Psyllid ID: psy5723


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
SGDAGLQPGGAGDDGIVGGPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAGNSSGRQQKSDPKSKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFEHVPTFHGLSMSRQINHLSAVIT
ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccc
ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcc
sgdaglqpggagddgivggprtPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDdragnlgkmdggfagnssgrqqksdpksklsesqkQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGasqfehvptfhglsmSRQINHLSAVIT
sgdaglqpggagddgivgGPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGgfagnssgrqqksdpksklsesqkqvdevvgiMRVNVEKVLERDQKLSELDNRANALQQGASQFEHVPTFHGLSMSRQINHLSAVIT
SGDAGLQPggagddgivggPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAGNSSGRQQKSDPKSKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFEHVPTFHGLSMSRQINHLSAVIT
********************************************I**********************************************************VVGIMRVNVEKV***********************************************
**************************************VDEVVDIMKTNVEKVLERDQKLSELDDRA********************SDPKSKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANAL***************LSMSRQINHLSAVIT
SGDAGLQPGGAGDDGIVGGPRTPQQ************QVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAG*********************VDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFEHVPTFHGLSMSRQINHLSAVIT
****************************QKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDG***GN********DPKSKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFEHVPTFHGLSMSRQINHLSAVIT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SGDAGLQPGGAGDDGIVGGPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAGNSSGRQQKSDPKSKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFEHVPTFHGLSMSRQINHLSAVIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q60WU2108 Synaptobrevin-1 OS=Caenor N/A N/A 0.388 0.583 0.661 8e-16
O02495109 Synaptobrevin-1 OS=Caenor yes N/A 0.296 0.440 0.791 4e-15
P63025103 Vesicle-associated membra yes N/A 0.382 0.601 0.661 6e-15
P63024103 Vesicle-associated membra yes N/A 0.382 0.601 0.661 6e-15
Q15836100 Vesicle-associated membra yes N/A 0.370 0.6 0.666 1e-14
Q2KJD2104 Vesicle-associated membra yes N/A 0.296 0.461 0.791 1e-14
Q4R8T0100 Vesicle-associated membra N/A N/A 0.296 0.48 0.791 1e-14
P63045116 Vesicle-associated membra no N/A 0.296 0.413 0.791 1e-14
P63044116 Vesicle-associated membra no N/A 0.296 0.413 0.791 1e-14
Q9N0Y0116 Vesicle-associated membra yes N/A 0.296 0.413 0.791 1e-14
>sp|Q60WU2|SYB1_CAEBR Synaptobrevin-1 OS=Caenorhabditis briggsae GN=snb-1 PE=3 SV=1 Back     alignment and function desciption
 Score = 82.8 bits (203), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%)

Query: 76  GFAGNSSGRQQKSDPKSKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQG 135
           G AG   G Q       +L ++Q QVDEVVGIM+VNVEKVLERDQKLS+LD+RA+ALQ+G
Sbjct: 5   GDAGAQGGSQGPRPSNKRLQQTQAQVDEVVGIMKVNVEKVLERDQKLSQLDDRADALQEG 64

Query: 136 ASQFE 140
           ASQFE
Sbjct: 65  ASQFE 69




Involved in the targeting and/or fusion of transport vesicles to their target membrane. Acts in neuronal exocytosis of synaptic transmission. Likely to have a role in cholinergic transmisson. Required for viability, coordinated movement and M3 pharynx motor neuron function.
Caenorhabditis briggsae (taxid: 6238)
>sp|O02495|SYB1_CAEEL Synaptobrevin-1 OS=Caenorhabditis elegans GN=snb-1 PE=1 SV=1 Back     alignment and function description
>sp|P63025|VAMP3_RAT Vesicle-associated membrane protein 3 OS=Rattus norvegicus GN=Vamp3 PE=2 SV=1 Back     alignment and function description
>sp|P63024|VAMP3_MOUSE Vesicle-associated membrane protein 3 OS=Mus musculus GN=Vamp3 PE=1 SV=1 Back     alignment and function description
>sp|Q15836|VAMP3_HUMAN Vesicle-associated membrane protein 3 OS=Homo sapiens GN=VAMP3 PE=1 SV=3 Back     alignment and function description
>sp|Q2KJD2|VAMP3_BOVIN Vesicle-associated membrane protein 3 OS=Bos taurus GN=VAMP3 PE=3 SV=1 Back     alignment and function description
>sp|Q4R8T0|VAMP3_MACFA Vesicle-associated membrane protein 3 OS=Macaca fascicularis GN=VAMP3 PE=3 SV=1 Back     alignment and function description
>sp|P63045|VAMP2_RAT Vesicle-associated membrane protein 2 OS=Rattus norvegicus GN=Vamp2 PE=1 SV=2 Back     alignment and function description
>sp|P63044|VAMP2_MOUSE Vesicle-associated membrane protein 2 OS=Mus musculus GN=Vamp2 PE=1 SV=2 Back     alignment and function description
>sp|Q9N0Y0|VAMP2_MACMU Vesicle-associated membrane protein 2 OS=Macaca mulatta GN=VAMP2 PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
170062609164 conserved hypothetical protein [Culex qu 0.407 0.402 0.884 1e-24
170047894158 conserved hypothetical protein [Culex qu 0.432 0.443 0.849 2e-24
357617484119 hypothetical protein KGM_12867 [Danaus p 0.530 0.722 0.670 4e-22
242247607117 n-synaptobrevin [Acyrthosiphon pisum] gi 0.617 0.854 0.566 1e-21
194864908217 GG14581 [Drosophila erecta] gi|190652950 0.691 0.516 0.529 3e-21
158294276178 AGAP005507-PB [Anopheles gambiae str. PE 0.586 0.533 0.594 3e-21
345495213124 PREDICTED: synaptobrevin-like isoform 2 0.586 0.766 0.594 3e-21
345495211130 PREDICTED: synaptobrevin-like isoform 1 0.586 0.730 0.594 4e-21
195490476223 GE20941 [Drosophila yakuba] gi|194179257 0.691 0.502 0.529 4e-21
195336642221 GM14195 [Drosophila sechellia] gi|194128 0.722 0.529 0.527 4e-21
>gi|170062609|ref|XP_001866744.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167880478|gb|EDS43861.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 62/69 (89%), Gaps = 3/69 (4%)

Query: 5  GLQPGGAGD---DGIVGGPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLS 61
          GL PG AG+   DGIVGGPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLS
Sbjct: 16 GLAPGAAGEPGADGIVGGPRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLS 75

Query: 62 ELDDRAGNL 70
          ELDDRA  L
Sbjct: 76 ELDDRADAL 84




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170047894|ref|XP_001851440.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167870138|gb|EDS33521.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|357617484|gb|EHJ70821.1| hypothetical protein KGM_12867 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242247607|ref|NP_001156248.1| n-synaptobrevin [Acyrthosiphon pisum] gi|239793435|dbj|BAH72834.1| ACYPI007508 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|194864908|ref|XP_001971167.1| GG14581 [Drosophila erecta] gi|190652950|gb|EDV50193.1| GG14581 [Drosophila erecta] Back     alignment and taxonomy information
>gi|158294276|ref|XP_001688670.1| AGAP005507-PB [Anopheles gambiae str. PEST] gi|158294278|ref|XP_001688671.1| AGAP005507-PA [Anopheles gambiae str. PEST] gi|157015489|gb|EDO63676.1| AGAP005507-PB [Anopheles gambiae str. PEST] gi|157015490|gb|EDO63677.1| AGAP005507-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|345495213|ref|XP_003427457.1| PREDICTED: synaptobrevin-like isoform 2 [Nasonia vitripennis] gi|345495215|ref|XP_003427458.1| PREDICTED: synaptobrevin-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345495211|ref|XP_001604664.2| PREDICTED: synaptobrevin-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195490476|ref|XP_002093156.1| GE20941 [Drosophila yakuba] gi|194179257|gb|EDW92868.1| GE20941 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195336642|ref|XP_002034944.1| GM14195 [Drosophila sechellia] gi|194128037|gb|EDW50080.1| GM14195 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
FB|FBgn0013342192 n-syb "n-synaptobrevin" [Droso 0.561 0.473 0.546 4.6e-18
UNIPROTKB|Q26335181 n-syb "N-syb protein" [Drosoph 0.561 0.502 0.546 5.8e-18
WB|WBGene00004897109 snb-1 [Caenorhabditis elegans 0.419 0.623 0.671 4.1e-17
UNIPROTKB|J9P1V7104 VAMP3 "Uncharacterized protein 0.388 0.605 0.666 7.7e-16
MGI|MGI:1321389103 Vamp3 "vesicle-associated memb 0.382 0.601 0.661 2.6e-15
RGD|61880103 Vamp3 "vesicle-associated memb 0.382 0.601 0.661 2.6e-15
UNIPROTKB|I3LVF9155 VAMP3 "Uncharacterized protein 0.382 0.4 0.645 4.2e-15
UNIPROTKB|F1NTL8113 VAMP2 "Uncharacterized protein 0.419 0.601 0.614 5.4e-15
UNIPROTKB|Q15836100 VAMP3 "Vesicle-associated memb 0.370 0.6 0.666 5.4e-15
UNIPROTKB|G3X752103 VAMP3 "Vesicle-associated memb 0.364 0.572 0.661 8.8e-15
FB|FBgn0013342 n-syb "n-synaptobrevin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 4.6e-18, P = 4.6e-18
 Identities = 53/97 (54%), Positives = 64/97 (65%)

Query:    20 PRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAG 79
             P  PQQIAAQKRLQQTQAQVDEVVDIM+TNVEKVLERD KLSELDDRA  L +      G
Sbjct:    39 PHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQ------G 92

Query:    80 NSSGRQQKSDPKSKLSESQKQVDEVVGIMRVNVEKVL 116
              S   QQ    K K      ++  ++G++ + V  ++
Sbjct:    93 ASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII 129


GO:0005886 "plasma membrane" evidence=IDA;NAS
GO:0005484 "SNAP receptor activity" evidence=ISS;NAS
GO:0007269 "neurotransmitter secretion" evidence=NAS
GO:0008021 "synaptic vesicle" evidence=ISS;IDA;NAS
GO:0016192 "vesicle-mediated transport" evidence=IEA;ISS;NAS
GO:0016081 "synaptic vesicle docking involved in exocytosis" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0043195 "terminal bouton" evidence=IDA
GO:0048786 "presynaptic active zone" evidence=IDA
UNIPROTKB|Q26335 n-syb "N-syb protein" [Drosophila sp. (taxid:7242)] Back     alignment and assigned GO terms
WB|WBGene00004897 snb-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1V7 VAMP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1321389 Vamp3 "vesicle-associated membrane protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61880 Vamp3 "vesicle-associated membrane protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LVF9 VAMP3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NTL8 VAMP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q15836 VAMP3 "Vesicle-associated membrane protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3X752 VAMP3 "Vesicle-associated membrane protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2KJD2VAMP3_BOVINNo assigned EC number0.79160.29620.4615yesN/A
Q9N0Y0VAMP2_MACMUNo assigned EC number0.79160.29620.4137yesN/A
Q15836VAMP3_HUMANNo assigned EC number0.66660.37030.6yesN/A
O02495SYB1_CAEELNo assigned EC number0.79160.29620.4403yesN/A
P63025VAMP3_RATNo assigned EC number0.66120.38270.6019yesN/A
P63024VAMP3_MOUSENo assigned EC number0.66120.38270.6019yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
pfam0095789 pfam00957, Synaptobrevin, Synaptobrevin 2e-16
pfam0095789 pfam00957, Synaptobrevin, Synaptobrevin 5e-15
COG5143190 COG5143, SNC1, Synaptobrevin/VAMP-like protein [In 6e-04
>gnl|CDD|201526 pfam00957, Synaptobrevin, Synaptobrevin Back     alignment and domain information
 Score = 69.9 bits (172), Expect = 2e-16
 Identities = 24/49 (48%), Positives = 31/49 (63%)

Query: 92  SKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFE 140
            KL++ Q QVDEV  IM  N++KVLER +KL  L ++   LQ  A QF 
Sbjct: 3   DKLNKIQAQVDEVKDIMTENIDKVLERGEKLDLLVDKTENLQSSAQQFR 51


Length = 89

>gnl|CDD|201526 pfam00957, Synaptobrevin, Synaptobrevin Back     alignment and domain information
>gnl|CDD|227472 COG5143, SNC1, Synaptobrevin/VAMP-like protein [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
KOG0860|consensus116 99.9
KOG0859|consensus217 99.73
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 99.72
KOG0860|consensus116 99.64
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 99.57
KOG0859|consensus217 99.54
KOG0861|consensus198 99.29
KOG0861|consensus198 99.27
COG5143190 SNC1 Synaptobrevin/VAMP-like protein [Intracellula 99.22
COG5143190 SNC1 Synaptobrevin/VAMP-like protein [Intracellula 98.81
KOG0862|consensus216 98.31
KOG0862|consensus216 97.91
KOG1983|consensus993 80.8
>KOG0860|consensus Back     alignment and domain information
Probab=99.90  E-value=1.2e-24  Score=162.15  Aligned_cols=81  Identities=48%  Similarity=0.609  Sum_probs=77.3

Q ss_pred             CcChhHHHHHHHHHHHHHHHHHHHHHhHHHHHHhhhhhHHHHHHhccccCCCCCCCCCCcccccCCCchhhhhhhhhhhh
Q psy5723          23 PQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAGNSSGRQQKSDPKSKLSESQKQVD  102 (162)
Q Consensus        23 ~~~~~~~~kl~~l~~~v~eV~~IM~~Ni~kvleRgekL~~L~~ks~~L~~~~~~fa~s~~F~~~a~rLk~Km~~~n~KL~  102 (162)
                      |++...+++++++++|||||++||++||+|+||||+||++|++||+.|++      +|.+|+++|.+++++|||++.++.
T Consensus        22 ~~~~~~~~k~~~tq~QvdeVv~IMr~NV~KVlER~ekL~~L~drad~L~~------~as~F~~~A~klkrk~wWkn~Km~   95 (116)
T KOG0860|consen   22 PPNNTANDKLQQTQAQVDEVVDIMRENVEKVLERGEKLDELDDRADQLQA------GASQFEKTAVKLKRKMWWKNCKMR   95 (116)
T ss_pred             CCcchhhHHHHHHHHHHHHHHHHHHHhHHHHHHhcchHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            77888899999999999999999999999999999999999999999999      999999999999999999999999


Q ss_pred             HHHHHHH
Q psy5723         103 EVVGIMR  109 (162)
Q Consensus       103 iVi~IM~  109 (162)
                      .+++++.
T Consensus        96 ~il~~v~  102 (116)
T KOG0860|consen   96 IILGLVI  102 (116)
T ss_pred             HHHHHHH
Confidence            8877653



>KOG0859|consensus Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>KOG0860|consensus Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>KOG0859|consensus Back     alignment and domain information
>KOG0861|consensus Back     alignment and domain information
>KOG0861|consensus Back     alignment and domain information
>COG5143 SNC1 Synaptobrevin/VAMP-like protein [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5143 SNC1 Synaptobrevin/VAMP-like protein [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0862|consensus Back     alignment and domain information
>KOG0862|consensus Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1sfc_A96 Neuronal Synaptic Fusion Complex Length = 96 1e-15
2kog_A119 Lipid-Bound Synaptobrevin Solution Nmr Structure Le 1e-15
3hd7_A91 Helical Extension Of The Neuronal Snare Complex Int 1e-15
1kil_A66 Three-Dimensional Structure Of The ComplexinSNARE C 2e-15
1n7s_A63 High Resolution Structure Of A Truncated Neuronal S 2e-15
1l4a_A80 X-Ray Structure Of The Neuronal ComplexinSNARE COMP 6e-14
3rk2_A37 Truncated Snare Complex Length = 37 4e-09
3rk2_A37 Truncated Snare Complex Length = 37 4e-06
3fie_C38 Crystal Structure Of Clostridium Botulinum Neurotox 2e-08
3fie_C38 Crystal Structure Of Clostridium Botulinum Neurotox 8e-05
3fii_B33 Crystal Structure Of Clostridium Botulinum Neurotox 2e-07
3fii_B33 Crystal Structure Of Clostridium Botulinum Neurotox 9e-05
2nps_A74 Crystal Structure Of The Early Endosomal Snare Comp 2e-05
2nps_A74 Crystal Structure Of The Early Endosomal Snare Comp 9e-05
3b5n_A61 Structure Of The Yeast Plasma Membrane Snare Comple 1e-04
3b5n_A61 Structure Of The Yeast Plasma Membrane Snare Comple 1e-04
>pdb|1SFC|A Chain A, Neuronal Synaptic Fusion Complex Length = 96 Back     alignment and structure

Iteration: 1

Score = 78.6 bits (192), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 38/48 (79%), Positives = 44/48 (91%) Query: 93 KLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFE 140 +L ++Q QVDEVV IMRVNV+KVLERDQKLSELD+RA+ALQ GASQFE Sbjct: 31 RLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFE 78
>pdb|2KOG|A Chain A, Lipid-Bound Synaptobrevin Solution Nmr Structure Length = 119 Back     alignment and structure
>pdb|3HD7|A Chain A, Helical Extension Of The Neuronal Snare Complex Into The Membrane, Spacegroup C 1 2 1 Length = 91 Back     alignment and structure
>pdb|1KIL|A Chain A, Three-Dimensional Structure Of The ComplexinSNARE COMPLEX Length = 66 Back     alignment and structure
>pdb|1N7S|A Chain A, High Resolution Structure Of A Truncated Neuronal Snare Complex Length = 63 Back     alignment and structure
>pdb|1L4A|A Chain A, X-Ray Structure Of The Neuronal ComplexinSNARE COMPLEX From The Squid Loligo Pealei Length = 80 Back     alignment and structure
>pdb|3RK2|A Chain A, Truncated Snare Complex Length = 37 Back     alignment and structure
>pdb|3RK2|A Chain A, Truncated Snare Complex Length = 37 Back     alignment and structure
>pdb|3FIE|C Chain C, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh1) Length = 38 Back     alignment and structure
>pdb|3FIE|C Chain C, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh1) Length = 38 Back     alignment and structure
>pdb|3FII|B Chain B, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh2) Length = 33 Back     alignment and structure
>pdb|3FII|B Chain B, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh2) Length = 33 Back     alignment and structure
>pdb|2NPS|A Chain A, Crystal Structure Of The Early Endosomal Snare Complex Length = 74 Back     alignment and structure
>pdb|2NPS|A Chain A, Crystal Structure Of The Early Endosomal Snare Complex Length = 74 Back     alignment and structure
>pdb|3B5N|A Chain A, Structure Of The Yeast Plasma Membrane Snare Complex Length = 61 Back     alignment and structure
>pdb|3B5N|A Chain A, Structure Of The Yeast Plasma Membrane Snare Complex Length = 61 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1n7s_A63 Vesicle-associated membrane protein 2; neuronal sn 6e-13
1n7s_A63 Vesicle-associated membrane protein 2; neuronal sn 1e-11
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 7e-13
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 3e-11
3b5n_A61 Synaptobrevin homolog 1; snare complex, syntaxin, 9e-13
3b5n_A61 Synaptobrevin homolog 1; snare complex, syntaxin, 2e-10
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 1e-12
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 2e-12
1l4a_A80 Synaptobrevin; snare, snare complex, membrane fusi 2e-12
1l4a_A80 Synaptobrevin; snare, snare complex, membrane fusi 9e-11
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 9e-12
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 6e-11
2nps_A74 VAMP-4, vesicle-associated membrane protein 4; ves 6e-11
2nps_A74 VAMP-4, vesicle-associated membrane protein 4; ves 4e-09
1gl2_A65 Endobrevin; membrane protein, membrane fusion prot 8e-11
1gl2_A65 Endobrevin; membrane protein, membrane fusion prot 3e-10
3fie_C38 Fragment of vesicle-associated membrane protein 2; 2e-10
3fie_C38 Fragment of vesicle-associated membrane protein 2; 3e-06
3kyq_A199 YKT6, synaptobrevin homolog YKT6; V-snare homolog, 1e-08
3kyq_A199 YKT6, synaptobrevin homolog YKT6; V-snare homolog, 1e-06
2nut_C196 Vesicle-trafficking protein SEC22B; human copii SE 5e-07
2nut_C196 Vesicle-trafficking protein SEC22B; human copii SE 1e-04
>1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Length = 63 Back     alignment and structure
 Score = 59.4 bits (144), Expect = 6e-13
 Identities = 38/49 (77%), Positives = 44/49 (89%)

Query: 92  SKLSESQKQVDEVVGIMRVNVEKVLERDQKLSELDNRANALQQGASQFE 140
            +L ++Q QVDEVV IMRVNV+KVLERDQKLSELD+RA+ALQ GASQFE
Sbjct: 4   RRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFE 52


>1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Length = 63 Back     alignment and structure
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Length = 119 Back     alignment and structure
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Length = 119 Back     alignment and structure
>3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Length = 61 Back     alignment and structure
>3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Length = 61 Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Length = 91 Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Length = 91 Back     alignment and structure
>1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Length = 80 Back     alignment and structure
>1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Length = 80 Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Length = 96 Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Length = 96 Back     alignment and structure
>2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Length = 74 Back     alignment and structure
>2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Length = 74 Back     alignment and structure
>1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Length = 65 Back     alignment and structure
>1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Length = 65 Back     alignment and structure
>3fie_C Fragment of vesicle-associated membrane protein 2; BONT F, VAMP, inhibitor, complex structure, acetylation, cell junction, hydrolase; 2.10A {Clostridium botulinum} Length = 38 Back     alignment and structure
>3fie_C Fragment of vesicle-associated membrane protein 2; BONT F, VAMP, inhibitor, complex structure, acetylation, cell junction, hydrolase; 2.10A {Clostridium botulinum} Length = 38 Back     alignment and structure
>3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} Length = 199 Back     alignment and structure
>3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} Length = 199 Back     alignment and structure
>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Length = 196 Back     alignment and structure
>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Length = 196 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 99.86
1l4a_A80 Synaptobrevin; snare, snare complex, membrane fusi 99.86
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 99.85
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 99.84
2nps_A74 VAMP-4, vesicle-associated membrane protein 4; ves 99.8
3b5n_A61 Synaptobrevin homolog 1; snare complex, syntaxin, 99.75
1n7s_A63 Vesicle-associated membrane protein 2; neuronal sn 99.75
3b5n_A61 Synaptobrevin homolog 1; snare complex, syntaxin, 99.73
1n7s_A63 Vesicle-associated membrane protein 2; neuronal sn 99.72
1gl2_A65 Endobrevin; membrane protein, membrane fusion prot 99.72
2nps_A74 VAMP-4, vesicle-associated membrane protein 4; ves 99.7
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 99.7
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 99.69
1gl2_A65 Endobrevin; membrane protein, membrane fusion prot 99.68
1l4a_A80 Synaptobrevin; snare, snare complex, membrane fusi 99.66
2nut_C196 Vesicle-trafficking protein SEC22B; human copii SE 99.64
4b93_A189 Vesicle-associated membrane protein 7; endocytosis 99.63
1urq_A63 M-tomosyn isoform; transport protein, tomosyn-snar 99.59
1urq_A63 M-tomosyn isoform; transport protein, tomosyn-snar 99.58
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 99.53
2nut_C196 Vesicle-trafficking protein SEC22B; human copii SE 99.39
3kyq_A199 YKT6, synaptobrevin homolog YKT6; V-snare homolog, 99.31
4b93_A189 Vesicle-associated membrane protein 7; endocytosis 99.26
3kyq_A199 YKT6, synaptobrevin homolog YKT6; V-snare homolog, 99.24
3fie_C38 Fragment of vesicle-associated membrane protein 2; 98.48
3zym_A310 Phosphatidylinositol-binding clathrin assembly PR 98.23
3zym_A310 Phosphatidylinositol-binding clathrin assembly PR 97.79
3fie_C38 Fragment of vesicle-associated membrane protein 2; 97.71
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Back     alignment and structure
Probab=99.86  E-value=1.1e-23  Score=157.40  Aligned_cols=83  Identities=51%  Similarity=0.677  Sum_probs=76.8

Q ss_pred             CCCCcChhHHHHHHHHHHHHHHHHHHHHHhHHHHHHhhhhhHHHHHHhccccCCCCCCCCCCcccccCCCchhhhhhhhh
Q psy5723          20 PRTPQQIAAQKRLQQTQAQVDEVVDIMKTNVEKVLERDQKLSELDDRAGNLGKMDGGFAGNSSGRQQKSDPKSKLSESQK   99 (162)
Q Consensus        20 ~~~~~~~~~~~kl~~l~~~v~eV~~IM~~Ni~kvleRgekL~~L~~ks~~L~~~~~~fa~s~~F~~~a~rLk~Km~~~n~   99 (162)
                      |+++++....+++.+++.+|+||++||++||+++|+|||+|++|++||++|+.      .|..|+++|+++++++||.+.
T Consensus        23 ~~~~~~~~~~d~l~~vq~evdeVk~IM~~NIdkvLeRGEkLd~L~~KTe~L~~------~S~~F~k~A~kl~rkmwwkn~   96 (119)
T 2kog_A           23 PAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQA------GASQFETSAAKLKRKYWWKNL   96 (119)
T ss_dssp             CCCCCSSSSCSHHHHSSHHHHHHHHHHHHHHHHHHCCCCSSCCCCSCCSCCCS------SSHHHHHHHHHHHHHHSCHHH
T ss_pred             CCCCCCCccchHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHH
Confidence            44456667789999999999999999999999999999999999999999999      999999999999999999999


Q ss_pred             hhhHHHHHH
Q psy5723         100 QVDEVVGIM  108 (162)
Q Consensus       100 KL~iVi~IM  108 (162)
                      ++..+++++
T Consensus        97 K~~iii~~i  105 (119)
T 2kog_A           97 KMMIILGVI  105 (119)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            999886654



>1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Back     alignment and structure
>2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Back     alignment and structure
>3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Back     alignment and structure
>3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Back     alignment and structure
>1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Back     alignment and structure
>4b93_A Vesicle-associated membrane protein 7; endocytosis, exocytosis, snare; 2.00A {Mus musculus} PDB: 2dmw_A Back     alignment and structure
>1urq_A M-tomosyn isoform; transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil; 2.0A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1urq_A M-tomosyn isoform; transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil; 2.0A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Back     alignment and structure
>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Back     alignment and structure
>3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} Back     alignment and structure
>4b93_A Vesicle-associated membrane protein 7; endocytosis, exocytosis, snare; 2.00A {Mus musculus} PDB: 2dmw_A Back     alignment and structure
>3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} Back     alignment and structure
>3fie_C Fragment of vesicle-associated membrane protein 2; BONT F, VAMP, inhibitor, complex structure, acetylation, cell junction, hydrolase; 2.10A {Clostridium botulinum} Back     alignment and structure
>3zym_A Phosphatidylinositol-binding clathrin assembly PR vesicle-associated membrane protein...; endocytosis, synaptobrevin, VAMP2, VAMP3, AP180; HET: PO4; 2.03A {Rattus norvegicus} Back     alignment and structure
>3zym_A Phosphatidylinositol-binding clathrin assembly PR vesicle-associated membrane protein...; endocytosis, synaptobrevin, VAMP2, VAMP3, AP180; HET: PO4; 2.03A {Rattus norvegicus} Back     alignment and structure
>3fie_C Fragment of vesicle-associated membrane protein 2; BONT F, VAMP, inhibitor, complex structure, acetylation, cell junction, hydrolase; 2.10A {Clostridium botulinum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00