSTMSLDISHNVFTDELQSLESLDLSMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNNSFDSLPAEGFSRLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPELFNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQSYSVNKERNKPNLVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNKTFNGLKELIILRLDDNRLTEIRGYEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQSITLTSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIRCMTGSEVGFTIMRTVIPSCNVVSTNVSSHSNNNNNTTTTTTTTTIFIPEHSPMNGSFILSELQPQQDYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLGEVPQKDLDPDIRLYLKSNTYLQWGDKLFWEKLKFALPDVP************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVCPGSVFITVLISALGLVSASISKALRYQAPDECKWFAVTSEGAEIEVPSAAEPDQEVALVCKLRTINSEIENTNFSIIQAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIGNLSAGSFRGLRKLKTLTLRTHNTDWSTMSLDISHNVFTDELQSLESLDLSMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNNSFDSLPAEGFSRLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPELFNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQSYSVNKERNKPNLVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNKTFNGLKELIILRLDDNRLTEIRGYEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQSITLTSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIRCMTGSEVGFTIMRTVIPSCNVVSTNVSSHSNNNNNTTTTTTTTTIFIPEHSPMNGSFILSELQPQQDYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLGEVPQKDLDPDIRLYLKSNTYLQWGDKLFWEKLKFALPDVPNNQRNNNNRNQVRHLNHSAHHHNHNHRHHQHHHNNTSQEKIPGMGISS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1269 2.2.26 [Sep-21-2011]
P089531097 Protein toll OS=Drosophil no N/A 0.654 0.756 0.259 2e-65
P35858605 Insulin-like growth facto yes N/A 0.356 0.748 0.301 2e-37
P70389603 Insulin-like growth facto yes N/A 0.338 0.711 0.301 3e-36
O88279 1531 Slit homolog 1 protein OS yes N/A 0.449 0.372 0.247 9e-36
Q80TR4 1531 Slit homolog 1 protein OS no N/A 0.438 0.363 0.244 1e-35
O75093 1534 Slit homolog 1 protein OS no N/A 0.468 0.387 0.24 3e-35
O02833605 Insulin-like growth facto N/A N/A 0.310 0.651 0.301 1e-34
P35859603 Insulin-like growth facto no N/A 0.319 0.671 0.299 4e-34
Q9HBX8967 Leucine-rich repeat-conta no N/A 0.291 0.382 0.319 5e-34
O88280 1523 Slit homolog 3 protein OS no N/A 0.434 0.361 0.256 1e-33
>sp|P08953|TOLL_DROME Protein toll OS=Drosophila melanogaster GN=Tl PE=1 SV=1 Back     alignment and function desciption
 Score =  251 bits (642), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 265/1021 (25%), Positives = 457/1021 (44%), Gaps = 191/1021 (18%)

Query: 229  SNNSFDSLPAEGFSRLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPEL 288
            S+N   ++  +   RL  L+        LT +  + L  + +L+ L L  N +  +P  L
Sbjct: 134  SDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRAN-IEEMPSHL 192

Query: 289  FNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVL 348
            F+   +L+ +   +N +  +  GIF  + +L  L+L +N+L    +    F G   ++ +
Sbjct: 193  FDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHN--LTKHDFEGATSVLGI 250

Query: 349  NIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNK--LKRI 406
            +I  N + +L   +F  L  +  ++L  N   S+ +  F    +L+ + + NN+  L  +
Sbjct: 251  DIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATL 310

Query: 407  ESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPK-VLRNLHSLK 465
             S    +   L +L L   EL+ +  +  ++ST + +  L  N L  +P  +L +  +L 
Sbjct: 311  PSRLFANQPELQILRL-RAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLL 369

Query: 466  TLDLGDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKV 525
            +LDL +N +T + +        L  LRL +N ++ IS  +F  L  L  L ++ N+++ +
Sbjct: 370  SLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTI 429

Query: 526  EAGTFDNNSNLVAIRLDGNYL------------TDIGGLFPKLPNLVWLNISEN--LLEW 571
            ++  F + + L  + LD N +            T I   F  +  L+ LN+  N  +  +
Sbjct: 430  DSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVY 489

Query: 572  FDYALIPADLQWLDIHGNQISELGNYFEIE--SQLRLTYFDASSNKLTELTGNAIPHSVE 629
             D+      L+ LD+  N IS LG Y ++   SQ RL + + + NK+  +   A+P  V 
Sbjct: 490  NDWKNTMLQLRELDLSYNNISSLG-YEDLAFLSQNRL-HVNMTHNKIRRI---ALPEDVH 544

Query: 630  NLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGEN 689
                 NN              NL  VDL                              +N
Sbjct: 545  LGEGYNN--------------NLVHVDL-----------------------------NDN 561

Query: 690  PFQCDCNMQWLQSYSVNKERNKPNLV-DLDTVTCKLLYNRANPAILLKEAHSNQFLCEYE 748
            P  CDC + W     + +  +KP         T +L+ ++ N   +L+     Q   E +
Sbjct: 562  PLVCDCTILWF--IQLVRGVHKPQYSRQFKLRTDRLVCSQPN---VLEGTPVRQI--EPQ 614

Query: 749  TNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIP-----M 803
            T   PL    DF     E  CP  C C+     +A VI+C +G   +   PR+P     M
Sbjct: 615  TLICPL----DFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHV--PRLPNLHKNM 668

Query: 804  DATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNKTFNGLKELIILRLDDNRL 863
               EL+L+ N                 +L L S++          G + +  L L  N L
Sbjct: 669  QLMELHLENN----------------TLLRLPSANTP--------GYESVTSLHLAGNNL 704

Query: 864  TEIRGYEFERLE-NLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQ 922
            T I   + ++L  NL  L + +N              HL++L       T     + + +
Sbjct: 705  TSI---DVDQLPTNLTHLDISWN--------------HLQMLN-----ATVLGFLNRTMK 742

Query: 923  IQSITLTSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIRCMTGSEVGFTIMRTVIPSCNV 982
             +S+ L+ NPW CDC   +    + Q +   + D +++ C+             +P+  V
Sbjct: 743  WRSVKLSGNPWMCDCT-AKPLLLFTQDNFERIGDRNEMMCVNAE----------MPTRMV 791

Query: 983  -VSTNVSSHSNNNNNTTTTTTTTTIFIPEHSPMNGSFILSELQPQQDYVFLLIILVSASF 1041
             +STN                                   ++ P +  VF+ + +V A  
Sbjct: 792  ELSTN-----------------------------------DICPAEKGVFIALAVVIALT 816

Query: 1042 VLVLLLILIIIYR--QEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFV 1099
             L+      + Y+   E+++W ++   +  F    ++   D+DK FDAF+SYS KD++F+
Sbjct: 817  GLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDL---DKDKKFDAFISYSHKDQSFI 873

Query: 1100 AEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRY 1159
             + L P LE+G   ++LC+H R++ VGG+I + I+++V  SRRTI+VLS+NFIKSEW R 
Sbjct: 874  EDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARL 933

Query: 1160 EFKSAHHQVL-RGKKRLIVILLGEVPQ-KDLDPDIRLYLKSNTYLQWGDKLFWEKLKFAL 1217
            EF++AH   L  G+ R+IVI+  ++   + LD +++ YLK NTYL+WGD  FW+KL+FAL
Sbjct: 934  EFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELKAYLKMNTYLKWGDPWFWDKLRFAL 993

Query: 1218 P 1218
            P
Sbjct: 994  P 994




Component of the extracellular signaling pathway that establishes the dorsal-ventral pathway of the embryo. Three proteases; ndl, gd and snk process easter to create active easter. Active easter defines cell identities along the dorsal-ventral continuum by activating the spz ligand for the Tl receptor in the ventral region of the embryo. Promotes heterophilic cellular adhesion. Spz C-106 in the hemolymph controls expression of the antifungal peptide Drosomycin (Drs) by acting as a ligand of Tl and inducing an intracellular signaling pathway.
Drosophila melanogaster (taxid: 7227)
>sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 Back     alignment and function description
>sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=2 SV=1 Back     alignment and function description
>sp|O88279|SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus GN=Slit1 PE=1 SV=1 Back     alignment and function description
>sp|Q80TR4|SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus GN=Slit1 PE=1 SV=2 Back     alignment and function description
>sp|O75093|SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens GN=SLIT1 PE=2 SV=4 Back     alignment and function description
>sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 Back     alignment and function description
>sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 Back     alignment and function description
>sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=2 SV=3 Back     alignment and function description
>sp|O88280|SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus GN=Slit3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1269
2420065181241 toll, putative [Pediculus humanus corpor 0.940 0.961 0.627 0.0
1892342171237 PREDICTED: similar to vasorin [Tribolium 0.933 0.957 0.617 0.0
1571075081343 toll [Aedes aegypti] gi|108884099|gb|EAT 0.976 0.922 0.566 0.0
2700029061212 tollo [Tribolium castaneum] 0.915 0.958 0.608 0.0
1700720761261 vasorin [Culex quinquefasciatus] gi|1678 0.970 0.976 0.574 0.0
1700668641332 vasorin [Culex quinquefasciatus] gi|1678 0.954 0.909 0.581 0.0
1936154151248 PREDICTED: slit homolog 3 protein-like [ 0.942 0.958 0.583 0.0
3227874901240 hypothetical protein SINV_12174 [Solenop 0.952 0.975 0.575 0.0
3072154401249 Protein toll [Harpegnathos saltator] 0.948 0.963 0.571 0.0
3320281931242 Protein toll [Acromyrmex echinatior] 0.947 0.968 0.573 0.0
>gi|242006518|ref|XP_002424097.1| toll, putative [Pediculus humanus corporis] gi|212507403|gb|EEB11359.1| toll, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 1586 bits (4107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 780/1243 (62%), Positives = 978/1243 (78%), Gaps = 50/1243 (4%)

