Psyllid ID: psy5785

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340
MSVAVIGETILLKMSKFSAIGLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYSKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVY
ccHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccccccEEEEEEEEccccccccccccccccHHHHHHHHcccccccccccccccccEEEEEEEccccccccccccEEEEEEccccccccccccccccccHHHHcccHHHHHHHccccHHHHHHHccccccccEEccccccHHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccEEEEEcccccccccccccccHHHHHHHHcccEEEccccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHccccccc
cHHHHHHHHHHHcHHHccHHccccccccccHHHHcccccccccccccEEEEEEEEEccccccccccccccccEEEEccccccccccccEcccccccEEEEEEEEccccccccccccccEccccHcccHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHccccccccccEcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHcccccccccEEEEcccccHHHHHccHcHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHEEEHcccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHccccccc
MSVAVIGETILLKMSKFSAIGLTAKNIRSFQLsaaassavpaekpakykTFAIYrwnpdkpdekptmqeYKTAKNIRSFQLsaaassavpaekpakykTFAIYrwnpdkpdekptmQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDdrkkldglyecilcaccstscpsywwngekylgpAVLMQAYRWIIDSRDEKTADRLnqlkdpfsvyskidandkvskiyplphmyvvkdlvpdmnNFYAQYKSIQpwlqrdkenignaqylqslddrkkldglyecilcaccstscpsywwngekylgpAVLMQAYRWIIDSRDEKTADRLnqlkdpfsvy
MSVAVIGETILLKMSKFSAIGLTAKNIRSFQLSaaassavpaekpakykTFAIYRWNPDKPDEKPTMQEYKTAKNIRSFQLsaaassavpaekpakykTFAIYRWNPDKPDEKPTMQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRlnqlkdpfsvyskidandkvskiypLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADrlnqlkdpfsvy
MSVAVIGETILLKMSKFSAIGLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYSKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVY
***AVIGETILLKMSKFSAIGLTAKNIRSFQLSA***********AKYKTFAIYRWN**************************************KYKTFAIYRWN********************************ISNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYSKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIID********************
**************************************************FAIYRWNPDKPDEKPTMQEYKTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYSKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQR****************RKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVY
MSVAVIGETILLKMSKFSAIGLTAKNIRSFQL***********KPAKYKTFAIYRWNPDKPDEKPTMQEYKTAKNIRSFQL***********KPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYSKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVY
***********L*********************************AKYKTFAIYRWNPDKPDEKPTMQEYKTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYSKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDK******QYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVAVIGETILLKMSKFSAIGLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYSKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query340 2.2.26 [Sep-21-2011]
B0BM36284 Succinate dehydrogenase [ yes N/A 0.594 0.711 0.510 2e-58
P21914297 Succinate dehydrogenase [ yes N/A 0.385 0.441 0.762 4e-57
Q75CI4261 Succinate dehydrogenase [ yes N/A 0.635 0.827 0.473 2e-56
Q3B8J8282 Succinate dehydrogenase [ N/A N/A 0.597 0.719 0.495 9e-56
Q6FWS8253 Succinate dehydrogenase [ yes N/A 0.644 0.865 0.456 4e-55
A5PL98280 Succinate dehydrogenase [ yes N/A 0.597 0.725 0.483 2e-54
Q007T0280 Succinate dehydrogenase [ yes N/A 0.385 0.467 0.714 2e-53
Q3T189280 Succinate dehydrogenase [ yes N/A 0.385 0.467 0.714 3e-53
P21913282 Succinate dehydrogenase [ yes N/A 0.385 0.464 0.714 3e-53
P21912280 Succinate dehydrogenase [ yes N/A 0.385 0.467 0.706 3e-53
>sp|B0BM36|DHSB_XENTR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Xenopus tropicalis GN=sdhb PE=2 SV=1 Back     alignment and function desciption
 Score =  226 bits (576), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 151/247 (61%), Gaps = 45/247 (18%)

Query: 96  KYKTFAIYRWNPDKPDEKPTMQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDDRKKLD 155
           + K FAIYRW+PDKP +KP MQ Y+VDLN     S        I N         R   +
Sbjct: 42  RIKKFAIYRWDPDKPGDKPRMQTYEVDLNE--CGSMVLDALIKIKNEMDPTLTFRRSCRE 99

Query: 156 GLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVY 215
           G+     C  C+ +      NG   L   V                              
Sbjct: 100 GI-----CGSCAMN-----INGGNTLACTV------------------------------ 119

Query: 216 SKIDAN-DKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQR-DKENIGNAQYLQSL 273
            +ID N  KVSKIYPLPHMYVVKDLVPD++NFYAQYKSI+P+L++ D+   G  QYLQS+
Sbjct: 120 -RIDTNLSKVSKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKEQYLQSI 178

Query: 274 DDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQL 333
           +DR KLDGLYECILCACCSTSCPSYWWN +KYLGPAVLMQAYRW+IDSRD+ T +RL +L
Sbjct: 179 EDRDKLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWMIDSRDDYTEERLAKL 238

Query: 334 KDPFSVY 340
           +DPFS+Y
Sbjct: 239 QDPFSLY 245
Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Xenopus tropicalis (taxid: 8364)
EC: 1EC: .EC: 3EC: .EC: 5EC: .EC: 1
>sp|P21914|DHSB_DROME Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Drosophila melanogaster GN=SdhB PE=2 SV=2 Back     alignment and function description
>sp|Q75CI4|DHSB_ASHGO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SDH2 PE=3 SV=1 Back     alignment and function description
>sp|Q3B8J8|DHSB_XENLA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Xenopus laevis GN=sdhb PE=2 SV=1 Back     alignment and function description
>sp|Q6FWS8|DHSB_CANGA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SDH2 PE=3 SV=1 Back     alignment and function description
>sp|A5PL98|DHSB_DANRE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Danio rerio GN=sdhb PE=2 SV=1 Back     alignment and function description
>sp|Q007T0|DHSB_PIG Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Sus scrofa GN=SDHB PE=1 SV=1 Back     alignment and function description
>sp|Q3T189|DHSB_BOVIN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Bos taurus GN=SDHB PE=2 SV=1 Back     alignment and function description
>sp|P21913|DHSB_RAT Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Rattus norvegicus GN=Sdhb PE=2 SV=2 Back     alignment and function description
>sp|P21912|DHSB_HUMAN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens GN=SDHB PE=1 SV=3 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query340
UNIPROTKB|Q3B8J8282 sdhb "Succinate dehydrogenase 0.364 0.439 0.761 2.9e-64
UNIPROTKB|B0BM36284 sdhb "Succinate dehydrogenase 0.364 0.436 0.753 2.9e-64
FB|FBgn0014028297 SdhB "Succinate dehydrogenase 0.367 0.420 0.798 9.9e-64
RGD|1308598282 Sdhb "succinate dehydrogenase 0.364 0.439 0.753 3.3e-63
UNIPROTKB|Q007T0280 SDHB "Succinate dehydrogenase 0.364 0.442 0.753 6.9e-63
ZFIN|ZDB-GENE-030131-8005280 sdhb "succinate dehydrogenase 0.367 0.446 0.763 1.1e-62
UNIPROTKB|Q3T189280 SDHB "Succinate dehydrogenase 0.364 0.442 0.753 1.1e-62
UNIPROTKB|I3LDC1280 SDHB "Succinate dehydrogenase 0.364 0.442 0.746 2.3e-62
MGI|MGI:1914930282 Sdhb "succinate dehydrogenase 0.364 0.439 0.753 2.9e-62
UNIPROTKB|F1Q3W8280 SDHB "Uncharacterized protein" 0.364 0.442 0.753 4.8e-62
UNIPROTKB|Q3B8J8 sdhb "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 539 (194.8 bits), Expect = 2.9e-64, Sum P(2) = 2.9e-64
 Identities = 96/126 (76%), Positives = 113/126 (89%)

Query:   217 KIDAN-DKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQR-DKENIGNAQYLQSLD 274
             +ID N  KVSKIYPLPHMYVVKDLVPD++NFYAQYKSI+P+L++ DK   G  QYLQS++
Sbjct:   118 RIDTNLSKVSKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDKSQQGKEQYLQSIE 177

Query:   275 DRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLK 334
             DR KLDGLYECILCACCSTSCPSYWWN +KYLGPAVLMQAYRW+IDSRD+ T +RL++L+
Sbjct:   178 DRDKLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWMIDSRDDFTEERLSKLQ 237

Query:   335 DPFSVY 340
             DPFS+Y
Sbjct:   238 DPFSLY 243
GO:0005743 "mitochondrial inner membrane" evidence=ISS
GO:0005749 "mitochondrial respiratory chain complex II" evidence=ISS
GO:0048039 "ubiquinone binding" evidence=ISS
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=ISS
GO:0051538 "3 iron, 4 sulfur cluster binding" evidence=ISS
GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=ISS
UNIPROTKB|B0BM36 sdhb "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
FB|FBgn0014028 SdhB "Succinate dehydrogenase B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1308598 Sdhb "succinate dehydrogenase complex, subunit B, iron sulfur (Ip)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q007T0 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8005 sdhb "succinate dehydrogenase complex, subunit B, iron sulfur (Ip)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T189 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDC1 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1914930 Sdhb "succinate dehydrogenase complex, subunit B, iron sulfur (Ip)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3W8 SDHB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P21801DHSB_YEAST1, ., 3, ., 5, ., 10.65410.38820.4962yesN/A
Q9CQA3DHSB_MOUSE1, ., 3, ., 5, ., 10.75390.36470.4397yesN/A
Q1RGP3DHSB_RICBR1, ., 3, ., 9, 9, ., 10.73910.33820.4406yesN/A
Q55CC2DHSB_DICDI1, ., 3, ., 5, ., 10.61980.33820.4006yesN/A
Q68XS0DHSB_RICTY1, ., 3, ., 9, 9, ., 10.71300.33820.4406yesN/A
Q6FWS8DHSB_CANGA1, ., 3, ., 5, ., 10.45620.64410.8656yesN/A
Q3T189DHSB_BOVIN1, ., 3, ., 5, ., 10.71420.38520.4678yesN/A
Q007T0DHSB_PIG1, ., 3, ., 5, ., 10.71420.38520.4678yesN/A
Q09545DHSB_CAEEL1, ., 3, ., 5, ., 10.63430.38820.4429yesN/A
Q59662DHSB_PARDE1, ., 3, ., 9, 9, ., 10.64910.33230.4362yesN/A
P21911DHSB_SCHPO1, ., 3, ., 5, ., 10.45340.62350.7709yesN/A
P21913DHSB_RAT1, ., 3, ., 5, ., 10.71420.38520.4645yesN/A
P21912DHSB_HUMAN1, ., 3, ., 5, ., 10.70670.38520.4678yesN/A
P21914DHSB_DROME1, ., 3, ., 5, ., 10.76290.38520.4410yesN/A
Q92JJ8DHSB_RICCN1, ., 3, ., 9, 9, ., 10.73040.33820.4406yesN/A
Q4UN71DHSB_RICFE1, ., 3, ., 9, 9, ., 10.71300.33820.4406yesN/A
Q75CI4DHSB_ASHGO1, ., 3, ., 5, ., 10.47360.63520.8275yesN/A
B0BM36DHSB_XENTR1, ., 3, ., 5, ., 10.51010.59410.7112yesN/A
Q9FJP9DHSB3_ARATH1, ., 3, ., 5, ., 10.38840.65580.7216yesN/A
Q9ZEA1DHSB_RICPR1, ., 3, ., 9, 9, ., 10.73040.33820.4406yesN/A
Q9YHT2DHSB_CHICK1, ., 3, ., 5, ., 10.72510.37940.4448yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.5.10.824
3rd Layer1.3.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
PRK05950232 PRK05950, sdhB, succinate dehydrogenase iron-sulfu 4e-72
PLN00129276 PLN00129, PLN00129, succinate dehydrogenase [ubiqu 2e-70
COG0479234 COG0479, FrdB, Succinate dehydrogenase/fumarate re 3e-51
TIGR00384220 TIGR00384, dhsB, succinate dehydrogenase and fumar 3e-46
PRK05950232 PRK05950, sdhB, succinate dehydrogenase iron-sulfu 4e-46
PRK12575235 PRK12575, PRK12575, succinate dehydrogenase iron-s 8e-43
PLN00129276 PLN00129, PLN00129, succinate dehydrogenase [ubiqu 6e-42
PRK12575235 PRK12575, PRK12575, succinate dehydrogenase iron-s 9e-32
COG0479234 COG0479, FrdB, Succinate dehydrogenase/fumarate re 2e-30
TIGR00384220 TIGR00384, dhsB, succinate dehydrogenase and fumar 9e-27
PRK12576279 PRK12576, PRK12576, succinate dehydrogenase iron-s 4e-21
PRK12577 329 PRK12577, PRK12577, succinate dehydrogenase iron-s 3e-20
PRK12385244 PRK12385, PRK12385, fumarate reductase iron-sulfur 8e-13
PRK12577329 PRK12577, PRK12577, succinate dehydrogenase iron-s 5e-11
PRK06259 486 PRK06259, PRK06259, succinate dehydrogenase/fumara 6e-11
PLN00129276 PLN00129, PLN00129, succinate dehydrogenase [ubiqu 1e-09
PRK12576279 PRK12576, PRK12576, succinate dehydrogenase iron-s 2e-09
PRK13552239 PRK13552, frdB, fumarate reductase iron-sulfur sub 1e-07
PLN00129276 PLN00129, PLN00129, succinate dehydrogenase [ubiqu 1e-06
PRK12385244 PRK12385, PRK12385, fumarate reductase iron-sulfur 5e-06
PRK05950232 PRK05950, sdhB, succinate dehydrogenase iron-sulfu 5e-05
pfam1353461 pfam13534, Fer4_17, 4Fe-4S dicluster domain 1e-04
pfam1353461 pfam13534, Fer4_17, 4Fe-4S dicluster domain 1e-04
PRK13552239 PRK13552, frdB, fumarate reductase iron-sulfur sub 2e-04
pfam13085107 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster bind 8e-04
PRK05950232 PRK05950, sdhB, succinate dehydrogenase iron-sulfu 0.003
PRK06259 486 PRK06259, PRK06259, succinate dehydrogenase/fumara 0.003
>gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information 
 Score =  223 bits (570), Expect = 4e-72
 Identities = 74/122 (60%), Positives = 90/122 (73%), Gaps = 1/122 (0%)

Query: 219 DANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKK 278
           D       I PLP + V+KDLV DM  FYAQY+SI+P+L  D       + LQS +DR+K
Sbjct: 78  DLKKGKIVIRPLPGLPVIKDLVVDMTQFYAQYRSIKPYLIND-TPPPARERLQSPEDREK 136

Query: 279 LDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFS 338
           LDGLYECILCACCSTSCPS+WWN +K+LGPA L+QAYR+I DSRDE T +RL+ L DPF 
Sbjct: 137 LDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFIADSRDEATGERLDILDDPFG 196

Query: 339 VY 340
           V+
Sbjct: 197 VF 198

Length = 232
>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|223555 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|232950 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|223555 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|232950 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>gnl|CDD|237143 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|237143 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|184136 PRK13552, frdB, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|222205 pfam13534, Fer4_17, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|222205 pfam13534, Fer4_17, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|184136 PRK13552, frdB, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|221911 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 340
KOG3049|consensus288 100.0
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, F 100.0
PLN00129276 succinate dehydrogenase [ubiquinone] iron-sulfur s 100.0
PRK13552239 frdB fumarate reductase iron-sulfur subunit; Provi 100.0
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
PRK08640249 sdhB succinate dehydrogenase iron-sulfur subunit; 100.0
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, F 100.0
PRK12386251 fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK12385244 fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
PLN00129276 succinate dehydrogenase [ubiquinone] iron-sulfur s 100.0
PRK13552239 frdB fumarate reductase iron-sulfur subunit; Provi 100.0
PRK05950232 sdhB succinate dehydrogenase iron-sulfur subunit; 100.0
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
PRK12576279 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 100.0
PRK08640249 sdhB succinate dehydrogenase iron-sulfur subunit; 100.0
PRK07570250 succinate dehydrogenase/fumarate reductase iron-su 100.0
PRK12386251 fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK12385244 fumarate reductase iron-sulfur subunit; Provisiona 99.97
KOG3049|consensus288 99.97
PRK07570250 succinate dehydrogenase/fumarate reductase iron-su 99.96
PRK12577329 succinate dehydrogenase iron-sulfur subunit; Provi 99.96
PRK12576279 succinate dehydrogenase iron-sulfur subunit; Provi 99.96
PRK05950232 sdhB succinate dehydrogenase iron-sulfur subunit; 99.96
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 99.94
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 99.9
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 99.85
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 99.84
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 99.7
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provis 98.22
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 97.48
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provis 97.18
PRK11168 396 glpC sn-glycerol-3-phosphate dehydrogenase subunit 97.14
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 97.13
COG1139459 Uncharacterized conserved protein containing a fer 97.04
COG0247 388 GlpC Fe-S oxidoreductase [Energy production and co 96.76
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 96.21
PRK13984 604 putative oxidoreductase; Provisional 96.11
TIGR03379 397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase 95.99
TIGR00273432 iron-sulfur cluster-binding protein. Members of th 95.86
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 95.8
PRK15055344 anaerobic sulfite reductase subunit A; Provisional 95.54
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit 95.48
PRK11168 396 glpC sn-glycerol-3-phosphate dehydrogenase subunit 95.25
PRK05035 695 electron transport complex protein RnfC; Provision 95.07
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 94.98
TIGR00273432 iron-sulfur cluster-binding protein. Members of th 94.86
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 94.51
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy 94.47
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 94.28
PF1348467 Fer4_16: 4Fe-4S double cluster binding domain 93.72
PF1279815 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 93.72
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s 93.64
PRK08493 819 NADH dehydrogenase subunit G; Validated 93.59
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 93.49
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 93.39
COG1150 195 HdrC Heterodisulfide reductase, subunit C [Energy 93.37
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 93.04
TIGR01945435 rnfC electron transport complex, RnfABCDGE type, C 92.78
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 92.76
TIGR03379 397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase 92.61
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 91.96
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 90.78
COG1139459 Uncharacterized conserved protein containing a fer 89.66
TIGR02910334 sulfite_red_A sulfite reductase, subunit A. Member 89.24
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s 88.88
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 88.02
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 87.33
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 86.82
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 86.55
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 86.0
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 85.49
TIGR00276282 iron-sulfur cluster binding protein, putative. Thi 85.15
PLN0007181 photosystem I subunit VII; Provisional 84.09
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 82.81
PF1374669 Fer4_18: 4Fe-4S dicluster domain 82.77
PF1374669 Fer4_18: 4Fe-4S dicluster domain 81.56
PRK0265181 photosystem I subunit VII; Provisional 80.32
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 80.26
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 80.21
>KOG3049|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-51  Score=371.25  Aligned_cols=205  Identities=61%  Similarity=1.117  Sum_probs=186.1

Q ss_pred             CCCCCcceEEEEEecCCCCCCCCCceeeeccccchhhhhhhcccccccccCCcccceeEEeeccCCCCCCCCCceEEEEE
Q psy5785          42 AEKPAKYKTFAIYRWNPDKPDEKPTMQEYKTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKV  121 (340)
Q Consensus        42 ~~~~~~~~~~~I~R~~P~~~~~~p~~q~Y~v~~~~lafr~sCrecam~iNG~p~ac~tl~I~r~~p~lp~~~PvikDLvV  121 (340)
                      +.+.++.+||+||||||+.||+||++|+|+||++                    .                         
T Consensus        40 ~~~~~rlKtFeIYRwnPd~pg~kP~~Q~y~vDL~--------------------~-------------------------   74 (288)
T KOG3049|consen   40 AATGPRLKTFEIYRWNPDNPGDKPHLQTYEVDLN--------------------D-------------------------   74 (288)
T ss_pred             cccCCccceEEEEecCCCCCCCCccceeeeecHH--------------------h-------------------------
Confidence            3456799999999999999999999999998831                    1                         


Q ss_pred             ecccccccccccchhhhcchhcccCCchhhhcccccccC--ccCcccccCCCccccCCCccCChHHHHHHHHHhhCCcch
Q psy5785         122 DLNNQLNFSARSSHATAISNAQYLQSLDDRKKLDGLYEC--ILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDE  199 (340)
Q Consensus       122 D~s~~~~~v~~~~~l~~i~~~e~~~~~e~~~~l~~~~~C--I~CG~C~s~CP~~~~ng~~flGPa~l~qa~Rf~~DpRD~  199 (340)
                          .++.|+|  +|.+|+.+     .|.+  +.|+++|  +.||+|.+.     +||                      
T Consensus        75 ----CGpMvLD--ALiKIKnE-----~Dpt--LTFRRSCREGICGSCAMN-----I~G----------------------  114 (288)
T KOG3049|consen   75 ----CGPMVLD--ALIKIKNE-----MDPT--LTFRRSCREGICGSCAMN-----ING----------------------  114 (288)
T ss_pred             ----cchHHHH--HHHHhhcc-----cCCc--eehhhhhhccccccceec-----cCC----------------------
Confidence                1346777  88888876     7777  9999999  999999988     988                      


Q ss_pred             hHHHhhhccCCCccccccccCC-CCceEEEeCCCCceeeecccChhHHHHHHHhcCCcccCCCC--CCCcccccCCHHHH
Q psy5785         200 KTADRLNQLKDPFSVYSKIDAN-DKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKE--NIGNAQYLQSLDDR  276 (340)
Q Consensus       200 ~~~~Rl~~l~~~~~c~~~~~~~-~~~~~I~pL~~~pvikDLvvD~~~~~~~~~~~~p~l~~~~~--~~~~~~~~~~~~~~  276 (340)
                           -+    .++|..+|+.+ .+..+|.||+|+.||||||+||+.||+||++|+|||+.++.  ..++.|++||.+|+
T Consensus       115 -----~N----tLACi~kId~n~sK~~kIyPLPHmfvvkDLVpDm~~FY~QYksIqPwlqrk~~~~~~g~~q~lQS~~dR  185 (288)
T KOG3049|consen  115 -----TN----TLACICKIDQNESKSTKIYPLPHMFVVKDLVPDMTNFYAQYKSIEPWLQRKNPAKEPGKKQYLQSVEDR  185 (288)
T ss_pred             -----Cc----eeEEEEeeccCCcccceeecCcceeeehhhcccHHHHHHHHhcccHHhhcCCcccCccHHHHHHhHHHH
Confidence                 34    89999999986 78899999999999999999999999999999999999876  33568999999999


Q ss_pred             HHhhchhhhhhcccccccCCCcccCCCccccHHHHHHHHHHhcCCCCCcHHHHHHhhcCCCCCC
Q psy5785         277 KKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVY  340 (340)
Q Consensus       277 ~~~~~~~~CIlCg~C~saCP~~~~~~~~flGPa~l~ka~r~~~D~Rd~~~~~rl~~l~~~~~~~  340 (340)
                      ++++.+..||||.||+.+||++|+|.+.|+||++|.+||||+.|+||+.+++||+.|.|+|++|
T Consensus       186 ~kLDGlYECILCACCsTSCPSYWWN~ekYLGPAvLmqAyRWiiDSRD~~t~eRl~~l~d~~sly  249 (288)
T KOG3049|consen  186 AKLDGLYECILCACCSTSCPSYWWNSEKYLGPAVLMQAYRWIIDSRDEATKERLAKLQDPFSLY  249 (288)
T ss_pred             HhhccHHHHHHHHHhcCCCcccccCcccccCHHHHHHHHhhhhcchhHHHHHHHHHhcCchhhe
Confidence            9999999999999999999999999999999999999999999999999999999999999987

>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>KOG3049|consensus Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] Back     alignment and domain information
>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>TIGR00273 iron-sulfur cluster-binding protein Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PRK15055 anaerobic sulfite reductase subunit A; Provisional Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR00273 iron-sulfur cluster-binding protein Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF13484 Fer4_16: 4Fe-4S double cluster binding domain Back     alignment and domain information
>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] Back     alignment and domain information
>TIGR02910 sulfite_red_A sulfite reductase, subunit A Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>TIGR00276 iron-sulfur cluster binding protein, putative Back     alignment and domain information
>PLN00071 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF13746 Fer4_18: 4Fe-4S dicluster domain Back     alignment and domain information
>PF13746 Fer4_18: 4Fe-4S dicluster domain Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
3abv_B252 Crystal Structure Of Porcine Heart Mitochondrial Co 2e-54
1zoy_B252 Crystal Structure Of Mitochondrial Respiratory Comp 2e-54
1yq3_B252 Avian Respiratory Complex Ii With Oxaloacetate And 8e-54
3vr8_B282 Mitochondrial Rhodoquinol-Fumarate Reductase From T 1e-49
2wp9_B238 Crystal Structure Of The E. Coli Succinate:quinone 1e-36
1nek_B238 Complex Ii (Succinate Dehydrogenase) From E. Coli W 1e-36
1kf6_B243 E. Coli Quinol-Fumarate Reductase With Bound Inhibi 2e-10
2bs2_B241 Quinol:fumarate Reductase From Wolinella Succinogen 6e-08
1qlb_B239 Respiratory Complex Ii-Like Fumarate Reductase From 6e-08
>pdb|3ABV|B Chain B, Crystal Structure Of Porcine Heart Mitochondrial Complex Ii Bound With N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide Length = 252 Back     alignment and structure 
Iteration: 1

 Score =  209 bits (531), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 115/126 (91%), Gaps = 2/126 (1%)
Query: 217 KIDAN-DKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQR-DKENIGNAQYLQSLD 274
           +ID N DKVSKIYPLPHMYV+KDLVPD++NFYAQYKSI+P+L++ D+   G  QYLQS++
Sbjct: 88  RIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIE 147
Query: 275 DRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLK 334
           +R+KLDGLYECILCACCSTSCPSYWWNG+KYLGPAVLMQAYRW+IDSRD+ T +RL +L+
Sbjct: 148 EREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQ 207
Query: 335 DPFSVY 340
           DPFS+Y
Sbjct: 208 DPFSLY 213
>pdb|1ZOY|B Chain B, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 252 Back     alignment and structure
>pdb|1YQ3|B Chain B, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 252 Back     alignment and structure
>pdb|3VR8|B Chain B, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 282 Back     alignment and structure
>pdb|2WP9|B Chain B, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhb His207thr Mutant Length = 238 Back     alignment and structure
>pdb|1NEK|B Chain B, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 238 Back     alignment and structure
>pdb|1KF6|B Chain B, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 243 Back     alignment and structure
>pdb|2BS2|B Chain B, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 241 Back     alignment and structure
>pdb|1QLB|B Chain B, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 239 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 8e-73
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 5e-43
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 9e-06
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 1e-69
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 3e-40
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 1e-05
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 2e-66
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 2e-39
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 8e-08
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 6e-06
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 1e-63
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 4e-36
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 9e-09
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 4e-07
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 6e-60
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 1e-35
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 9e-09
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 5e-07
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 1e-28
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 Back     alignment and structure
 Score =  224 bits (573), Expect = 8e-73
 Identities = 68/125 (54%), Positives = 92/125 (73%)

Query: 216 SKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDD 275
           S ++   K   I PLP + V++DLV DM  FYAQY+ I+P+L  + +N    ++LQ  + 
Sbjct: 80  SALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQ 139

Query: 276 RKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKD 335
           R+KLDGLYECILCACCSTSCPS+WWN +K++GPA L+ AYR++IDSRD +T  RL+ L D
Sbjct: 140 REKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSD 199

Query: 336 PFSVY 340
            FSV+
Sbjct: 200 AFSVF 204
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Length = 514 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 100.0
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 99.98
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 99.97
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 99.95
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 99.95
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 99.94
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 99.93
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 99.93
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 99.93
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 99.91
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 99.89
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 99.87
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 98.28
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 97.52
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 96.52
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 94.22
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 93.82
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 92.81
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 86.19
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 80.49
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
Probab=100.00  E-value=3.2e-43  Score=334.91  Aligned_cols=223  Identities=49%  Similarity=0.945  Sum_probs=182.7

Q ss_pred             hhhhhHHHHHhhhh--hcCCCCCCCcceEEEEEecCCCCCCCCCceeeeccccchhhhhhhcccccccccCCcccceeEE
Q psy5785          24 AKNIRSFQLSAAAS--SAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKTAKNIRSFQLSAAASSAVPAEKPAKYKTFA  101 (340)
Q Consensus        24 ~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~I~R~~P~~~~~~p~~q~Y~v~~~~lafr~sCrecam~iNG~p~ac~tl~  101 (340)
                      .++++.++.+++++  +++++++.+++++|+||||||+.++++||||+|+|+..                          
T Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~I~R~~p~~~~~~p~~~~~~v~v~--------------------------   62 (282)
T 3vr8_B            9 CRSLELVTQAARYASAATAAAPTGKRIKTFEIYRFNPEEPGAKPKLQKFDVDLD--------------------------   62 (282)
T ss_pred             HHHHHHHHHHHHhhhhccCcccCCCeeEEEEEEEeCCCCCCCCCCcEEEEEEeC--------------------------
Confidence            45666666555555  56667778899999999999986677899999987721                          


Q ss_pred             eeccCCCCCCCCCceEEEEEecccccccccccchhhhcchhcccCCchhhhcccccccC--ccCcccccCCCccccCCCc
Q psy5785         102 IYRWNPDKPDEKPTMQEYKVDLNNQLNFSARSSHATAISNAQYLQSLDDRKKLDGLYEC--ILCACCSTSCPSYWWNGEK  179 (340)
Q Consensus       102 I~r~~p~lp~~~PvikDLvVD~s~~~~~v~~~~~l~~i~~~e~~~~~e~~~~l~~~~~C--I~CG~C~s~CP~~~~ng~~  179 (340)
                        +                     -+++|++  +|.+++..     .+..  +.+..+|  +.||+|.+.     +||  
T Consensus        63 --~---------------------~~~tlLd--aL~~i~~~-----~~pt--l~~~~~C~~G~CGsC~V~-----InG--  103 (282)
T 3vr8_B           63 --K---------------------CGTMVLD--ALIKIKNE-----VDPT--LTFRRSCREGICGSCAMN-----IAG--  103 (282)
T ss_pred             --C---------------------CCCcHHH--HHHhcCcc-----cCCc--eeecCCCCCCCCCCCEEE-----ECC--
Confidence              0                     0235566  66555532     2233  6677789  899999887     998  


Q ss_pred             cCChHHHHHHHHHhhCCcchhHHHhhhccCCCccccccccC-CCCceEEEeCCCCceeeecccChhHHHHHHHhcCCccc
Q psy5785         180 YLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYSKIDA-NDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQ  258 (340)
Q Consensus       180 flGPa~l~qa~Rf~~DpRD~~~~~Rl~~l~~~~~c~~~~~~-~~~~~~I~pL~~~pvikDLvvD~~~~~~~~~~~~p~l~  258 (340)
                                               ..    .++|.+.+.+ .++.++||||++||||||||||+++||++|++++|||+
T Consensus       104 -------------------------~~----~laC~t~v~~~~~~~~tIepL~~~pVikDLvvD~~~f~~~~~~v~p~l~  154 (282)
T 3vr8_B          104 -------------------------EN----TLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQ  154 (282)
T ss_pred             -------------------------EE----ecchhhhHhHhcCCcEEeccCCCCceeeccccccHHHHHHHHHHhhhcC
Confidence                                     34    6689999875 46789999999999999999999999999999999999


Q ss_pred             CCCC-CCCcccccCCHHHHHHhhchhhhhhcccccccCCCcccCCCccccHHHHHHHHHHhcCCCCCcHHHHHHhhcCCC
Q psy5785         259 RDKE-NIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPF  337 (340)
Q Consensus       259 ~~~~-~~~~~~~~~~~~~~~~~~~~~~CIlCg~C~saCP~~~~~~~~flGPa~l~ka~r~~~D~Rd~~~~~rl~~l~~~~  337 (340)
                      .++. ..++.+++|+|+++++++.+..||+||+|+++||+++.+++.|+||+++++++|++.|+||+.+.+||+.+.+.+
T Consensus       155 ~~~~~~~~~~~~~qs~~~~~~~~~~~~CI~CG~C~~aCP~~~~~~~~~lGP~~li~a~r~~~d~rd~~~~erl~~l~~~~  234 (282)
T 3vr8_B          155 KKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGF  234 (282)
T ss_pred             CCCCCCCCchhcccCHHHHHHHHhhhhCcccCcCcccCCceeccCCcCCCHHHHHHHHHHHhCCcccchHHHHHHHhhcC
Confidence            8765 345678999999999999999999999999999999877678999999999999999999999999999887777


Q ss_pred             CCC
Q psy5785         338 SVY  340 (340)
Q Consensus       338 ~~~  340 (340)
                      |+|
T Consensus       235 ~l~  237 (282)
T 3vr8_B          235 SAF  237 (282)
T ss_pred             Ccc
Confidence            876
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 340
d1nekb1132 a.1.2.1 (B:107-238) Succinate dehydogenase {Escher 2e-25
d1nekb1132 a.1.2.1 (B:107-238) Succinate dehydogenase {Escher 3e-12
d1kf6b1138 a.1.2.1 (B:106-243) Fumarate reductase {Escherichi 5e-25
d1kf6b1138 a.1.2.1 (B:106-243) Fumarate reductase {Escherichi 9e-13
d2bs2b1133 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella 6e-22
d2bs2b1133 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella 2e-11
d2bs2b2106 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur 8e-14
d2bs2b2106 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur 8e-06
d1nekb2106 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sul 4e-13
d1nekb2106 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sul 0.002
d1kf6b2105 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur 9e-13
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure

class: All alpha proteins
fold: Globin-like
superfamily: alpha-helical ferredoxin
family: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain
domain: Succinate dehydogenase
species: Escherichia coli [TaxId: 562]

 Score = 97.3 bits (241), Expect = 2e-25
 Identities = 57/98 (58%), Positives = 76/98 (77%)

Query: 243 MNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNG 302
           M  FYAQY+ I+P+L  + +N    ++LQ  + R+KLDGLYECILCACCSTSCPS+WWN 
Sbjct: 1   MGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNP 60

Query: 303 EKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVY 340
           +K++GPA L+ AYR++IDSRD +T  RL+ L D FSV+
Sbjct: 61  DKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVF 98
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 133 Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 133 Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Length = 106 Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Length = 106 Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 105 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.82
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 99.8
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.8
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 99.79
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 99.78
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 99.74
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 99.74
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 99.73
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.61
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 99.56
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.53
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 99.41
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 95.3
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 88.01
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 85.59
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 83.46
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 82.49
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 82.36
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 82.22
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 81.65
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 81.58
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 81.47
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 81.46
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 80.53
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 80.38
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 80.3
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Globin-like
superfamily: alpha-helical ferredoxin
family: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain
domain: Fumarate reductase
species: Escherichia coli [TaxId: 562]

Probab=99.82  E-value=3.1e-21  Score=163.48  Aligned_cols=97  Identities=27%  Similarity=0.565  Sum_probs=90.4

Q ss_pred             hhHHHHHHHhcCCcccCCCCCCCcccccCCHHHHHHhhchhhhhhcccccccCCCcccCCCccccHHHHHHHHHHhcCCC
Q psy5785         243 MNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSR  322 (340)
Q Consensus       243 ~~~~~~~~~~~~p~l~~~~~~~~~~~~~~~~~~~~~~~~~~~CIlCg~C~saCP~~~~~~~~flGPa~l~ka~r~~~D~R  322 (340)
                      |++||++|++|+|||+.+.+..+..+.+|+|+++++++.+++||.||+|+++||++..+ .+|+||+.+.+++|++.|+|
T Consensus         1 m~~f~~~~~~i~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CI~Cg~C~~~CP~~~~~-~~~~gp~~~~~~~r~~~d~r   79 (138)
T d1kf6b1           1 MTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLN-PEFIGPAAITLAHRYNEDSR   79 (138)
T ss_dssp             CHHHHHHHHHTCCSCCSCCCCGGGCCCCCCHHHHHTTGGGGCCCCCCHHHHHCHHHHHC-TTSCCHHHHHHHHHHHTCTT
T ss_pred             ChHHHHHHHhccceeeCCCCCCCcccccchHHHHhhHHHHHHHHHhChhhccCccchhh-hhhhhHHHHHHHHHhccCcc
Confidence            68999999999999998877667788999999999999999999999999999998776 47999999999999999999


Q ss_pred             CCcHHHHHHhhcCCCCCC
Q psy5785         323 DEKTADRLNQLKDPFSVY  340 (340)
Q Consensus       323 d~~~~~rl~~l~~~~~~~  340 (340)
                      |....+||+.+.+++|+|
T Consensus        80 d~~~~~rl~~l~~~~g~~   97 (138)
T d1kf6b1          80 DHGKKERMAQLNSQNGVW   97 (138)
T ss_dssp             CCCTHHHHHHHHSTTTGG
T ss_pred             hhhhhhhHHHhhcccccc
Confidence            999999999999999986
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure