Psyllid ID: psy5723
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| 170062609 | 164 | conserved hypothetical protein [Culex qu | 0.407 | 0.402 | 0.884 | 1e-24 | |
| 170047894 | 158 | conserved hypothetical protein [Culex qu | 0.432 | 0.443 | 0.849 | 2e-24 | |
| 357617484 | 119 | hypothetical protein KGM_12867 [Danaus p | 0.530 | 0.722 | 0.670 | 4e-22 | |
| 242247607 | 117 | n-synaptobrevin [Acyrthosiphon pisum] gi | 0.617 | 0.854 | 0.566 | 1e-21 | |
| 194864908 | 217 | GG14581 [Drosophila erecta] gi|190652950 | 0.691 | 0.516 | 0.529 | 3e-21 | |
| 158294276 | 178 | AGAP005507-PB [Anopheles gambiae str. PE | 0.586 | 0.533 | 0.594 | 3e-21 | |
| 345495213 | 124 | PREDICTED: synaptobrevin-like isoform 2 | 0.586 | 0.766 | 0.594 | 3e-21 | |
| 345495211 | 130 | PREDICTED: synaptobrevin-like isoform 1 | 0.586 | 0.730 | 0.594 | 4e-21 | |
| 195490476 | 223 | GE20941 [Drosophila yakuba] gi|194179257 | 0.691 | 0.502 | 0.529 | 4e-21 | |
| 195336642 | 221 | GM14195 [Drosophila sechellia] gi|194128 | 0.722 | 0.529 | 0.527 | 4e-21 |
| >gi|170062609|ref|XP_001866744.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167880478|gb|EDS43861.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 117 bits (293), Expect = 1e-24, Method: Compositional matrix adjust.
Identities = 61/69 (88%), Positives = 62/69 (89%), Gaps = 3/69 (4%)
Query: 5 GLQPGGAGD---DGIVGGPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLS 61
GL PG AG+ DGIVGGPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLS
Sbjct: 16 GLAPGAAGEPGADGIVGGPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLS 75
Query: 62 ELDDRAGNL 70
ELDDRA L
Sbjct: 76 ELDDRADAL 84
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|170047894|ref|XP_001851440.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167870138|gb|EDS33521.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|357617484|gb|EHJ70821.1| hypothetical protein KGM_12867 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|242247607|ref|NP_001156248.1| n-synaptobrevin [Acyrthosiphon pisum] gi|239793435|dbj|BAH72834.1| ACYPI007508 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|194864908|ref|XP_001971167.1| GG14581 [Drosophila erecta] gi|190652950|gb|EDV50193.1| GG14581 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|158294276|ref|XP_001688670.1| AGAP005507-PB [Anopheles gambiae str. PEST] gi|158294278|ref|XP_001688671.1| AGAP005507-PA [Anopheles gambiae str. PEST] gi|157015489|gb|EDO63676.1| AGAP005507-PB [Anopheles gambiae str. PEST] gi|157015490|gb|EDO63677.1| AGAP005507-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|345495213|ref|XP_003427457.1| PREDICTED: synaptobrevin-like isoform 2 [Nasonia vitripennis] gi|345495215|ref|XP_003427458.1| PREDICTED: synaptobrevin-like isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345495211|ref|XP_001604664.2| PREDICTED: synaptobrevin-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|195490476|ref|XP_002093156.1| GE20941 [Drosophila yakuba] gi|194179257|gb|EDW92868.1| GE20941 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195336642|ref|XP_002034944.1| GM14195 [Drosophila sechellia] gi|194128037|gb|EDW50080.1| GM14195 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| FB|FBgn0013342 | 192 | n-syb "n-synaptobrevin" [Droso | 0.561 | 0.473 | 0.546 | 4.6e-18 | |
| UNIPROTKB|Q26335 | 181 | n-syb "N-syb protein" [Drosoph | 0.561 | 0.502 | 0.546 | 5.8e-18 | |
| WB|WBGene00004897 | 109 | snb-1 [Caenorhabditis elegans | 0.419 | 0.623 | 0.671 | 4.1e-17 | |
| UNIPROTKB|J9P1V7 | 104 | VAMP3 "Uncharacterized protein | 0.388 | 0.605 | 0.666 | 7.7e-16 | |
| MGI|MGI:1321389 | 103 | Vamp3 "vesicle-associated memb | 0.382 | 0.601 | 0.661 | 2.6e-15 | |
| RGD|61880 | 103 | Vamp3 "vesicle-associated memb | 0.382 | 0.601 | 0.661 | 2.6e-15 | |
| UNIPROTKB|I3LVF9 | 155 | VAMP3 "Uncharacterized protein | 0.382 | 0.4 | 0.645 | 4.2e-15 | |
| UNIPROTKB|F1NTL8 | 113 | VAMP2 "Uncharacterized protein | 0.419 | 0.601 | 0.614 | 5.4e-15 | |
| UNIPROTKB|Q15836 | 100 | VAMP3 "Vesicle-associated memb | 0.370 | 0.6 | 0.666 | 5.4e-15 | |
| UNIPROTKB|G3X752 | 103 | VAMP3 "Vesicle-associated memb | 0.364 | 0.572 | 0.661 | 8.8e-15 |
| FB|FBgn0013342 n-syb "n-synaptobrevin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 219 (82.2 bits), Expect = 4.6e-18, P = 4.6e-18
Identities = 53/97 (54%), Positives = 64/97 (65%)
Query: 20 PRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAG 79
P PQQIAAQKRLQQTQAQVDEVVDIM+TNVEKVLERD KLSELDDRA L + G
Sbjct: 39 PHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQ------G 92
Query: 80 NSSGRQQKSDPKSKLSESQKQVDEVVGIMRVNVEKVL 116
S QQ K K ++ ++G++ + V ++
Sbjct: 93 ASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII 129
|
|
| UNIPROTKB|Q26335 n-syb "N-syb protein" [Drosophila sp. (taxid:7242)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00004897 snb-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P1V7 VAMP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1321389 Vamp3 "vesicle-associated membrane protein 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|61880 Vamp3 "vesicle-associated membrane protein 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LVF9 VAMP3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NTL8 VAMP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15836 VAMP3 "Vesicle-associated membrane protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X752 VAMP3 "Vesicle-associated membrane protein 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 162 | |||
| pfam00957 | 89 | pfam00957, Synaptobrevin, Synaptobrevin | 2e-16 | |
| pfam00957 | 89 | pfam00957, Synaptobrevin, Synaptobrevin | 5e-15 | |
| COG5143 | 190 | COG5143, SNC1, Synaptobrevin/VAMP-like protein [In | 6e-04 |
| >gnl|CDD|201526 pfam00957, Synaptobrevin, Synaptobrevin | Back alignment and domain information |
|---|
Score = 69.9 bits (172), Expect = 2e-16
Identities = 24/49 (48%), Positives = 31/49 (63%)
Query: 92 SKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFE 140
KL++ Q QVDEV IM N++KVLER +KL L ++ LQ A QF
Sbjct: 3 DKLNKIQAQVDEVKDIMTENIDKVLERGEKLDLLVDKTENLQSSAQQFR 51
|
Length = 89 |
| >gnl|CDD|201526 pfam00957, Synaptobrevin, Synaptobrevin | Back alignment and domain information |
|---|
| >gnl|CDD|227472 COG5143, SNC1, Synaptobrevin/VAMP-like protein [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| KOG0860|consensus | 116 | 99.9 | ||
| KOG0859|consensus | 217 | 99.73 | ||
| PF00957 | 89 | Synaptobrevin: Synaptobrevin; InterPro: IPR001388 | 99.72 | |
| KOG0860|consensus | 116 | 99.64 | ||
| PF00957 | 89 | Synaptobrevin: Synaptobrevin; InterPro: IPR001388 | 99.57 | |
| KOG0859|consensus | 217 | 99.54 | ||
| KOG0861|consensus | 198 | 99.29 | ||
| KOG0861|consensus | 198 | 99.27 | ||
| COG5143 | 190 | SNC1 Synaptobrevin/VAMP-like protein [Intracellula | 99.22 | |
| COG5143 | 190 | SNC1 Synaptobrevin/VAMP-like protein [Intracellula | 98.81 | |
| KOG0862|consensus | 216 | 98.31 | ||
| KOG0862|consensus | 216 | 97.91 | ||
| KOG1983|consensus | 993 | 80.8 |
| >KOG0860|consensus | Back alignment and domain information |
|---|
Probab=99.90 E-value=1.2e-24 Score=162.15 Aligned_cols=81 Identities=48% Similarity=0.609 Sum_probs=77.3
Q ss_pred CcChhHHHHHHHHHHHHHHHHHHHHHhHHHHHHhhhhhHHHHHHhccccCCCCCCCCCCcccccCCCchhhhhhhhhhhh
Q psy5723 23 PQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAGNSSGRQQKSDPKSKLSESQKQVD 102 (162)
Q Consensus 23 ~~~~~~~~kl~~l~~~v~eV~~IM~~Ni~kvleRgekL~~L~~ks~~L~~~~~~fa~s~~F~~~a~rLk~Km~~~n~KL~ 102 (162)
|++...+++++++++|||||++||++||+|+||||+||++|++||+.|++ +|.+|+++|.+++++|||++.++.
T Consensus 22 ~~~~~~~~k~~~tq~QvdeVv~IMr~NV~KVlER~ekL~~L~drad~L~~------~as~F~~~A~klkrk~wWkn~Km~ 95 (116)
T KOG0860|consen 22 PPNNTANDKLQQTQAQVDEVVDIMRENVEKVLERGEKLDELDDRADQLQA------GASQFEKTAVKLKRKMWWKNCKMR 95 (116)
T ss_pred CCcchhhHHHHHHHHHHHHHHHHHHHhHHHHHHhcchHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHH
Confidence 77888899999999999999999999999999999999999999999999 999999999999999999999999
Q ss_pred HHHHHHH
Q psy5723 103 EVVGIMR 109 (162)
Q Consensus 103 iVi~IM~ 109 (162)
.+++++.
T Consensus 96 ~il~~v~ 102 (116)
T KOG0860|consen 96 IILGLVI 102 (116)
T ss_pred HHHHHHH
Confidence 8877653
|
|
| >KOG0859|consensus | Back alignment and domain information |
|---|
| >PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis | Back alignment and domain information |
|---|
| >KOG0860|consensus | Back alignment and domain information |
|---|
| >PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis | Back alignment and domain information |
|---|
| >KOG0859|consensus | Back alignment and domain information |
|---|
| >KOG0861|consensus | Back alignment and domain information |
|---|
| >KOG0861|consensus | Back alignment and domain information |
|---|
| >COG5143 SNC1 Synaptobrevin/VAMP-like protein [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG5143 SNC1 Synaptobrevin/VAMP-like protein [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0862|consensus | Back alignment and domain information |
|---|
| >KOG0862|consensus | Back alignment and domain information |
|---|
| >KOG1983|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 162 | ||||
| 1sfc_A | 96 | Neuronal Synaptic Fusion Complex Length = 96 | 1e-15 | ||
| 2kog_A | 119 | Lipid-Bound Synaptobrevin Solution Nmr Structure Le | 1e-15 | ||
| 3hd7_A | 91 | Helical Extension Of The Neuronal Snare Complex Int | 1e-15 | ||
| 1kil_A | 66 | Three-Dimensional Structure Of The ComplexinSNARE C | 2e-15 | ||
| 1n7s_A | 63 | High Resolution Structure Of A Truncated Neuronal S | 2e-15 | ||
| 1l4a_A | 80 | X-Ray Structure Of The Neuronal ComplexinSNARE COMP | 6e-14 | ||
| 3rk2_A | 37 | Truncated Snare Complex Length = 37 | 4e-09 | ||
| 3rk2_A | 37 | Truncated Snare Complex Length = 37 | 4e-06 | ||
| 3fie_C | 38 | Crystal Structure Of Clostridium Botulinum Neurotox | 2e-08 | ||
| 3fie_C | 38 | Crystal Structure Of Clostridium Botulinum Neurotox | 8e-05 | ||
| 3fii_B | 33 | Crystal Structure Of Clostridium Botulinum Neurotox | 2e-07 | ||
| 3fii_B | 33 | Crystal Structure Of Clostridium Botulinum Neurotox | 9e-05 | ||
| 2nps_A | 74 | Crystal Structure Of The Early Endosomal Snare Comp | 2e-05 | ||
| 2nps_A | 74 | Crystal Structure Of The Early Endosomal Snare Comp | 9e-05 | ||
| 3b5n_A | 61 | Structure Of The Yeast Plasma Membrane Snare Comple | 1e-04 | ||
| 3b5n_A | 61 | Structure Of The Yeast Plasma Membrane Snare Comple | 1e-04 |
| >pdb|1SFC|A Chain A, Neuronal Synaptic Fusion Complex Length = 96 | Back alignment and structure |
|
| >pdb|2KOG|A Chain A, Lipid-Bound Synaptobrevin Solution Nmr Structure Length = 119 | Back alignment and structure |
| >pdb|3HD7|A Chain A, Helical Extension Of The Neuronal Snare Complex Into The Membrane, Spacegroup C 1 2 1 Length = 91 | Back alignment and structure |
| >pdb|1KIL|A Chain A, Three-Dimensional Structure Of The ComplexinSNARE COMPLEX Length = 66 | Back alignment and structure |
| >pdb|1N7S|A Chain A, High Resolution Structure Of A Truncated Neuronal Snare Complex Length = 63 | Back alignment and structure |
| >pdb|1L4A|A Chain A, X-Ray Structure Of The Neuronal ComplexinSNARE COMPLEX From The Squid Loligo Pealei Length = 80 | Back alignment and structure |
| >pdb|3RK2|A Chain A, Truncated Snare Complex Length = 37 | Back alignment and structure |
| >pdb|3RK2|A Chain A, Truncated Snare Complex Length = 37 | Back alignment and structure |
| >pdb|3FIE|C Chain C, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh1) Length = 38 | Back alignment and structure |
| >pdb|3FIE|C Chain C, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh1) Length = 38 | Back alignment and structure |
| >pdb|3FII|B Chain B, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh2) Length = 33 | Back alignment and structure |
| >pdb|3FII|B Chain B, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh2) Length = 33 | Back alignment and structure |
| >pdb|2NPS|A Chain A, Crystal Structure Of The Early Endosomal Snare Complex Length = 74 | Back alignment and structure |
| >pdb|2NPS|A Chain A, Crystal Structure Of The Early Endosomal Snare Complex Length = 74 | Back alignment and structure |
| >pdb|3B5N|A Chain A, Structure Of The Yeast Plasma Membrane Snare Complex Length = 61 | Back alignment and structure |
| >pdb|3B5N|A Chain A, Structure Of The Yeast Plasma Membrane Snare Complex Length = 61 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 162 | |||
| 1n7s_A | 63 | Vesicle-associated membrane protein 2; neuronal sn | 6e-13 | |
| 1n7s_A | 63 | Vesicle-associated membrane protein 2; neuronal sn | 1e-11 | |
| 2kog_A | 119 | Vesicle-associated membrane protein 2; synaptobrev | 7e-13 | |
| 2kog_A | 119 | Vesicle-associated membrane protein 2; synaptobrev | 3e-11 | |
| 3b5n_A | 61 | Synaptobrevin homolog 1; snare complex, syntaxin, | 9e-13 | |
| 3b5n_A | 61 | Synaptobrevin homolog 1; snare complex, syntaxin, | 2e-10 | |
| 3hd7_A | 91 | Vesicle-associated membrane protein 2; membrane pr | 1e-12 | |
| 3hd7_A | 91 | Vesicle-associated membrane protein 2; membrane pr | 2e-12 | |
| 1l4a_A | 80 | Synaptobrevin; snare, snare complex, membrane fusi | 2e-12 | |
| 1l4a_A | 80 | Synaptobrevin; snare, snare complex, membrane fusi | 9e-11 | |
| 1sfc_A | 96 | VAMP 2, protein (synaptobrevin 2); membrane fusion | 9e-12 | |
| 1sfc_A | 96 | VAMP 2, protein (synaptobrevin 2); membrane fusion | 6e-11 | |
| 2nps_A | 74 | VAMP-4, vesicle-associated membrane protein 4; ves | 6e-11 | |
| 2nps_A | 74 | VAMP-4, vesicle-associated membrane protein 4; ves | 4e-09 | |
| 1gl2_A | 65 | Endobrevin; membrane protein, membrane fusion prot | 8e-11 | |
| 1gl2_A | 65 | Endobrevin; membrane protein, membrane fusion prot | 3e-10 | |
| 3fie_C | 38 | Fragment of vesicle-associated membrane protein 2; | 2e-10 | |
| 3fie_C | 38 | Fragment of vesicle-associated membrane protein 2; | 3e-06 | |
| 3kyq_A | 199 | YKT6, synaptobrevin homolog YKT6; V-snare homolog, | 1e-08 | |
| 3kyq_A | 199 | YKT6, synaptobrevin homolog YKT6; V-snare homolog, | 1e-06 | |
| 2nut_C | 196 | Vesicle-trafficking protein SEC22B; human copii SE | 5e-07 | |
| 2nut_C | 196 | Vesicle-trafficking protein SEC22B; human copii SE | 1e-04 |
| >1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Length = 63 | Back alignment and structure |
|---|
Score = 59.4 bits (144), Expect = 6e-13
Identities = 38/49 (77%), Positives = 44/49 (89%)
Query: 92 SKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFE 140
+L ++Q QVDEVV IMRVNV+KVLERDQKLSELD+RA+ALQ GASQFE
Sbjct: 4 RRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFE 52
|
| >1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Length = 63 | Back alignment and structure |
|---|
| >2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Length = 119 | Back alignment and structure |
|---|
| >2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Length = 119 | Back alignment and structure |
|---|
| >3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Length = 61 | Back alignment and structure |
|---|
| >3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Length = 61 | Back alignment and structure |
|---|
| >3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Length = 91 | Back alignment and structure |
|---|
| >3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Length = 91 | Back alignment and structure |
|---|
| >1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Length = 80 | Back alignment and structure |
|---|
| >1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Length = 80 | Back alignment and structure |
|---|
| >1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Length = 96 | Back alignment and structure |
|---|
| >1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Length = 96 | Back alignment and structure |
|---|
| >2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Length = 74 | Back alignment and structure |
|---|
| >2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Length = 74 | Back alignment and structure |
|---|
| >1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Length = 65 | Back alignment and structure |
|---|
| >1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Length = 65 | Back alignment and structure |
|---|
| >3fie_C Fragment of vesicle-associated membrane protein 2; BONT F, VAMP, inhibitor, complex structure, acetylation, cell junction, hydrolase; 2.10A {Clostridium botulinum} Length = 38 | Back alignment and structure |
|---|
| >3fie_C Fragment of vesicle-associated membrane protein 2; BONT F, VAMP, inhibitor, complex structure, acetylation, cell junction, hydrolase; 2.10A {Clostridium botulinum} Length = 38 | Back alignment and structure |
|---|
| >3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} Length = 199 | Back alignment and structure |
|---|
| >3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} Length = 199 | Back alignment and structure |
|---|
| >2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Length = 196 | Back alignment and structure |
|---|
| >2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Length = 196 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| 2kog_A | 119 | Vesicle-associated membrane protein 2; synaptobrev | 99.86 | |
| 1l4a_A | 80 | Synaptobrevin; snare, snare complex, membrane fusi | 99.86 | |
| 1sfc_A | 96 | VAMP 2, protein (synaptobrevin 2); membrane fusion | 99.85 | |
| 3hd7_A | 91 | Vesicle-associated membrane protein 2; membrane pr | 99.84 | |
| 2nps_A | 74 | VAMP-4, vesicle-associated membrane protein 4; ves | 99.8 | |
| 3b5n_A | 61 | Synaptobrevin homolog 1; snare complex, syntaxin, | 99.75 | |
| 1n7s_A | 63 | Vesicle-associated membrane protein 2; neuronal sn | 99.75 | |
| 3b5n_A | 61 | Synaptobrevin homolog 1; snare complex, syntaxin, | 99.73 | |
| 1n7s_A | 63 | Vesicle-associated membrane protein 2; neuronal sn | 99.72 | |
| 1gl2_A | 65 | Endobrevin; membrane protein, membrane fusion prot | 99.72 | |
| 2nps_A | 74 | VAMP-4, vesicle-associated membrane protein 4; ves | 99.7 | |
| 3hd7_A | 91 | Vesicle-associated membrane protein 2; membrane pr | 99.7 | |
| 1sfc_A | 96 | VAMP 2, protein (synaptobrevin 2); membrane fusion | 99.69 | |
| 1gl2_A | 65 | Endobrevin; membrane protein, membrane fusion prot | 99.68 | |
| 1l4a_A | 80 | Synaptobrevin; snare, snare complex, membrane fusi | 99.66 | |
| 2nut_C | 196 | Vesicle-trafficking protein SEC22B; human copii SE | 99.64 | |
| 4b93_A | 189 | Vesicle-associated membrane protein 7; endocytosis | 99.63 | |
| 1urq_A | 63 | M-tomosyn isoform; transport protein, tomosyn-snar | 99.59 | |
| 1urq_A | 63 | M-tomosyn isoform; transport protein, tomosyn-snar | 99.58 | |
| 2kog_A | 119 | Vesicle-associated membrane protein 2; synaptobrev | 99.53 | |
| 2nut_C | 196 | Vesicle-trafficking protein SEC22B; human copii SE | 99.39 | |
| 3kyq_A | 199 | YKT6, synaptobrevin homolog YKT6; V-snare homolog, | 99.31 | |
| 4b93_A | 189 | Vesicle-associated membrane protein 7; endocytosis | 99.26 | |
| 3kyq_A | 199 | YKT6, synaptobrevin homolog YKT6; V-snare homolog, | 99.24 | |
| 3fie_C | 38 | Fragment of vesicle-associated membrane protein 2; | 98.48 | |
| 3zym_A | 310 | Phosphatidylinositol-binding clathrin assembly PR | 98.23 | |
| 3zym_A | 310 | Phosphatidylinositol-binding clathrin assembly PR | 97.79 | |
| 3fie_C | 38 | Fragment of vesicle-associated membrane protein 2; | 97.71 |
| >2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.86 E-value=1.1e-23 Score=157.40 Aligned_cols=83 Identities=51% Similarity=0.677 Sum_probs=76.8
Q ss_pred CCCCcChhHHHHHHHHHHHHHHHHHHHHHhHHHHHHhhhhhHHHHHHhccccCCCCCCCCCCcccccCCCchhhhhhhhh
Q psy5723 20 PRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAGNSSGRQQKSDPKSKLSESQK 99 (162)
Q Consensus 20 ~~~~~~~~~~~kl~~l~~~v~eV~~IM~~Ni~kvleRgekL~~L~~ks~~L~~~~~~fa~s~~F~~~a~rLk~Km~~~n~ 99 (162)
|+++++....+++.+++.+|+||++||++||+++|+|||+|++|++||++|+. .|..|+++|+++++++||.+.
T Consensus 23 ~~~~~~~~~~d~l~~vq~evdeVk~IM~~NIdkvLeRGEkLd~L~~KTe~L~~------~S~~F~k~A~kl~rkmwwkn~ 96 (119)
T 2kog_A 23 PAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQA------GASQFETSAAKLKRKYWWKNL 96 (119)
T ss_dssp CCCCCSSSSCSHHHHSSHHHHHHHHHHHHHHHHHHCCCCSSCCCCSCCSCCCS------SSHHHHHHHHHHHHHHSCHHH
T ss_pred CCCCCCCccchHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHH
Confidence 44456667789999999999999999999999999999999999999999999 999999999999999999999
Q ss_pred hhhHHHHHH
Q psy5723 100 QVDEVVGIM 108 (162)
Q Consensus 100 KL~iVi~IM 108 (162)
++..+++++
T Consensus 97 K~~iii~~i 105 (119)
T 2kog_A 97 KMMIILGVI 105 (119)
T ss_dssp HHHHHHHHH
T ss_pred HHHHHHHHH
Confidence 999886654
|
| >1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A | Back alignment and structure |
|---|
| >2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B | Back alignment and structure |
|---|
| >3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B | Back alignment and structure |
|---|
| >1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A | Back alignment and structure |
|---|
| >1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A | Back alignment and structure |
|---|
| >4b93_A Vesicle-associated membrane protein 7; endocytosis, exocytosis, snare; 2.00A {Mus musculus} PDB: 2dmw_A | Back alignment and structure |
|---|
| >1urq_A M-tomosyn isoform; transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil; 2.0A {Rattus norvegicus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >1urq_A M-tomosyn isoform; transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil; 2.0A {Rattus norvegicus} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A | Back alignment and structure |
|---|
| >3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4b93_A Vesicle-associated membrane protein 7; endocytosis, exocytosis, snare; 2.00A {Mus musculus} PDB: 2dmw_A | Back alignment and structure |
|---|
| >3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3fie_C Fragment of vesicle-associated membrane protein 2; BONT F, VAMP, inhibitor, complex structure, acetylation, cell junction, hydrolase; 2.10A {Clostridium botulinum} | Back alignment and structure |
|---|
| >3zym_A Phosphatidylinositol-binding clathrin assembly PR vesicle-associated membrane protein...; endocytosis, synaptobrevin, VAMP2, VAMP3, AP180; HET: PO4; 2.03A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3zym_A Phosphatidylinositol-binding clathrin assembly PR vesicle-associated membrane protein...; endocytosis, synaptobrevin, VAMP2, VAMP3, AP180; HET: PO4; 2.03A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3fie_C Fragment of vesicle-associated membrane protein 2; BONT F, VAMP, inhibitor, complex structure, acetylation, cell junction, hydrolase; 2.10A {Clostridium botulinum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00