Query: 8    VFITVLISA-LGLVSASISKALRYQAPDECKWFAVTSEGAEIEVPSAAEPDQEVALVCKL 66
            V  T+   A   ++SAS+SKALRYQAPDECKW +  S+G      +AA  D++VALVC+L
Sbjct: 4    VTFTIFFGATFSVLSASLSKALRYQAPDECKWLSANSDGEN----TAAVDDEDVALVCRL 59

Query: 67   RTINSEIENTNFSIIQAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIGN 126
             TINSE+ENTNFS+IQ Q+TVRLR+EC + LFFQSSL+ GSF++L++LK+LS+E+CKIGN
Sbjct: 60   GTINSEVENTNFSVIQPQHTVRLRLECNNTLFFQSSLNSGSFRSLVELKELSIEYCKIGN 119

Query: 127  LSAGSFRGLRKLKTLTLRTHNTDWSTMSLDISHNVFTDELQSLESLDLSMNSIWTLPDAI 186
            L+AG+F+GL++L+ LTLRTHNTDWS M+L I  + F + L  L+ LDL  N+IWTL D +
Sbjct: 120  LTAGAFKGLKELRNLTLRTHNTDWSAMTLHIQPDAFEENLDLLQRLDLGENNIWTLADGV 179

Query: 187  FCPLQSLSYLNLTQNKLSNVATFSFSN----YDTARCGINLRVLDLSNNSFDSLPAEGFS 242
            FCPL  L YLNLT+N+L NV    F       +T +CG NL +LDLSNNS D +P E  S
Sbjct: 180  FCPLHKLEYLNLTRNRLRNVTALRFGGSGQEQNTNKCGSNLVILDLSNNSIDVVPPEALS 239

Query: 243  RLSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPELFNQSRDLKEVYLQN 302
             L +L++LYL GN ++ LAD AL+GL SLTVL+L+ N LVN+PPELF+  +DLKE+YLQN
Sbjct: 240  GLLKLKKLYLNGNGMSLLADRALEGLISLTVLSLNNNKLVNLPPELFSDKKDLKELYLQN 299

Query: 303  NSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSI 362
            NSINVLAPG+FN LTQLIVLDLS NELT EWVN+ATF+G+  LVVL+++YN+++KL+ S+
Sbjct: 300  NSINVLAPGLFNDLTQLIVLDLSRNELTSEWVNSATFTGMLHLVVLDVSYNRISKLEPSL 359

Query: 363  FKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTALSVLSL 422
            F+DLYRLQ+L LE N IESI  NTF+SL NLHTLI+SNN+L  IES +   L  LS+LSL
Sbjct: 360  FRDLYRLQILKLEGNVIESIPENTFSSLYNLHTLILSNNRLSVIESYTFSGLYVLSLLSL 419

Query: 423  DNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITEINNLSL 482
            DNN++E I+  ALKNS+SLQD HLNGNKL E+P VL ++  LKTLDLG+N IT I N + 
Sbjct: 420  DNNDIESIDPQALKNSSSLQDLHLNGNKLLEVPLVLSDVPLLKTLDLGENHITNIANSTF 479

Query: 483  NSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLD 542
              +  + GLRLTENNI NISKG+F+K+S L ILNL+ NKIQKVE G FDNN  L AIRLD
Sbjct: 480  GQMQHMYGLRLTENNIGNISKGIFDKMSSLKILNLSRNKIQKVEPGAFDNNVKLQAIRLD 539

Query: 543  GNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIES 602
            GNYL+DIGGLF KLPNL+WLNIS+N LEWFDYALIP  LQWLDIH N+I+ELGNYFEIES
Sbjct: 540  GNYLSDIGGLFAKLPNLIWLNISDNRLEWFDYALIPTGLQWLDIHANRITELGNYFEIES 599

Query: 603  QLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRL 662
             LRL+ FDAS+NKLTE+TG+AIP SVE LFL +NLISKVQ YTFF KPNLTRVDL GN++
Sbjct: 600  HLRLSTFDASANKLTEITGSAIPDSVELLFLNDNLISKVQSYTFFKKPNLTRVDLYGNKI 659

Query: 663  KNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQ-SYSVNKERNKPNLVDLDTVT 721
             ++N  +LRIS +P+ K +P+FYIG NP++CDC M+WLQ S   N+ RN+P L+DL+++ 
Sbjct: 660  TSLNPNSLRISAVPADKLLPEFYIGGNPYECDCTMEWLQKSNQENRARNQPKLMDLESIY 719

Query: 722  CKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSW 781
            CKL+YNR    I L E  S++FLC+YE +C  LCHCCDFDACDC+MTCPNNCTCYHD SW
Sbjct: 720  CKLMYNRGRSYIPLVEVESSRFLCQYEFHCFALCHCCDFDACDCKMTCPNNCTCYHDQSW 779

Query: 782  EANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVET 841
             ANV+DC+  GY N LP RIPMDAT+LYLDGN +  +GSH+FIGRKKL+IL++NSS++E 
Sbjct: 780  SANVVDCTAKGYVNALPERIPMDATQLYLDGNDLQAIGSHAFIGRKKLKILYMNSSNIEI 839

Query: 842  IHNKTFNGLKELIILRLDDNRLTEIRGYEFERLENLRELYLQYNKIIYISNRTFLSLTHL 901
            IHN+TFNGLKEL +LRLD+N L E+ G EFE LENLR+LYLQ NKI+ I+N TFL L HL
Sbjct: 840  IHNRTFNGLKELELLRLDNNNLQELNGQEFEGLENLRQLYLQNNKIVSINNDTFLPLRHL 899

Query: 902  KVLQLDHNRITSFAVWHLSSQIQSITLTSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIR 961
            ++L+LD+N+I  FAVWHLS  + S++L++N WSC+C++T++FR++++ SR ++ D+S I+
Sbjct: 900  EILRLDNNKIKYFAVWHLSPSLTSVSLSNNHWSCECEYTDRFREWIETSRKTITDLSSIK 959

Query: 962  CMTGS------EVGFTIMRTVIPSCNVVSTNVSSHSNNNNNTTTTTTTTTIFIPEHSPMN 1015
            CM  +      E+GF I+     SC +                      TI + +H    
Sbjct: 960  CMKPTNRTDVFEIGFFIVNDNSTSCEI----------------EPIIENTINMTDHI--- 1000

Query: 1016 GSFILSELQPQQDYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLFYKSSE 1075
                       QDY+ LL+  ++A   +++++++I +YRQEMRVWF+SRFGVRLFYKS+E
Sbjct: 1001 -----------QDYLPLLVATMTAFLTIIVVILVIFLYRQEMRVWFYSRFGVRLFYKSTE 1049

Query: 1076 IEMDDRDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQ 1135
            ++ DDRDKLFDAFVSYSSKDEA+VAEELAP+LE+GDP+YKLCLHYR+FPV  +I DTIVQ
Sbjct: 1050 LDRDDRDKLFDAFVSYSSKDEAWVAEELAPMLEHGDPSYKLCLHYRDFPVNAFIADTIVQ 1109

Query: 1136 AVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRG-KKRLIVILLGEVPQKDLDPDIRL 1194
            AVESSRRTIMVLSENFIKSEWCR+EFKSAHHQVLR  +KRLIV+LLGEVPQKDLDPDIRL
Sbjct: 1110 AVESSRRTIMVLSENFIKSEWCRFEFKSAHHQVLRDRRKRLIVVLLGEVPQKDLDPDIRL 1169

Query: 1195 YLKSNTYLQWGDKLFWEKLKFALPDVPNNQRNNNNRNQVRHLN 1237
            YLK+NTYLQWGDKLFWEKL+FALPDVPNNQR    R+ +R+ N
Sbjct: 1170 YLKTNTYLQWGDKLFWEKLRFALPDVPNNQR---TRSSMRNSN 1209




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189234217|ref|XP_972104.2| PREDICTED: similar to vasorin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157107508|ref|XP_001649813.1| toll [Aedes aegypti] gi|108884099|gb|EAT48324.1| AAEL000633-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270002906|gb|EEZ99353.1| tollo [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170072076|ref|XP_001870087.1| vasorin [Culex quinquefasciatus] gi|167868157|gb|EDS31540.1| vasorin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170066864|ref|XP_001868253.1| vasorin [Culex quinquefasciatus] gi|167863061|gb|EDS26444.1| vasorin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|193615415|ref|XP_001948566.1| PREDICTED: slit homolog 3 protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322787490|gb|EFZ13578.1| hypothetical protein SINV_12174 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307215440|gb|EFN90107.1| Protein toll [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332028193|gb|EGI68244.1| Protein toll [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1269
FB|FBgn00291141346 Tollo "Tollo" [Drosophila mela 0.743 0.701 0.505 0.0
FB|FBgn0036494 1514 Toll-6 "Toll-6" [Drosophila me 0.591 0.496 0.480 2.9e-240
FB|FBgn0034476 1446 Toll-7 "Toll-7" [Drosophila me 0.707 0.621 0.413 1.3e-224
FB|FBgn0004364 1389 18w "18 wheeler" [Drosophila m 0.706 0.645 0.399 1e-215
WB|WBGene000065931221 tol-1 [Caenorhabditis elegans 0.490 0.510 0.300 2e-88
FB|FBgn02624731097 Tl "Toll" [Drosophila melanoga 0.128 0.148 0.464 2.6e-65
RGD|1562655987 Tlr13 "toll-like receptor 13" 0.289 0.372 0.280 2.6e-41
ZFIN|ZDB-GENE-040220-4 989 tlr21 "toll-like receptor 21" 0.327 0.420 0.276 4.7e-41
ZFIN|ZDB-GENE-040220-5947 tlr22 "toll-like receptor 22" 0.491 0.658 0.241 6.8e-47
UNIPROTKB|F1ND28972 TLR21 "Uncharacterized protein 0.107 0.140 0.401 2.7e-46
FB|FBgn0029114 Tollo "Tollo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2569 (909.4 bits), Expect = 0., Sum P(2) = 0.
 Identities = 489/968 (50%), Positives = 669/968 (69%)

Query:     1 MMVCPGSVFITVLISALGLVSASISKALRYQAPDECKWFAVTSEGAEIEVPSAAEPDQEV 60
             M+     +++ +    + +  A++SK + YQAPDEC+W    S G E           ++
Sbjct:     1 MLATTHMLYVLIATCVIPIFGAALSKTVLYQAPDECRW----SGGGE----------HDI 46

Query:    61 ALVCKLRTINSEIENTNFSIIQAQYTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVE 120
              LVC LRTINSE+ENTNFS+IQ Q TVRLR+EC D LFFQSSLSP SF++L++L+DL++E
Sbjct:    47 TLVCHLRTINSELENTNFSVIQPQNTVRLRLECNDALFFQSSLSPDSFRSLVELRDLTIE 106

Query:   121 FCKIGNLSAGSFRGXXXXXXXXXXXHNTDWSTMSLDISHNVFTXXXXXXXXXXXXMNSIW 180
             +CK+GNL+ GSFRG           HN DWSTMSL+++ N F             +N+IW
Sbjct:   107 YCKLGNLTDGSFRGLQELRNLTIRTHNGDWSTMSLEMASNSFVEFRQLERLDLS-LNNIW 165

Query:   181 TLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTAR----CGINLRVLDLSNNSFDSL 236
              +PD + CPL+SL +LN + NK+ +++ F FS   ++R    CG  L+ LDLS N   SL
Sbjct:   166 LIPDGMVCPLKSLQHLNASYNKIQDISNFYFSASLSSRKARVCGSTLQSLDLSANKMVSL 225

Query:   237 PAEGFSRLSRLQELYLQGNILTFLADHALDGXXXXXXXXXXXXXXXXIPPELFNQSRDLK 296
             P    S L RL  L +  N ++FLAD A +G                +PPELF +++ L+
Sbjct:   226 PTAMLSALGRLTHLNMAKNSMSFLADRAFEGLLSLRVVDLSANRLTSLPPELFAETKQLQ 285

Query:   297 EVYLQNNSINVLAPGIFNVLTQLIVLDLSNNELTEEWVNAATFSGLHRLVVLNIAYNKMN 356
             E+YL+NNSINVLAPGIF  L +L+VLDL++NEL  +W+NAATF GL RL++L+++ NK++
Sbjct:   286 EIYLRNNSINVLAPGIFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLDLSANKIS 345

Query:   357 KLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKRIESNSLDSLTA 416
             +L++ IF+ L  LQ+L LE+N I+ +    FA L+NLHTLI+S N++  IE  +L  L  
Sbjct:   346 RLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQGLKN 405

Query:   417 LSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEIPKVLRNLHSLKTLDLGDNLITE 476
             L VLSLD N +  +++ +L N + LQD HLN NKL  +P+ L ++  LKTLD+G+N+I++
Sbjct:   406 LLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQAVPEALAHVQLLKTLDVGENMISQ 465

Query:   477 INNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNL 536
             I N S+  L  L GLR+TEN++++I +GVF+++S L ILNL+ NK++ +EAG+   NS L
Sbjct:   466 IENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRNSQL 525

Query:   537 VAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGN 596
              AIRLDGN L  I GLF +LPNLVWLNIS N LE FDY+ IP  LQWLD+  N+I++LGN
Sbjct:   526 QAIRLDGNQLKSIAGLFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGN 585

Query:   597 YFEIESQLRLTYFDASSNKLTELTGNAIPHSVENLFLTNNLISKVQPYTFFMKPNLTRVD 656
             YFEIES+L L+ FDAS N LTE+T ++IP+SVE L+L +N ISK+QPYTFF KPNLTRVD
Sbjct:   586 YFEIESELSLSTFDASYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVD 645

Query:   657 LVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQSYSVNKE-RNKPNLV 715
             LV NRL  +   ALR+SP+   + IP+FYIG N ++CDCN+ WLQ   VN+E R +P L+
Sbjct:   646 LVRNRLTTLEPNALRLSPIAEDREIPEFYIGHNAYECDCNLDWLQK--VNRESRTQPQLM 703

Query:   716 DLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTC 775
             DLD + C+L Y R +  + L EA S+ FLC+Y ++C  LCHCCDF ACDC+M CP+ C+C
Sbjct:   704 DLDQIHCRLAYARGSSHVSLIEAKSDDFLCKYASHCFALCHCCDFQACDCKMECPDRCSC 763

Query:   776 YHDVSWEANVIDCSTGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLN 835
             YHD SW +NV+DCS   Y+  LP  IPMD+T+LYLDGN    + SH+FIGRK+L++L LN
Sbjct:   764 YHDQSWTSNVVDCSRASYEQTLPSHIPMDSTQLYLDGNNFRELQSHAFIGRKRLKVLHLN 823

Query:   836 SSHVETIHNKTFNGLKELIILRLDDNRLTEIRGYEFERLENLRELYLQYNKIIYISNRTF 895
              S +E +HN+TF GL EL +L+L  N+L  + G EF+ L+NL+ELYLQ+N I  I   TF
Sbjct:   824 HSRIEVLHNRTFYGLLELEVLQLQSNQLKALNGNEFQGLDNLQELYLQHNAIATIDTLTF 883

Query:   896 LSLTHLKVLQLDHNRITSFAVWH-LSSQIQSITLTSNPWSCDCDFTEKFRDYLQRSRSSV 954
               L HLK+L+LDHN ITSFAVW+ L S +  + L SNPW+C C+F +K RDY+ R    V
Sbjct:   884 THLYHLKILRLDHNAITSFAVWNFLPSYLNELRLASNPWTCSCEFIDKLRDYINRHEYVV 943

Query:   955 HDISQIRC 962
              D  +++C
Sbjct:   944 -DKLKMKC 950


GO:0005886 "plasma membrane" evidence=ISS
GO:0004888 "transmembrane signaling receptor activity" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=ISS
GO:0006952 "defense response" evidence=NAS
GO:0016021 "integral to membrane" evidence=ISS
GO:0007352 "zygotic specification of dorsal/ventral axis" evidence=IEA
GO:0006963 "positive regulation of antibacterial peptide biosynthetic process" evidence=IEA
GO:0050830 "defense response to Gram-positive bacterium" evidence=IEA
GO:0008063 "Toll signaling pathway" evidence=IEA
GO:0009620 "response to fungus" evidence=IEA
GO:0060049 "regulation of protein glycosylation" evidence=IMP
GO:0048935 "peripheral nervous system neuron development" evidence=IMP
GO:0002227 "innate immune response in mucosa" evidence=IMP
FB|FBgn0036494 Toll-6 "Toll-6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034476 Toll-7 "Toll-7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004364 18w "18 wheeler" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006593 tol-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0262473 Tl "Toll" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1562655 Tlr13 "toll-like receptor 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040220-4 tlr21 "toll-like receptor 21" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040220-5 tlr22 "toll-like receptor 22" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND28 TLR21 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1269
smart00255140 smart00255, TIR, Toll - interleukin 1 - resistance 5e-35
pfam01582135 pfam01582, TIR, TIR domain 8e-27
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-23
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-17
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-17
pfam13676102 pfam13676, TIR_2, TIR domain 5e-16
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-16
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-12
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 7e-06
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 4e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
PHA03420137 PHA03420, PHA03420, E4 protein; Provisional 0.002
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.002
PLN032101153 PLN03210, PLN03210, Resistant to P 0.003
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance Back     alignment and domain information
 Score =  130 bits (328), Expect = 5e-35
 Identities = 48/141 (34%), Positives = 68/141 (48%), Gaps = 9/141 (6%)

Query: 1085 FDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTI 1144
            +D F+SYS K+   V  E    L      Y LC+   +F  GG   + I +A+E SR  I
Sbjct: 2    YDVFISYSGKE--DVRNEFLSHLLEKLRGYGLCVFIDDFEPGGGDLEEIDEAIEKSRIAI 59

Query: 1145 MVLSENFIKSEWCRYEFKSAHHQVLR-GKKRLIVILLGEVPQ--KDLDPDIRLYLKSNTY 1201
            +VLS N+ +SEWC  E  +A    L  G  R+I I    +P   +      R   K N Y
Sbjct: 60   VVLSPNYAESEWCLDELVAALENALEEGGLRVIPIFYEVIPSDVRKQPGKFRKVFKKN-Y 118

Query: 1202 LQWGDKL---FWEKLKFALPD 1219
            L+W +     FW+K  +A+P 
Sbjct: 119  LKWPEDEKEQFWKKALYAVPS 139


Length = 140

>gnl|CDD|216585 pfam01582, TIR, TIR domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|222311 pfam13676, TIR_2, TIR domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|177648 PHA03420, PHA03420, E4 protein; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1269
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194|consensus873 100.0
KOG4194|consensus873 100.0
KOG4237|consensus498 100.0
KOG0472|consensus565 99.98
KOG4237|consensus498 99.97
KOG0472|consensus565 99.97
KOG0618|consensus1081 99.96
KOG0618|consensus1081 99.96
KOG0444|consensus 1255 99.94
KOG0444|consensus1255 99.93
PF01582141 TIR: TIR domain; InterPro: IPR000157 In Drosophila 99.93
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.85
smart00255140 TIR Toll - interleukin 1 - resistance. 99.84
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PLN032101153 Resistant to P. syringae 6; Provisional 99.81
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.61
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.56
PLN03194187 putative disease resistance protein; Provisional 99.47
PF13676102 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ 99.35
KOG0617|consensus264 99.29
KOG0617|consensus264 99.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.25
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG3207|consensus505 99.05
KOG1909|consensus382 99.04
KOG1259|consensus490 99.04
KOG3207|consensus505 98.97
KOG0531|consensus414 98.97
KOG0531|consensus414 98.95
PLN03150623 hypothetical protein; Provisional 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
KOG1259|consensus490 98.93
KOG1909|consensus382 98.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.79
KOG0532|consensus722 98.76
KOG0532|consensus722 98.73
KOG4658|consensus889 98.64
KOG4658|consensus889 98.33
KOG1859|consensus 1096 98.3
PLN03150623 hypothetical protein; Provisional 98.22
KOG1644|consensus233 98.12
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 98.1
KOG1859|consensus 1096 98.1
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.08
KOG1644|consensus233 98.07
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.06
KOG4579|consensus177 98.05
PF08937130 DUF1863: MTH538 TIR-like domain (DUF1863); InterPr 98.05
KOG2982|consensus418 98.04
KOG3678|consensus832 97.98
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.97
PRK15386426 type III secretion protein GogB; Provisional 97.91
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.9
KOG2120|consensus419 97.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
PRK15386426 type III secretion protein GogB; Provisional 97.77
KOG2982|consensus418 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.75
KOG2120|consensus419 97.71
KOG4579|consensus177 97.7
PF08357150 SEFIR: SEFIR domain; InterPro: IPR013568 This doma 97.6
KOG4341|consensus483 97.59
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 97.35
KOG4341|consensus483 97.25
KOG3665|consensus699 97.07
KOG3665|consensus699 96.83
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 96.82
KOG2123|consensus388 96.39
KOG2123|consensus388 96.26
PF10137125 TIR-like: Predicted nucleotide-binding protein con 96.05
KOG1947|consensus482 95.88
smart0001333 LRRNT Leucine rich repeat N-terminal domain. 95.73
KOG2739|consensus260 95.57
KOG2739|consensus260 95.41
KOG1947|consensus482 95.19
PF0146228 LRRNT: Leucine rich repeat N-terminal domain; Inte 94.47
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.93
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.59
smart0037026 LRR Leucine-rich repeats, outliers. 93.59
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 93.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.11
smart0037026 LRR Leucine-rich repeats, outliers. 92.19
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.19
KOG4308|consensus478 90.5
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.4
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.29
KOG0473|consensus326 90.27
KOG4308|consensus478 88.85
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1e-47  Score=509.91  Aligned_cols=535  Identities=25%  Similarity=0.267  Sum_probs=304.8

Q ss_pred             ceeEEEEEeCCceeeccCCCchhccCCcccceeEeccccCC-CCChhhccCCccCceeecccccCCCCccceeccchhhh
Q psy5670          85 YTVRLRIECGDMLFFQSSLSPGSFQTLIDLKDLSVEFCKIG-NLSAGSFRGLRKLKTLTLRTHNTDWSTMSLDISHNVFT  163 (1269)
Q Consensus        85 ~~~~L~L~~~~~~~~~~~i~~~~f~~l~~L~~L~L~~~~i~-~i~~~~f~~l~~L~~L~L~~~~~~~~~~~~~i~~~~f~  163 (1269)
                      +++.|+|+++.+    +...+.+|..+++|++|+|++|++. .+|...|.++++|++|+|++|+..     ..+ |.   
T Consensus        70 ~v~~L~L~~~~i----~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~-----~~~-p~---  136 (968)
T PLN00113         70 RVVSIDLSGKNI----SGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFT-----GSI-PR---  136 (968)
T ss_pred             cEEEEEecCCCc----cccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccc-----ccc-Cc---
Confidence            477888888873    3333558889999999999999885 576666667777777777654431     011 11   


Q ss_pred             hcCCCCCEEEccCCCCccCCcccCCCCCCCcEEECCCCCCCCCCccccCCCCcccCCCcccEEEcCCCCCCccCcccCCC
Q psy5670         164 DELQSLESLDLSMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNNSFDSLPAEGFSR  243 (1269)
Q Consensus       164 ~~l~~L~~L~Ls~n~l~~l~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~  243 (1269)
                      +.+++|++|+|++|.+....+..++.+++|++|+|++|.+.+..+..+..      +++|++|+|++|.+....+..+++
T Consensus       137 ~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~------l~~L~~L~L~~n~l~~~~p~~l~~  210 (968)
T PLN00113        137 GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTN------LTSLEFLTLASNQLVGQIPRELGQ  210 (968)
T ss_pred             cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhh------CcCCCeeeccCCCCcCcCChHHcC
Confidence            34566777777777666433334566666666666666665444433322      456666666666665554455666


Q ss_pred             CCCCCEEEccCCCCcccchhhhcCCCCCcEEEccCCCCCCCCcccccCCCCCcEEEeeCCcccccCcccccCCCCCCEEE
Q psy5670         244 LSRLQELYLQGNILTFLADHALDGLNSLTVLNLSVNNLVNIPPELFNQSRDLKEVYLQNNSINVLAPGIFNVLTQLIVLD  323 (1269)
Q Consensus       244 l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~l~~~~f~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~  323 (1269)
                      +++|++|++++|.+.+..+..++++++|++|++++|.+....+..|.++++|++|++++|.+.+..|..+.++++|++|+
T Consensus       211 l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  290 (968)
T PLN00113        211 MKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLD  290 (968)
T ss_pred             cCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEE
Confidence            66666666666666655555566666666666666655544444455555666666665555554455555555555555


Q ss_pred             CcCCCCCccccCcccccCCCCccEEEcCCCCCcccCchhhcCCCCCcEEEccCCcccccccccccCCCCCcEEEccCCcc
Q psy5670         324 LSNNELTEEWVNAATFSGLHRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKL  403 (1269)
Q Consensus       324 L~~n~l~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~i~~~~f~~l~~L~~L~Ls~n~l  403 (1269)
                      +++|.+.+  ..+..+.++++|+.|++++|.+.+..+..+..+++|+.|++++|.+                        
T Consensus       291 Ls~n~l~~--~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l------------------------  344 (968)
T PLN00113        291 LSDNSLSG--EIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKF------------------------  344 (968)
T ss_pred             CcCCeecc--CCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCC------------------------
Confidence            55555543  1233444455555555555555444444444444444444444444                        


Q ss_pred             cccCcccccCCCCCCEEEccCCCCCccChhhhcCCCCCcEEEccCCCCC-CchhhhcCCCCCcEEECCCCCCCccChhhh
Q psy5670         404 KRIESNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLT-EIPKVLRNLHSLKTLDLGDNLITEINNLSL  482 (1269)
Q Consensus       404 ~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~l~-~lp~~l~~l~~L~~L~Ls~n~i~~~~~~~~  482 (1269)
                      .+..+..+..+++|+.|++++|.+.+..+..+..+++|+.|++++|.+. .+|..+..+++|+.|++++|.+++..+..+
T Consensus       345 ~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~  424 (968)
T PLN00113        345 SGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF  424 (968)
T ss_pred             cCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhH
Confidence            4444444444444444444444444444444444445555555555443 344444555555555555555555444455


Q ss_pred             hccccCCeeeccCCcCCCCChhhhcCCCCCCEEEcCCCccccccccccCCCCCccEEEcccccccc-cCCcCCCCCCCcE
Q psy5670         483 NSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLDGNYLTD-IGGLFPKLPNLVW  561 (1269)
Q Consensus       483 ~~l~~L~~L~Ls~n~l~~i~~~~f~~l~~L~~L~Ls~n~i~~~~~~~~~~~~~L~~L~L~~n~l~~-l~~~~~~l~~L~~  561 (1269)
                      ..++.|+.|++++|.+....+..+..+++|+.|++++|++.+..+..+ ..++|+.|++++|+++. +|..+..+++|+.
T Consensus       425 ~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~  503 (968)
T PLN00113        425 TKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQ  503 (968)
T ss_pred             hcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCE
Confidence            555555555555555533333334455555555665555555444333 23556666666665552 3444555555555


Q ss_pred             EEccCCcCccccccccCCCccEEECCCCCcccccccccccccccccEEEcCCCccccccCCccc--CCccEEEccCcccc
Q psy5670         562 LNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIP--HSVENLFLTNNLIS  639 (1269)
Q Consensus       562 L~Ls~n~l~~~~~~~lp~~L~~L~Ls~n~l~~~~~~~~l~~~~~L~~LdLs~N~l~~~~~~~~~--~~L~~L~Ls~N~i~  639 (1269)
                      |++++|++..    .+|.                   .+..+++|++|+|++|.+++..+..+.  ++|+.|+|++|+++
T Consensus       504 L~Ls~N~l~~----~~p~-------------------~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~  560 (968)
T PLN00113        504 LKLSENKLSG----EIPD-------------------ELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLS  560 (968)
T ss_pred             EECcCCccee----eCCh-------------------HHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCccc
Confidence            5555554441    1111                   123345667777777777665554443  47888888888888


Q ss_pred             cccCCccCCCCCccEEEcCCCCcccccccccccccCCCCCCCCceEecCCccccc
Q psy5670         640 KVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCD  694 (1269)
Q Consensus       640 ~~~~~~f~~~~~L~~LdLs~N~l~~l~~~~~~~~~~~~~~~l~~l~l~~Np~~c~  694 (1269)
                      +..|..+.++++|+.|++++|++.+.-+..-      ....+....+.+||..|.
T Consensus       561 ~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~------~~~~~~~~~~~~n~~lc~  609 (968)
T PLN00113        561 GEIPKNLGNVESLVQVNISHNHLHGSLPSTG------AFLAINASAVAGNIDLCG  609 (968)
T ss_pred             ccCChhHhcCcccCEEeccCCcceeeCCCcc------hhcccChhhhcCCccccC
Confidence            8888888888999999999999886333211      111233345678887774



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>smart00255 TIR Toll - interleukin 1 - resistance Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF10137 TIR-like: Predicted nucleotide-binding protein containing TIR-like domain; InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>smart00013 LRRNT Leucine rich repeat N-terminal domain Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>PF01462 LRRNT: Leucine rich repeat N-terminal domain; InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1269
1o77_A146 Crystal Structure Of The C713s Mutant Of The Tir Do 1e-20
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-20
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-16
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-12
1fyv_A161 Crystal Structure Of The Tir Domain Of Human Tlr1 L 3e-20
1fyx_A149 Crystal Structure Of P681h Mutant Of Tir Domain Of 1e-19
1fyw_A149 Crystal Structure Of The Tir Domain Of Human Tlr2 L 1e-18
2j67_A178 The Tir Domain Of Human Toll-Like Receptor 10 (Tlr1 5e-18
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 8e-18
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 3e-16
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 3e-06
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-17
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-12
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 7e-10
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-17
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-12
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 8e-10
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 4e-16
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-10
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 6e-10
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 4e-16
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-10
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 6e-10
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 9e-16
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 4e-09
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-08
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 1e-15
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 1e-14
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 2e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 1e-15
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 1e-14
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 2e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 4e-15
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-14
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 2e-14
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 2e-14
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 2e-10
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 2e-04
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 5e-14
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 2e-13
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-13
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-07
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 2e-13
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 6e-13
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 3e-12
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 1e-09
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 3e-06
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 1e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 2e-12
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 5e-12
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-11
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 9e-12
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 9e-12
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-11
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 1e-11
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 9e-06
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 1e-11
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 8e-06
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 1e-11
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 2e-05
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 1e-11
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 1e-05
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 2e-11
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 1e-05
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 3e-11
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 6e-10
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 5e-09
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 4e-11
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-05
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 8e-11
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 2e-10
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 9e-11
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 1e-10
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 1e-10
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 1e-07
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 2e-05
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 1e-10
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 1e-07
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 2e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 1e-10
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 1e-10
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 2e-07
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 2e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-10
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 5e-10
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-10
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 4e-05
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 2e-10
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 3e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 4e-10
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 1e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 7e-10
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 9e-10
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 4e-09
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-09
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-08
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 4e-05
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 1e-08
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 1e-08
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 3e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 6e-05
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 1e-08
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-06
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 1e-08
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 4e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 7e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-08
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-07
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 1e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-08
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 4e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 1e-04
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 2e-08
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 3e-08
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-08
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 6e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-08
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 4e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 2e-08
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 1e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 1e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 3e-08
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 1e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 3e-08
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 5e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 3e-08
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 9e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 3e-08
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 9e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 4e-08
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 7e-05
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 4e-08
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 9e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 5e-08
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-07
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-04
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 1e-07
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 1e-06
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 2e-07
2z64_A 599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 4e-04
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 2e-07
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 4e-06
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 2e-07
3vq1_A 606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 4e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 3e-07
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 6e-05
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 7e-07
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 8e-07
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 7e-04
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 1e-06
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 1e-05
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 2e-06
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 2e-06
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-05
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-05
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 4e-04
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 5e-04
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 2e-06
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-05
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-05
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-04
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 2e-06
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 3e-06
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 3e-05
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 6e-05
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 4e-05
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 8e-05
3rgx_A768 Structural Insight Into Brassinosteroid Perception 9e-05
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-04
3ub4_A146 S180l Variant Of Tir Domain Of MalTIRAP Length = 14 1e-04
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 1e-04
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 7e-04
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 2e-04
3ub2_A146 Tir Domain Of MalTIRAP Length = 146 2e-04
2y92_A145 Crystal Structure Of Mal Adaptor Protein Length = 1 2e-04
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 6e-04
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 3e-04
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 8e-04
3ub3_A146 D96n Variant Of Tir Domain Of MalTIRAP Length = 146 7e-04
>pdb|1O77|A Chain A, Crystal Structure Of The C713s Mutant Of The Tir Domain Of Human Tlr2 Length = 146 Back     alignment and structure

Iteration: 1

Score = 99.4 bits (246), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 49/124 (39%), Positives = 75/124 (60%), Gaps = 4/124 (3%) Query: 1085 FDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTI 1144 +DAFVSYS +D +V + LEN +P +KLCLH R+F G +I D I+ ++E S +T+ Sbjct: 3 YDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV 62 Query: 1145 MVLSENFIKSEWCRYEFKSAHHQVLRGKKRLIVILLGEVPQKDLDPD----IRLYLKSNT 1200 VLSENF+KSEW +YE +H ++ +++L E +K P +R + + T Sbjct: 63 FVLSENFVKSEWSKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKT 122 Query: 1201 YLQW 1204 YL+W Sbjct: 123 YLEW 126
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1FYV|A Chain A, Crystal Structure Of The Tir Domain Of Human Tlr1 Length = 161 Back     alignment and structure
>pdb|1FYX|A Chain A, Crystal Structure Of P681h Mutant Of Tir Domain Of Human Tlr2 Length = 149 Back     alignment and structure
>pdb|1FYW|A Chain A, Crystal Structure Of The Tir Domain Of Human Tlr2 Length = 149 Back     alignment and structure
>pdb|2J67|A Chain A, The Tir Domain Of Human Toll-Like Receptor 10 (Tlr10) Length = 178 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3UB4|A Chain A, S180l Variant Of Tir Domain Of MalTIRAP Length = 146 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3UB2|A Chain A, Tir Domain Of MalTIRAP Length = 146 Back     alignment and structure
>pdb|2Y92|A Chain A, Crystal Structure Of Mal Adaptor Protein Length = 145 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|3UB3|A Chain A, D96n Variant Of Tir Domain Of MalTIRAP Length = 146 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1269
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-147
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-91
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-80
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-60
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-117
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-81
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-77
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-113
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-80
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-84
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-58
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-42
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-91
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-66
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-89
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-75
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-64
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-55
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-81
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-72
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-68
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-65
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-64
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-73
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-54
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-53
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-47
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-47
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-72
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-67
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-65
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-56
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-48
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-72
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-51
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-49
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-47
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-39
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-32
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-28
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-70
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-68
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-49
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-68
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-64
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-58
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-55
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-66
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-62
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-57
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-52
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-41
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-65
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-59
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-57
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-44
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-64
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-62
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-59
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-57
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-51
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-36
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-60
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-54
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-39
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-28
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-58
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-56
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-47
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-46
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-42
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-41
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-38
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-31
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-58
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-57
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-47
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-46
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-43
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-40
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-37
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-29
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-57
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-47
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-43
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-57
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-56
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-54
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-52
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-49
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-35
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-55
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-53
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-53
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-51
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-43
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-40
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-38
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-54
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-54
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-51
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-51
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-49
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-47
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-41
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-54
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-46
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-43
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-32
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-29
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-14
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 2e-54
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-53
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-38
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-37
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-53
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-47
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-47
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-45
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-45
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-33
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-16
2js7_A160 Myeloid differentiation primary response protein M 6e-52
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 9e-52
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-51
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-48
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-46
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-42
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-41
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-40
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-31
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 7e-50
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-45
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-43
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-40
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-35
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-34
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-33
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-22
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-42
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-38
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-37
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-34
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-30
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 8e-42
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-41
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-39
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-35
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-35
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-33
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-41
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-37
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-35
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-34
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-28
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-26
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-41
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-40
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-34
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-31
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-30
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-29
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-26
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-22
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-20
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-36
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-32
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-27
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-26
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-25
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-24
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-36
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-22
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-35
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-27
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-23
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-35
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-35
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-31
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-26
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-23
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-21
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-35
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-26
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-26
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-24
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-18
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-35
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-32
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-34
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-30
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-32
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-29
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-24
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-22
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-20
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-19
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-31
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-27
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-29
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-29
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-28
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-24
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-29
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-26
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-27
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-26
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-26
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-25
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-21
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-20
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-17
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-21
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-20
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-20
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-17
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-24
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-18
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-24
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-19
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-17
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-17
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-16
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-24
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-23
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-23
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-22
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-21
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-19
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-17
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-17
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-21
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-19
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-19
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-19
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-19
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-17
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-15
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-15
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-15
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-19
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-15
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-16
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-15
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-14
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-12
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-12
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 4e-07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 1e-06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 2e-06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 4e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 2e-06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 2e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 6e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 7e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 9e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 2e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 8e-04
4fdw_A401 Leucine rich hypothetical protein; putative cell s 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-06
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 1e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 5e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-04
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
 Score =  464 bits (1196), Expect = e-147
 Identities = 163/931 (17%), Positives = 325/931 (34%), Gaps = 126/931 (13%)

Query: 349  NIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLKR-IE 407
             IA+ +   L + + + L   + L L  N I ++  ++F  L  L  L + +      I+
Sbjct: 7    RIAFYRFCNL-TQVPQVLNTTERLLLSFNYIRTVTASSFPFLEQLQLLELGSQYTPLTID 65

Query: 408  SNSLDSLTALSVLSLDNNELEYIEENALKNSTSLQDFHLNGNKLTEI---PKVLRNLHSL 464
              +  +L  L +L L ++++ ++  +A +    L +  L    L++        RNL +L
Sbjct: 66   KEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYFCGLSDAVLKDGYFRNLKAL 125

Query: 465  KTLDLGDNLITEIN-NLSLNSLHQLAGLRLTENNISNISKGVFEKLSV--LTILNLASNK 521
              LDL  N I  +  + S   L+ L  +  + N I  + +   E L    L+  +LA+N 
Sbjct: 126  TRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQIFLVCEHELEPLQGKTLSFFSLAANS 185

Query: 522  IQKVEAGTFDNNSN-LVAIRLDGNYLTDIGGLFPKLPNLVWLNISENLLEWFDYALIPAD 580
            +    +  +    N    + L+   ++  G     +       IS++             
Sbjct: 186  LYSRVSVDWGKCMNPFRNMVLEILDVSGNG-WTVDITGNFSNAISKSQAFSLIL---AHH 241

Query: 581  LQWLDIHGNQISELG-NYFEIESQLRLTYFDASSNKLTELTGNAIPH--SVENLFLTNNL 637
            +       + I +   N F   ++  + + D S   +  L          ++ L L  N 
Sbjct: 242  IMGAGFGFHNIKDPDQNTFAGLARSSVRHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNK 301

Query: 638  ISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNM 697
            I+K+    F+   NL  ++L  N L  +  +            +    + +N        
Sbjct: 302  INKIADEAFYGLDNLQVLNLSYNLLGELYSSNFY-----GLPKVAYIDLQKNH------- 349

Query: 698  QWLQSYSVNKERNKPNLVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHC 757
              +        +    L  LD     L  N                          L   
Sbjct: 350  --IAIIQDQTFKFLEKLQTLD-----LRDNA-------------------------LTTI 377

Query: 758  CDFDACDCEMTCPNNCTCYHDVSWEANVIDCSTGGYDNQLPPRIPMDA---TELYLDGNR 814
                +        N       ++  AN+I  S    +N       +       L L+ NR
Sbjct: 378  HFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYFLLRVPHLQILILNQNR 437

Query: 815  IPVV-GSHSFIGRKKLQILFLNSSHVE-----TIHNKTFNGLKELIILRLDDNRLTEIRG 868
                 G  +      L+ LFL  + ++      +    F GL  L +L L+ N L  +  
Sbjct: 438  FSSCSGDQTPSENPSLEQLFLGENMLQLAWETELCWDVFEGLSHLQVLYLNHNYLNSLPP 497

Query: 869  YEFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVWHLSSQIQSITL 928
              F  L  LR L L  N++  +S+    +  +L++L +  N++ +       S +  + +
Sbjct: 498  GVFSHLTALRGLSLNSNRLTVLSHNDLPA--NLEILDISRNQLLAPNPDVFVS-LSVLDI 554

Query: 929  TSNPWSCDCDFTEKFRDYLQRSRSSVHDISQIRCMTGSEV-GFTIMRTVIPSCNVVSTNV 987
            T N + C+C+ +         + +     + I C+      G ++       C+      
Sbjct: 555  THNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCD------ 608

Query: 988  SSHSNNNNNTTTTTTTTTIFIPEHSPMNGSFILSELQPQQDYVFLLIILVSASFVLVLLL 1047
                                                +     +   + +V    + + L+
Sbjct: 609  -----------------------------------EEEVLKSLKFSLFIVCTVTLTLFLM 633

Query: 1048 ILIIIYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPIL 1107
             ++ + +     +   +   RL +K      +     +DA++ +SSKD  +V   L   L
Sbjct: 634  TILTVTKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHL 693

Query: 1108 EN---GDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSA 1164
            +        + LC   R+F  G      I  A+ +SR+ + ++S +F++  WC   F  A
Sbjct: 694  DTQYSDQNRFNLCFEERDFVPGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYA 753

Query: 1165 HHQVLRGKK-RLIVILLGEVPQKDL--DPDIRLYLKSNTYLQWGDK-----LFWEKLKFA 1216
              + L      LI++++G + Q  L     IR +++   YL+W +       F  KL   
Sbjct: 754  QGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDFQDVGWFLHKLSQQ 813

Query: 1217 LPDVPNNQRNNNNRN-QVRHLNHSAHHHNHN 1246
            +      ++ +NN   Q       +HHH+H+
Sbjct: 814  ILKKEKEKKKDNNIPLQTVATISGSHHHHHH 844


>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Length = 160 Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Length = 149 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1269
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 99.97
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2js7_A160 Myeloid differentiation primary response protein M 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.91
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.9
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.87
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.83
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.76
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.75
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.74
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.74
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.74
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.68
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.68
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.67
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.66
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.65
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 99.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.62
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 99.62
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.54
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.5
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.4
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 99.39
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.03
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.52
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.49
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.45
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.76
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.42
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.35
1eiw_A111 Hypothetical protein MTH538; CHEY-like fold, flavo 97.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.61
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.43
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 92.97
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 92.63
3hyn_A189 Putative signal transduction protein; DUF1863 fami 91.33
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.2e-89  Score=895.80  Aligned_cols=786  Identities=22%  Similarity=0.336  Sum_probs=451.2

Q ss_pred             EEEccCCCCccCCcccCCCCCCCcEEECCCCCCCCCCccccCCCCcccCCCcccEEEcCCC-CCCccCcccCCCCCCCCE
Q psy5670         171 SLDLSMNSIWTLPDAIFCPLQSLSYLNLTQNKLSNVATFSFSNYDTARCGINLRVLDLSNN-SFDSLPAEGFSRLSRLQE  249 (1269)
Q Consensus       171 ~L~Ls~n~l~~l~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~l~~L~~L~Ls~n-~l~~~~~~~~~~l~~L~~  249 (1269)
                      ..+.++++++.+|.    ..++|++|+|++|.++.+.+..|..      +++|++|+|++| .+..+++.+|+++++|++
T Consensus         8 ~~dcs~~~L~~vP~----lp~~l~~LdLs~N~i~~i~~~~~~~------l~~L~~LdLs~n~~~~~i~~~~f~~L~~L~~   77 (844)
T 3j0a_A            8 IAFYRFCNLTQVPQ----VLNTTERLLLSFNYIRTVTASSFPF------LEQLQLLELGSQYTPLTIDKEAFRNLPNLRI   77 (844)
T ss_dssp             EEEESCCCSSCCCS----SCTTCCEEEEESCCCCEECSSSCSS------CCSCSEEEECTTCCCCEECTTTTSSCTTCCE
T ss_pred             EEEccCCCCCCCCC----CCCCcCEEECCCCcCCccChhHCcc------cccCeEEeCCCCCCccccCHHHhcCCCCCCE
Confidence            45556666666664    2356666666666666555544433      456666666666 333444555666666666


Q ss_pred             EEccCCCCcccchhhhcCCCCCcEEEccCCCCCC--CCcccccCCCCCcEEEeeCCcccccCc-ccccCCCCCCEEECcC
Q psy5670         250 LYLQGNILTFLADHALDGLNSLTVLNLSVNNLVN--IPPELFNQSRDLKEVYLQNNSINVLAP-GIFNVLTQLIVLDLSN  326 (1269)
Q Consensus       250 L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~--l~~~~f~~l~~L~~L~L~~n~l~~~~~-~~~~~l~~L~~L~L~~  326 (1269)
                      |+|++|.+..+.+.+|.++++|++|+|++|.+++  .....|..+++|++|+|++|.++++.+ ..|+++++|++|++++
T Consensus        78 L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~L~~L~~L~Ls~N~l~~~~~~~~~~~L~~L~~L~Ls~  157 (844)
T 3j0a_A           78 LDLGSSKIYFLHPDAFQGLFHLFELRLYFCGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSS  157 (844)
T ss_dssp             EECTTCCCCEECTTSSCSCSSCCCEECTTCCCSSCCSTTCCCSSCSSCCEEEEESCCCCCCCCCGGGGTCSSCCEEEEES
T ss_pred             EECCCCcCcccCHhHccCCcccCEeeCcCCCCCcccccCccccccCCCCEEECCCCcccccccchhHhhCCCCCEEECCC
Confidence            6666666666656666666666666666666554  222235556666666666666555433 3455556666666655


Q ss_pred             CCCCccccCcccccCC--CCccEEEcCCCCCcccCchhhcCCCCCcEEEccCCcccccccccccCCCCCcEEEccCCccc
Q psy5670         327 NELTEEWVNAATFSGL--HRLVVLNIAYNKMNKLDSSIFKDLYRLQVLHLENNQIESIHRNTFASLSNLHTLIMSNNKLK  404 (1269)
Q Consensus       327 n~l~~~~~~~~~~~~l--~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~i~~~~f~~l~~L~~L~Ls~n~l~  404 (1269)
                      |.+.+  ..+..+..+  ++|+.|+++.|.+.+..+..+..+++                 .|.. ..|+.|++++|.+.
T Consensus       158 N~i~~--~~~~~l~~l~~~~L~~L~L~~n~l~~~~~~~~~~~~~-----------------~~~~-~~L~~L~Ls~n~l~  217 (844)
T 3j0a_A          158 NQIFL--VCEHELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMN-----------------PFRN-MVLEILDVSGNGWT  217 (844)
T ss_dssp             SCCCC--CCSGGGHHHHHCSSCCCEECCSBSCCCCCCCCCSSSC-----------------TTTT-CCBSEEBCSSCCSS
T ss_pred             CcCCe--eCHHHcccccCCccceEECCCCccccccccchhhcCC-----------------cccc-CceeEEecCCCcCc
Confidence            55544  223334333  45555555555554433333332222                 0000 01444444444333


Q ss_pred             ccCcccccC---CCCCCEEEccC---------CCCCccChhhhcCC--CCCcEEEccCCCCCCch-hhhcCCCCCcEEEC
Q psy5670         405 RIESNSLDS---LTALSVLSLDN---------NELEYIEENALKNS--TSLQDFHLNGNKLTEIP-KVLRNLHSLKTLDL  469 (1269)
Q Consensus       405 ~~~~~~~~~---l~~L~~L~Ls~---------n~i~~~~~~~~~~l--~~L~~L~Ls~n~l~~lp-~~l~~l~~L~~L~L  469 (1269)
                      +..+..+..   ...++.|.++.         +.+.......|.++  ++|+.|++++|.+..++ ..+..+++|++|++
T Consensus       218 ~~~~~~~~~~l~~~~l~~L~l~~~~~~~~~~~~~l~~~~~~~f~~l~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L  297 (844)
T 3j0a_A          218 VDITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQNTFAGLARSSVRHLDLSHGFVFSLNSRVFETLKDLKVLNL  297 (844)
T ss_dssp             TTTTSGGGGTSCSCCBSEEECCSSCCBCSSSCSSSTTGGGTTTTTTTTSCCCEEECTTCCCCEECSCCSSSCCCCCEEEE
T ss_pred             hhHHHHHHhhcCcccccceecccccccccccccccCCCChhhhhccccCCccEEECCCCcccccChhhhhcCCCCCEEEC
Confidence            322222211   12333444332         22222222333332  34555555555444332 23444455555555


Q ss_pred             CCCCCCccChhhhhccccCCeeeccCCcCCCCChhhhcCCCCCCEEEcCCCccccccccccCCCCCccEEEccccccccc
Q psy5670         470 GDNLITEINNLSLNSLHQLAGLRLTENNISNISKGVFEKLSVLTILNLASNKIQKVEAGTFDNNSNLVAIRLDGNYLTDI  549 (1269)
Q Consensus       470 s~n~i~~~~~~~~~~l~~L~~L~Ls~n~l~~i~~~~f~~l~~L~~L~Ls~n~i~~~~~~~~~~~~~L~~L~L~~n~l~~l  549 (1269)
                      ++|.++++.+..|.++++|+.|+|++|.++.+.+..|.++++|+.|++++|++..+.+..|.++++|+.|++++|.++.+
T Consensus       298 ~~n~i~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~~~~l~~L~~L~Ls~N~l~~i  377 (844)
T 3j0a_A          298 AYNKINKIADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTI  377 (844)
T ss_dssp             ESCCCCEECTTTTTTCSSCCEEEEESCCCSCCCSCSCSSCTTCCEEECCSCCCCCCCSSCSCSCCCCCEEEEETCCSCCC
T ss_pred             CCCcCCCCChHHhcCCCCCCEEECCCCCCCccCHHHhcCCCCCCEEECCCCCCCccChhhhcCCCCCCEEECCCCCCCcc
Confidence            55555544444444445555555555555444444444455555555555555444444444444455555544444433


Q ss_pred             CCcCCCCCCCcEEEccCCcCccccccccCCCccEEECCCCCcccccccccccccccccEEEcCCCccccccCCcccCCcc
Q psy5670         550 GGLFPKLPNLVWLNISENLLEWFDYALIPADLQWLDIHGNQISELGNYFEIESQLRLTYFDASSNKLTELTGNAIPHSVE  629 (1269)
Q Consensus       550 ~~~~~~l~~L~~L~Ls~n~l~~~~~~~lp~~L~~L~Ls~n~l~~~~~~~~l~~~~~L~~LdLs~N~l~~~~~~~~~~~L~  629 (1269)
                      +.    ++                      +|+.|++++|+++.++..     ..+++.|++++|+++++...       
T Consensus       378 ~~----~~----------------------~L~~L~l~~N~l~~l~~~-----~~~l~~L~ls~N~l~~l~~~-------  419 (844)
T 3j0a_A          378 HF----IP----------------------SIPDIFLSGNKLVTLPKI-----NLTANLIHLSENRLENLDIL-------  419 (844)
T ss_dssp             SS----CC----------------------SCSEEEEESCCCCCCCCC-----CTTCCEEECCSCCCCSSTTH-------
T ss_pred             cC----CC----------------------CcchhccCCCCccccccc-----ccccceeecccCccccCchh-------
Confidence            22    33                      455555555555544431     23566777777776654321       


Q ss_pred             EEEccCcccccccCCccCCCCCccEEEcCCCCcccccccccccccCCCCCCCCceEecCCccccccCChhHHhhcccccc
Q psy5670         630 NLFLTNNLISKVQPYTFFMKPNLTRVDLVGNRLKNINQTALRISPLPSHKNIPDFYIGENPFQCDCNMQWLQSYSVNKER  709 (1269)
Q Consensus       630 ~L~Ls~N~i~~~~~~~f~~~~~L~~LdLs~N~l~~l~~~~~~~~~~~~~~~l~~l~l~~Np~~c~c~~~~l~~~~~~~~~  709 (1269)
                                    ..+..+++|+.|+|++|++++++....    ....                               
T Consensus       420 --------------~~~~~l~~L~~L~Ls~N~l~~~~~~~~----~~~~-------------------------------  450 (844)
T 3j0a_A          420 --------------YFLLRVPHLQILILNQNRFSSCSGDQT----PSEN-------------------------------  450 (844)
T ss_dssp             --------------HHHTTCTTCCEEEEESCCCCCCCSSSS----SCSC-------------------------------
T ss_pred             --------------hhhhcCCccceeeCCCCcccccccccc----cccC-------------------------------
Confidence                          112345566666666665554321100    0000                               


Q ss_pred             CCCcccccCccccccccccCCCcccccccCCCccccccccCcccccccccCCCCcccCCCCCCceecCCCCCcceeeecC
Q psy5670         710 NKPNLVDLDTVTCKLLYNRANPAILLKEAHSNQFLCEYETNCAPLCHCCDFDACDCEMTCPNNCTCYHDVSWEANVIDCS  789 (1269)
Q Consensus       710 ~~~~~~~l~~~~c~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~cp~~C~c~~~~~~~~~~v~c~  789 (1269)
                                                                                                      
T Consensus       451 --------------------------------------------------------------------------------  450 (844)
T 3j0a_A          451 --------------------------------------------------------------------------------  450 (844)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCccccCCCCCCCCCcEEEecCCCCCCcCCCcCCCCCCccEEEccCcCccccccccccCCCCCCEEeCCCCCCcccCcc
Q psy5670         790 TGGYDNQLPPRIPMDATELYLDGNRIPVVGSHSFIGRKKLQILFLNSSHVETIHNKTFNGLKELIILRLDDNRLTEIRGY  869 (1269)
Q Consensus       790 ~~~l~~~~p~~~p~~~~~l~l~~n~i~~l~~~~f~~~~~L~~L~l~~n~i~~i~~~~f~~l~~L~~L~L~~N~l~~i~~~  869 (1269)
                                   .+++.|++++|.++.+...                   .+.+..|.++++|+.|+|++|+|+.+++.
T Consensus       451 -------------~~L~~L~Ls~N~l~~~~~~-------------------~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~  498 (844)
T 3j0a_A          451 -------------PSLEQLFLGENMLQLAWET-------------------ELCWDVFEGLSHLQVLYLNHNYLNSLPPG  498 (844)
T ss_dssp             -------------TTCCBCEEESCCCSSSCCS-------------------CCCSSCSSCBCCEECCCCCHHHHTTCCTT
T ss_pred             -------------CccccccCCCCcccccccc-------------------ccchhhhcCcccccEEECCCCcccccChh
Confidence                         1122333333333322211                   11123455566666777777777777777


Q ss_pred             cccCCcccCeeecccccCcccChhhhhcCcccceEeccCccceeeecc-cccCCccEEEeeCCcccccCCcHHHHHHHHH
Q psy5670         870 EFERLENLRELYLQYNKIIYISNRTFLSLTHLKVLQLDHNRITSFAVW-HLSSQIQSITLTSNPWSCDCDFTEKFRDYLQ  948 (1269)
Q Consensus       870 ~f~~l~~L~~L~L~~N~l~~i~~~~f~~l~~L~~L~L~~N~l~~~~~~-~~~~~l~~l~l~~Np~~C~C~~~~~~~~w~~  948 (1269)
                      +|.++++|++|+|++|+|+++++..|.  ++|+.|+|++|+|+++++. +  .+++.+++++|||.|+|++ .||..|++
T Consensus       499 ~~~~l~~L~~L~Ls~N~l~~l~~~~~~--~~L~~L~Ls~N~l~~~~~~~~--~~L~~l~l~~Np~~C~c~~-~~f~~~~~  573 (844)
T 3j0a_A          499 VFSHLTALRGLSLNSNRLTVLSHNDLP--ANLEILDISRNQLLAPNPDVF--VSLSVLDITHNKFICECEL-STFINWLN  573 (844)
T ss_dssp             SSSSCCSCSEEEEESCCCSSCCCCCCC--SCCCEEEEEEECCCCCCSCCC--SSCCEEEEEEECCCCSSSC-CSHHHHHH
T ss_pred             HccchhhhheeECCCCCCCccChhhhh--ccccEEECCCCcCCCCChhHh--CCcCEEEecCCCccccccc-HHHHHHHH
Confidence            777777777777777777777776664  6777777777777777776 4  4688999999999999997 69999998


Q ss_pred             hccCCcCc-cCcceeccCCccceeeeeeecCCccccccccccCCCCCCCccccccceeeecCCCCCCCcceeeccCCCcc
Q psy5670         949 RSRSSVHD-ISQIRCMTGSEVGFTIMRTVIPSCNVVSTNVSSHSNNNNNTTTTTTTTTIFIPEHSPMNGSFILSELQPQQ 1027 (1269)
Q Consensus       949 ~~~~~i~~-~~~~~C~~p~~~~~~~~~~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1027 (1269)
                      .....+.+ ..++.|.+|+...+.         ++.++....|.    ..      ...                  ...
T Consensus       574 ~~~~~~~~~~~~~~C~~p~~~~g~---------~l~~~~~~~C~----~~------~~~------------------~~~  616 (844)
T 3j0a_A          574 HTNVTIAGPPADIYCVYPDSFSGV---------SLFSLSTEGCD----EE------EVL------------------KSL  616 (844)
T ss_dssp             HTTTTTCCCGGGCCCSSCSSSCSC---------CTTTCCCCCC-------------------------------------
T ss_pred             hcCcccccccccCccCCchhhCCC---------ccccCccccCC----ch------hhc------------------ccc
Confidence            76655543 467899999887541         23334445665    10      000                  000


Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccccccccccccCCCCceeEEEEcccCCHHHHHHHHHHhh
Q psy5670        1028 DYVFLLIILVSASFVLVLLLILIIIYRQEMRVWFHSRFGVRLFYKSSEIEMDDRDKLFDAFVSYSSKDEAFVAEELAPIL 1107 (1269)
Q Consensus      1028 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yDafvsy~~~d~~~v~~~l~~~L 1107 (1269)
                      .+. ++++++++++++++++++++.|+....+||+.. ..++.....+ ++.+++++|||||||+++|++||.++|+|.|
T Consensus       617 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~-~~~~~~~~~~-~~~~~~~~yd~fisy~~~d~~~v~~~l~~~L  693 (844)
T 3j0a_A          617 KFS-LFIVCTVTLTLFLMTILTVTKFRGFCFICYKTA-QRLVFKDHPQ-GTEPDMYKYDAYLCFSSKDFTWVQNALLKHL  693 (844)
T ss_dssp             -CH-HHHHHHHHHHHHHHTTTSHHHHC-----------------CCCG-GGSSSCCCCSEEEECCSTTHHHHHHTHHHHH
T ss_pred             cee-hhHHHHHHHHHHHHHHHHHHHHhhhhhhhhHHH-HHHHhccccc-cccccceeccEEEEeeCCcHHHHHHHHHHHH
Confidence            111 111222222222222233344443334455433 2233322222 4556789999999999999999999999999


Q ss_pred             hcC---CCCceEEEecccCCCCCchhHHHHHHHHhcceEEEEecccchhhhhhHHHHHHHHHHHhcCC-CeEEEEEeCCC
Q psy5670        1108 ENG---DPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYEFKSAHHQVLRGK-KRLIVILLGEV 1183 (1269)
Q Consensus      1108 e~~---~~~~~l~~~~rd~~~G~~~~~~i~~~i~~Sr~~i~vlS~~~~~s~w~~~e~~~a~~~~~~~~-~~~i~i~~~~~ 1183 (1269)
                      |++   ++|||+|+++|||.||+.++++|.++|++|||+|+|+|++|++|+||++|++.|++++++++ +++|+|+++++
T Consensus       694 e~~~~~~~~~~~~~~~rd~~~G~~~~~~i~~~i~~sr~~i~vls~~~~~s~wc~~e~~~a~~~~~~~~~~~~i~i~~~~~  773 (844)
T 3j0a_A          694 DTQYSDQNRFNLCFEERDFVPGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCLSDLNSALIMVVVGSL  773 (844)
T ss_dssp             HSTTTTTTCSCEECSSSSCCSSSCHHHHHHHHHHHSSEEEEEECTTHHHHTSTTHHHHHHHSCCCCSSCTTEEEEESSCC
T ss_pred             hhccccCCceEEEEEccccCCCchHHHHHHHHHHHhCeEEEEeccccccChHHHHHHHHHHHHHHHhcCCcEEEEEeccC
Confidence            983   68999999999999999999999999999999999999999999999999999999999888 99999999999


Q ss_pred             CCCCCC--HHHHHHHhcCceEEcCC-----cchHHHHHHhCCCCCCCCCCCCCCC
Q psy5670        1184 PQKDLD--PDIRLYLKSNTYLQWGD-----KLFWEKLKFALPDVPNNQRNNNNRN 1231 (1269)
Q Consensus      1184 ~~~~~~--~~l~~~l~~~~~l~w~~-----~~Fw~~l~~~l~~~~~~~~~~~~~~ 1231 (1269)
                      ++++++  ++||+++++++||+|++     ++||++||||||.+.+.+ +..+++
T Consensus       774 ~~~~~~~~~~l~~~~~~~~~l~w~~~~~~~~~Fw~~l~~al~~~~~~~-~~~~~~  827 (844)
T 3j0a_A          774 SQYQLMKHQSIRGFVQKQQYLRWPEDFQDVGWFLHKLSQQILKKEKEK-KKDNNI  827 (844)
T ss_dssp             CSSSCCSCSSTTHHHHTTCCCCCCSSSTTTTHHHHHHTTTTTSCCCCS-CC----
T ss_pred             ChHHhhhhHHHHHHHhhCCeeeCCCCchhHHHHHHHHHHHhccccccc-cCCCCc
Confidence            998873  58999999999999976     589999999999765543 344444



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>3hyn_A Putative signal transduction protein; DUF1863 family protein, nucleotide-binding protein, structur genomics; HET: MSE; 1.20A {Eubacterium rectale atcc 33656} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1269
d1fyxa_149 c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H 2e-39
d1fyva_161 c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H 9e-37
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-28
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-27
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-08
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Toll/Interleukin receptor TIR domain
family: Toll/Interleukin receptor TIR domain
domain: Toll-like receptor 2, TLR2
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  141 bits (356), Expect = 2e-39
 Identities = 56/147 (38%), Positives = 86/147 (58%), Gaps = 9/147 (6%)

Query: 1081 RDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESS 1140
            R+  +DAFVSYS +D  +V   +   LEN +P +KLCLH R+F  G +I D I+ ++E S
Sbjct: 2    RNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIHGKWIIDNIIDSIEKS 61

Query: 1141 RRTIMVLSENFIKSEWCRYEFKSAHHQVLR-GKKRLIVILLGEVPQKDL---DPDIRLYL 1196
             +T+ VLSENF+KSEWC+YE   +H ++        I+ILL  + +K +      +R  +
Sbjct: 62   HKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIM 121

Query: 1197 KSNTYLQW-----GDKLFWEKLKFALP 1218
             + TYL+W       + FW  L+ A+ 
Sbjct: 122  NTKTYLEWPMDEAQREGFWVNLRAAIK 148


>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1269
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 99.97
d1fyva_161 Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ 99.96
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.66
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.32
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.3
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.27
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.04
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.13
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.35
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.24
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Toll/Interleukin receptor TIR domain
family: Toll/Interleukin receptor TIR domain
domain: Toll-like receptor 2, TLR2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=5.3e-32  Score=267.98  Aligned_cols=139  Identities=40%  Similarity=0.770  Sum_probs=131.0

Q ss_pred             CCCceeEEEEcccCCHHHHHHHHHHhhhcCCCCceEEEecccCCCCCchhHHHHHHHHhcceEEEEecccchhhhhhHHH
Q psy5670        1081 RDKLFDAFVSYSSKDEAFVAEELAPILENGDPAYKLCLHYREFPVGGYIGDTIVQAVESSRRTIMVLSENFIKSEWCRYE 1160 (1269)
Q Consensus      1081 ~~~~yDafvsy~~~d~~~v~~~l~~~Le~~~~~~~l~~~~rd~~~G~~~~~~i~~~i~~Sr~~i~vlS~~~~~s~w~~~e 1160 (1269)
                      .++.|||||||+++|++||.+.|++.||++.+||++|+++||+.||+.+.++|.++|++||++|+|+|++|++|.||++|
T Consensus         2 ~~~~YDvFiSys~~D~~~V~~~l~~~LE~~~~g~~~~~~~rd~~~G~~~~~~i~~~i~~S~~~i~vlS~~~l~s~wc~~E   81 (149)
T d1fyxa_           2 RNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIHGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYE   81 (149)
T ss_dssp             CSCCEEEEEECCGGGHHHHHTHHHHHHTTSSSCCCEEEHHHHCCSSSCHHHHHHHHHHHEEEEEEEECHHHHHHHTHHHH
T ss_pred             CCCEEEEEEECchhhHHHHHHHHHHHHHhcCCCceEEEecccccccchHHHHHHHHHHhCCEEEEEEcCccccccchHHH
Confidence            47899999999999999999999999998778999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCC-CeEEEEEeCCCCCCCCC---HHHHHHHhcCceEEcCC-----cchHHHHHHhCCC
Q psy5670        1161 FKSAHHQVLRGK-KRLIVILLGEVPQKDLD---PDIRLYLKSNTYLQWGD-----KLFWEKLKFALPD 1219 (1269)
Q Consensus      1161 ~~~a~~~~~~~~-~~~i~i~~~~~~~~~~~---~~l~~~l~~~~~l~w~~-----~~Fw~~l~~~l~~ 1219 (1269)
                      ++.|++++++++ .++|||++++++...+|   ..++.++++++|++|++     ++||+|||+|||+
T Consensus        82 ~~~a~~~~~~~~~~~iIpV~l~~~~~~~~~~~~~~l~~~l~~~~~l~w~~~~~~~~~Fw~~L~~al~~  149 (149)
T d1fyxa_          82 LDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS  149 (149)
T ss_dssp             SCCSCCTTCGGGTTCCEEEESSCCCTTTSCSSCHHHHHHHHHTCSEECCSSGGGHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHcCCceEEEEEeccCchhhcchhhHHHHHHhccCCeEECCCCcccchHHHHHHHHHcCC
Confidence            999999998877 99999999999998887   58999999999999953     5899999999984



>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure