Psyllid ID: psy5902

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
KLFKVENYVCFTDSTVALCWVHGTPPQGNVFVANRVSKLQQTIDCERLFHILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
cEEEEccEEEEEccEEEEccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccEEEEEEEEEEEcccccccccc
cccccccEEEEcccEEEEEcccccccEEEEEEccccccHHHHccccHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHccccccccEEEEEccccccccc
klfkvenyvcftdSTVALCwvhgtppqgnvfVANRVSKLQQTIDCERLFHILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLhvlggrplhwppg
KLFKVENYVCFTDSTVALCWVHGTPPQGNVFVANRVSKLQQTIDCERLFHILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHvlggrplhwppg
KLFKVENYVCFTDSTVALCWVHGTPPQGNVFVANRVSKLQQTIDCERLFHILGHLMIvakkvaakkLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
**FKVENYVCFTDSTVALCWVHGTPPQGNVFVANRVSKLQQTIDCERLFHILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLH****
KLFKVENYVCFTDSTVALCWVHGTPPQGNVFVANRVSKLQQTIDCERLFHILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPP*
KLFKVENYVCFTDSTVALCWVHGTPPQGNVFVANRVSKLQQTIDCERLFHILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
*LFKVENYVCFTDSTVALCWVHGTPPQGNVFVANRVSKLQQTIDCERLFHILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHW**G
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KLFKVENYVCFTDSTVALCWVHGTPPQGNVFVANRVSKLQQTIDCERLFHILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query103 2.2.26 [Sep-21-2011]
P53795130 Histidine triad nucleotid yes N/A 0.883 0.7 0.43 3e-12
P49773126 Histidine triad nucleotid yes N/A 0.514 0.420 0.611 5e-11
Q5RF69126 Histidine triad nucleotid yes N/A 0.514 0.420 0.611 6e-11
P62959126 Histidine triad nucleotid yes N/A 0.514 0.420 0.611 6e-11
P70349126 Histidine triad nucleotid yes N/A 0.514 0.420 0.611 6e-11
Q9D0S9163 Histidine triad nucleotid no N/A 0.524 0.331 0.581 8e-11
P80912126 Histidine triad nucleotid yes N/A 0.699 0.571 0.466 1e-10
P62958126 Histidine triad nucleotid yes N/A 0.640 0.523 0.492 2e-10
P73481114 Uncharacterized HIT-like N/A N/A 0.514 0.464 0.574 3e-10
Q9BX68163 Histidine triad nucleotid no N/A 0.563 0.355 0.525 7e-10
>sp|P53795|HINT_CAEEL Histidine triad nucleotide-binding protein 1 OS=Caenorhabditis elegans GN=hint-1 PE=4 SV=1 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 55/100 (55%), Gaps = 9/100 (9%)

Query: 9   VCFTDSTVALCWVHGTPPQGN----VFVANRVSKLQQTIDCERLFHILGHLMIVAKKVAA 64
           + F D   AL + H   PQ      V    R+  L+  +D +    ++G LM+ A KVA 
Sbjct: 35  IIFEDDE-ALAF-HDVSPQAPIHFLVIPKRRIDMLENAVDSDAA--LIGKLMVTASKVAK 90

Query: 65  KKLIRN-YRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 103
           +  + N YRVVVNNG +  Q   HLHLHVLGGR L WPPG
Sbjct: 91  QLGMANGYRVVVNNGKDGAQSVFHLHLHVLGGRQLQWPPG 130

Caenorhabditis elegans (taxid: 6239)
>sp|P49773|HINT1_HUMAN Histidine triad nucleotide-binding protein 1 OS=Homo sapiens GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RF69|HINT1_PONAB Histidine triad nucleotide-binding protein 1 OS=Pongo abelii GN=HINT1 PE=2 SV=3 Back     alignment and function description
>sp|P62959|HINT1_RAT Histidine triad nucleotide-binding protein 1 OS=Rattus norvegicus GN=Hint1 PE=1 SV=5 Back     alignment and function description
>sp|P70349|HINT1_MOUSE Histidine triad nucleotide-binding protein 1 OS=Mus musculus GN=Hint1 PE=1 SV=3 Back     alignment and function description
>sp|Q9D0S9|HINT2_MOUSE Histidine triad nucleotide-binding protein 2, mitochondrial OS=Mus musculus GN=Hint2 PE=2 SV=1 Back     alignment and function description
>sp|P80912|HINT1_RABIT Histidine triad nucleotide-binding protein 1 OS=Oryctolagus cuniculus GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|P62958|HINT1_BOVIN Histidine triad nucleotide-binding protein 1 OS=Bos taurus GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|P73481|YHIT_SYNY3 Uncharacterized HIT-like protein slr1234 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1234 PE=4 SV=1 Back     alignment and function description
>sp|Q9BX68|HINT2_HUMAN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens GN=HINT2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
443714561173 hypothetical protein CAPTEDRAFT_184620 [ 0.563 0.335 0.573 4e-12
321455610170 hypothetical protein DAPPUDRAFT_331763 [ 0.514 0.311 0.666 8e-12
328777305 596 PREDICTED: hypothetical protein LOC40840 0.922 0.159 0.373 1e-11
380030650 478 PREDICTED: cyclin-dependent kinase 6-lik 0.922 0.198 0.373 1e-11
340383291128 PREDICTED: histidine triad nucleotide-bi 0.864 0.695 0.431 2e-11
425472461113 conserved hypothetical protein [Microcys 0.640 0.584 0.507 3e-11
425467287113 conserved hypothetical protein [Microcys 0.640 0.584 0.507 3e-11
443656395113 histidine triad nucleotide-binding prote 0.640 0.584 0.507 4e-11
425461015113 conserved hypothetical protein [Microcys 0.640 0.584 0.492 5e-11
422305101113 conserved hypothetical protein [Microcys 0.640 0.584 0.507 5e-11
>gi|443714561|gb|ELU06925.1| hypothetical protein CAPTEDRAFT_184620 [Capitella teleta] Back     alignment and taxonomy information
 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 3/61 (4%)

Query: 44  DCERLFHILGHLMIVAKKVA-AKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPP 102
           DC++   +LGHLM+ AKKVA A+ L++ YRVV+NNG E  Q   HLH+HV+GGR + WPP
Sbjct: 115 DCDQ--QLLGHLMLTAKKVAEAENLVKGYRVVINNGVEGSQSVYHLHIHVMGGRQMEWPP 172

Query: 103 G 103
           G
Sbjct: 173 G 173

Source: Capitella teleta

Species: Capitella teleta

Genus: Capitella

Family: Capitellidae

Order: Capitellida

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota
>gi|321455610|gb|EFX66738.1| hypothetical protein DAPPUDRAFT_331763 [Daphnia pulex] Back     alignment and taxonomy information
>gi|328777305|ref|XP_391955.3| PREDICTED: hypothetical protein LOC408406 [Apis mellifera] Back     alignment and taxonomy information
>gi|380030650|ref|XP_003698956.1| PREDICTED: cyclin-dependent kinase 6-like [Apis florea] Back     alignment and taxonomy information
>gi|340383291|ref|XP_003390151.1| PREDICTED: histidine triad nucleotide-binding protein 1-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|425472461|ref|ZP_18851302.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701] gi|389881462|emb|CCI37994.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701] Back     alignment and taxonomy information
>gi|425467287|ref|ZP_18846571.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809] gi|389829958|emb|CCI28311.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809] Back     alignment and taxonomy information
>gi|443656395|ref|ZP_21131672.1| histidine triad nucleotide-binding protein 1 [Microcystis aeruginosa DIANCHI905] gi|159028303|emb|CAO87201.1| unnamed protein product [Microcystis aeruginosa PCC 7806] gi|443333421|gb|ELS47982.1| histidine triad nucleotide-binding protein 1 [Microcystis aeruginosa DIANCHI905] Back     alignment and taxonomy information
>gi|425461015|ref|ZP_18840495.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808] gi|389826187|emb|CCI23477.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808] Back     alignment and taxonomy information
>gi|422305101|ref|ZP_16392438.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806] gi|389789658|emb|CCI14387.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
ZFIN|ZDB-GENE-040927-8126 hint1 "histidine triad nucleot 0.922 0.753 0.353 6.6e-10
UNIPROTKB|P49773126 HINT1 "Histidine triad nucleot 0.514 0.420 0.518 8.4e-10
UNIPROTKB|Q5RF69126 HINT1 "Histidine triad nucleot 0.514 0.420 0.518 8.4e-10
MGI|MGI:1321133126 Hint1 "histidine triad nucleot 0.514 0.420 0.518 1.8e-09
RGD|620960126 Hint1-ps1 "histidine triad nuc 0.514 0.420 0.518 1.8e-09
UNIPROTKB|D4A269126 D4A269 "Uncharacterized protei 0.514 0.420 0.518 1.8e-09
UNIPROTKB|P80912126 HINT1 "Histidine triad nucleot 0.699 0.571 0.4 2.2e-09
FB|FBgn0031459150 CG2862 [Drosophila melanogaste 0.514 0.353 0.5 2.9e-09
UNIPROTKB|J9P9J0126 HINT1 "Uncharacterized protein 0.514 0.420 0.5 2.9e-09
ZFIN|ZDB-GENE-070410-139161 hint2 "histidine triad nucleot 0.640 0.409 0.405 2.9e-09
ZFIN|ZDB-GENE-040927-8 hint1 "histidine triad nucleotide binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 142 (55.0 bits), Expect = 6.6e-10, P = 6.6e-10
 Identities = 35/99 (35%), Positives = 52/99 (52%)

Query:     7 NYVCFTDSTVALCWVHGTPPQGNVFVANR-VSKLQQTIDCERLFHILGHLMIXXXX-XXX 64
             N +   D  +A   V    P   + V  + +S++ +  D ++   +LGH+MI        
Sbjct:    30 NIIYEDDQCIAFNDVAPQAPTHFLVVPRKPISQISKVEDADK--ELLGHMMIVAKKCAEQ 87

Query:    65 XXLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 103
               L R YR+VVN+G +  Q   H+H+HVLGGR L WPPG
Sbjct:    88 VGLPRGYRLVVNDGPDGGQSVYHIHIHVLGGRQLGWPPG 126
GO:0003824 "catalytic activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|P49773 HINT1 "Histidine triad nucleotide-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RF69 HINT1 "Histidine triad nucleotide-binding protein 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1321133 Hint1 "histidine triad nucleotide binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620960 Hint1-ps1 "histidine triad nucleotide binding protein 1, pseudogene 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A269 D4A269 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P80912 HINT1 "Histidine triad nucleotide-binding protein 1" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
FB|FBgn0031459 CG2862 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9J0 HINT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-139 hint2 "histidine triad nucleotide binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53795HINT_CAEELNo assigned EC number0.430.88340.7yesN/A
P62959HINT1_RAT3, ., -, ., -, ., -0.61110.51450.4206yesN/A
Q9Z863YHIT_CHLPNNo assigned EC number0.31680.85430.8yesN/A
Q5RF69HINT1_PONAB3, ., -, ., -, ., -0.61110.51450.4206yesN/A
P49773HINT1_HUMAN3, ., -, ., -, ., -0.61110.51450.4206yesN/A
P70349HINT1_MOUSE3, ., -, ., -, ., -0.61110.51450.4206yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
cd01276104 cd01276, PKCI_related, Protein Kinase C Interactin 8e-12
pfam0123097 pfam01230, HIT, HIT domain 2e-08
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme 8e-08
PRK10687119 PRK10687, PRK10687, purine nucleoside phosphoramid 2e-06
COG0537138 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hy 7e-06
cd01277103 cd01277, HINT_subgroup, HINT (histidine triad nucl 1e-04
cd0046886 cd00468, HIT_like, HIT family: HIT (Histidine tria 4e-04
>gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information 
 Score = 56.0 bits (136), Expect = 8e-12
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 50  HILGHLMIVAKKVAAKKLIRN--YRVVVNNGWEAVQFSGHLHLHVLGG 95
            +LGHL+  A KVA    I    YR+V+N G +  Q   HLHLH+LGG
Sbjct: 57  ELLGHLLSAAAKVAKDLGIAEDGYRLVINCGKDGGQEVFHLHLHLLGG 104

The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members. Length = 104
>gnl|CDD|216377 pfam01230, HIT, HIT domain Back     alignment and domain information
>gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>gnl|CDD|182648 PRK10687, PRK10687, purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>gnl|CDD|223611 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|238608 cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|238263 cd00468, HIT_like, HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
KOG3275|consensus127 100.0
PRK10687119 purine nucleoside phosphoramidase; Provisional 99.96
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 99.94
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 99.93
cd01276104 PKCI_related Protein Kinase C Interacting protein 99.92
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 99.88
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 99.88
KOG3379|consensus150 99.87
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 99.87
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 99.85
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 99.69
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 99.6
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 99.59
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 99.58
PLN02643336 ADP-glucose phosphorylase 99.5
KOG4359|consensus166 99.38
KOG0562|consensus184 98.41
PF02744166 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf 97.95
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [En 97.61
PF04677121 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In 97.26
KOG3969|consensus310 96.92
PLN03103 403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 96.39
KOG2958|consensus354 95.68
KOG2720|consensus 431 91.34
COG4360 298 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetr 90.84
cd00608 329 GalT Galactose-1-phosphate uridyl transferase (Gal 89.52
COG5075305 Uncharacterized conserved protein [Function unknow 87.37
COG1085 338 GalT Galactose-1-phosphate uridylyltransferase [En 86.02
PLN02643 336 ADP-glucose phosphorylase 85.86
KOG2476|consensus 528 83.29
PF01087183 GalP_UDP_transf: Galactose-1-phosphate uridyl tran 83.19
>KOG3275|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.1e-33  Score=187.24  Aligned_cols=94  Identities=41%  Similarity=0.667  Sum_probs=89.5

Q ss_pred             CccEEEECCCEEEeccccCCCcCCccee----eccccccccCchhhhHHHHHHHHHHHHHHHHHh-hCCCceEEEEecCc
Q psy5902           5 VENYVCFTDSTVALCWVHGTPPQGNVFV----ANRVSKLQQTIDCERLFHILGHLMIVAKKVAAK-KLIRNYRVVVNNGW   79 (103)
Q Consensus         5 ~~~iv~e~d~~~a~~af~d~~P~~~gH~----k~Hi~~l~~l~~~e~~~~~l~~l~~~a~~v~~~-~~~~g~~i~~n~G~   79 (103)
                      |..++||||+++|   |+|+.|++|||+    |+|+..+.-+.+.+.  ++++++|.++++++++ ++.+|||+++|||+
T Consensus        29 Pa~ii~Edd~~lA---F~Di~Pqap~HfLvIPK~hi~~~s~aed~~~--e~Lg~ll~~~k~vak~~Gl~~gYrvv~NnG~  103 (127)
T KOG3275|consen   29 PAKIIFEDDRCLA---FHDIAPQAPGHFLVIPKKHITQLSKAEDRDD--ELLGHLLPVAKKVAKALGLEDGYRVVQNNGK  103 (127)
T ss_pred             CcceEeeccceEE---EEecCCCCCceEEEeecccccchhhcccCCH--HHHHHHHHHHHHHHHHhCcccceeEEEcCCc
Confidence            4589999999999   999999999999    999988888888777  9999999999999999 89899999999999


Q ss_pred             cCCCCcceeeeeeEcCCCCCCCCC
Q psy5902          80 EAVQFSGHLHLHVLGGRPLHWPPG  103 (103)
Q Consensus        80 ~agQ~V~HlHlHvip~~~~~~~~g  103 (103)
                      .++|||.|+|+||+||++++||||
T Consensus       104 ~g~QsV~HvH~HvlgGrqm~WPpg  127 (127)
T KOG3275|consen  104 DGHQSVYHVHLHVLGGRQMQWPPG  127 (127)
T ss_pred             ccceEEEEEEEEEeCCcccCCCCC
Confidence            999999999999999999999997

>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>KOG3379|consensus Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>KOG4359|consensus Back     alignment and domain information
>KOG0562|consensus Back     alignment and domain information
>PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues Back     alignment and domain information
>KOG3969|consensus Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>KOG2958|consensus Back     alignment and domain information
>KOG2720|consensus Back     alignment and domain information
>COG4360 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphosphate phosphorylase II) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>COG5075 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>KOG2476|consensus Back     alignment and domain information
>PF01087 GalP_UDP_transf: Galactose-1-phosphate uridyl transferase, N-terminal domain; InterPro: IPR005849 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
3o1z_A126 High Resolution Crystal Structure Of Histidine Tria 3e-09
3o1c_A126 High Resolution Crystal Structure Of Histidine Tria 4e-09
3o1x_A126 High Resolution Crystal Structure Of Histidine Tria 8e-09
4eqe_A128 Crystal Structure Of Histidine Triad Nucleotide-Bin 9e-09
1kpa_A126 Pkci-1-Zinc Length = 126 9e-09
1kpb_A125 Pkci-1-Apo Length = 125 9e-09
3tw2_A126 High Resolution Structure Of Human Histidine Triad 9e-09
1rzy_A126 Crystal Structure Of Rabbit Hint Complexed With N- 1e-08
3rhn_A115 Histidine Triad Nucleotide-Binding Protein (Hint) F 1e-08
>pdb|3O1Z|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) Double Cysteine Mutant From Rabbit Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (49%), Gaps = 9/105 (8%)
Query: 4   KVENYVCFTDSTVALCWVHGTPPQGN----VFVANRVSKLQQTIDCERLFHILGHLMIXX 59
           ++   + F D   AL + H   PQ      V     +S++    D +    +LGHLMI  
Sbjct: 26  EIPAKIIFEDDQ-ALAF-HDISPQAPTHFLVIPKKHISQISAAEDADE--SLLGHLMIVG 81
Query: 60  XXXXXXX-LIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 103
                   L + YR+VVN G +  Q   H+HLHVLGGR ++WPPG
Sbjct: 82  KKAAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126
>pdb|3O1C|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C38a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|3O1X|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C84a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|4EQE|A Chain A, Crystal Structure Of Histidine Triad Nucleotide-Binding Protein 1 (Hint1) From Human Complexed With Lys-Ams Length = 128 Back     alignment and structure
>pdb|1KPA|A Chain A, Pkci-1-Zinc Length = 126 Back     alignment and structure
>pdb|1KPB|A Chain A, Pkci-1-Apo Length = 125 Back     alignment and structure
>pdb|3TW2|A Chain A, High Resolution Structure Of Human Histidine Triad Nucleotide-binding Protein 1 (hhint1)/amp Complex In A Monoclinic Space Group Length = 126 Back     alignment and structure
>pdb|1RZY|A Chain A, Crystal Structure Of Rabbit Hint Complexed With N- Ethylsulfamoyladenosine Length = 126 Back     alignment and structure
>pdb|3RHN|A Chain A, Histidine Triad Nucleotide-Binding Protein (Hint) From Rabbit Complexed With Gmp Length = 115 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 1e-21
3oj7_A117 Putative histidine triad family protein; hydrolase 1e-20
4egu_A119 Histidine triad (HIT) protein; structural genomics 2e-18
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 2e-15
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 1e-14
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 2e-14
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 3e-13
3ksv_A149 Uncharacterized protein; HIT family, structural ge 1e-12
3r6f_A135 HIT family protein; structural genomics, seattle s 5e-11
3imi_A147 HIT family protein; structural genomics, infectiou 1e-10
2eo4_A149 150AA long hypothetical histidine triad nucleotid 2e-10
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 3e-10
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 6e-10
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 1e-08
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 3e-04
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
 Score = 81.4 bits (202), Expect = 1e-21
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (1%)

Query: 51  ILGHLMIVAKKVAAKKLIRN-YRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 103
           +LGHLMIV KK AA   ++  YR+VVN G +  Q   H+HLHVLGGR ++WPPG
Sbjct: 73  LLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Length = 119 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Length = 138 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} Length = 149 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Length = 135 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} Length = 147 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Length = 173 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Length = 161 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 100.0
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 99.97
3oj7_A117 Putative histidine triad family protein; hydrolase 99.97
4egu_A119 Histidine triad (HIT) protein; structural genomics 99.96
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 99.95
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 99.94
3ksv_A149 Uncharacterized protein; HIT family, structural ge 99.93
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 99.92
3imi_A147 HIT family protein; structural genomics, infectiou 99.92
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 99.92
2eo4_A149 150AA long hypothetical histidine triad nucleotid 99.91
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 99.91
3r6f_A135 HIT family protein; structural genomics, seattle s 99.91
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 99.9
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 99.88
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 99.87
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 99.87
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 99.84
3ohe_A137 Histidine triad (HIT) protein; structural genomics 99.82
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 99.81
3nrd_A135 Histidine triad (HIT) protein; structural genomics 99.77
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 99.76
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 99.72
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 99.7
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 99.67
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 99.0
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 98.94
1z84_A 351 Galactose-1-phosphate uridyl transferase-like prot 97.62
1gup_A 348 Galactose-1-phosphate uridylyltransferase; nucleot 87.24
3vg8_G116 Hypothetical protein TTHB210; alpha and beta prote 84.43
2pof_A227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 80.91
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
Probab=100.00  E-value=3.6e-33  Score=187.14  Aligned_cols=94  Identities=41%  Similarity=0.719  Sum_probs=89.3

Q ss_pred             CccEEEECCCEEEeccccCCCcCCccee----eccccccccCchhhhHHHHHHHHHHHHHHHHHh-hCCCceEEEEecCc
Q psy5902           5 VENYVCFTDSTVALCWVHGTPPQGNVFV----ANRVSKLQQTIDCERLFHILGHLMIVAKKVAAK-KLIRNYRVVVNNGW   79 (103)
Q Consensus         5 ~~~iv~e~d~~~a~~af~d~~P~~~gH~----k~Hi~~l~~l~~~e~~~~~l~~l~~~a~~v~~~-~~~~g~~i~~n~G~   79 (103)
                      ++.+|||||.++|   |+|++|.+|||+    |+|++++.||+++|.  +++++|+.++++++++ ..++|||+++|+|+
T Consensus        28 ~~~iv~e~e~~~a---f~d~~P~~pgH~LViPk~H~~~l~dL~~~e~--~~l~~l~~~~~~~~~~~~~~~g~ni~~n~g~  102 (126)
T 3o1c_A           28 PAKIIFEDDQALA---FHDISPQAPTHFLVIPKKHISQISAAEDADE--SLLGHLMIVGKKCAADLGLKKGYRMVVNEGS  102 (126)
T ss_dssp             CCCEEEECSSEEE---EECSSCSSSEEEEEEESSCCCCGGGCCGGGH--HHHHHHHHHHHHHHHHTTCTTCEEEECCCHH
T ss_pred             cCCEEEECCCEEE---EECCCCCCCceEEEEechHhchHhhCchhHH--HHHHHHHHHHHHHHHHhCCCCCeEEEEecCC
Confidence            4689999999999   999999999999    999999999999988  8999999999999987 55679999999999


Q ss_pred             cCCCCcceeeeeeEcCCCCCCCCC
Q psy5902          80 EAVQFSGHLHLHVLGGRPLHWPPG  103 (103)
Q Consensus        80 ~agQ~V~HlHlHvip~~~~~~~~g  103 (103)
                      .|||+|+|+|+|||||++++||||
T Consensus       103 ~agq~v~HlH~Hiipr~~~~~~~~  126 (126)
T 3o1c_A          103 DGGQSVYHVHLHVLGGRQMNWPPG  126 (126)
T ss_dssp             HHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             ccCCccCEeEEEEeCCcccCCCCC
Confidence            999999999999999999999998
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>3vg8_G Hypothetical protein TTHB210; alpha and beta proteins (A+B), unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 103
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 1e-12
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium ther 2e-04
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.6 bits (136), Expect = 1e-12
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 1/55 (1%)

Query: 50  HILGHLMIVAKKVAAKKLIRN-YRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 103
            +LGHLMIV KK AA   +   YR+VVN G +  Q   H+HLHVLGGR +HWPPG
Sbjct: 57  SLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 111
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 100.0
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 99.95
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 99.94
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 99.94
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 99.94
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 99.84
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 99.77
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 99.73
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 99.47
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 95.8
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escheri 93.8
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.2e-34  Score=189.54  Aligned_cols=94  Identities=43%  Similarity=0.710  Sum_probs=88.9

Q ss_pred             CccEEEECCCEEEeccccCCCcCCccee----eccccccccCchhhhHHHHHHHHHHHHHHHHHh-hCCCceEEEEecCc
Q psy5902           5 VENYVCFTDSTVALCWVHGTPPQGNVFV----ANRVSKLQQTIDCERLFHILGHLMIVAKKVAAK-KLIRNYRVVVNNGW   79 (103)
Q Consensus         5 ~~~iv~e~d~~~a~~af~d~~P~~~gH~----k~Hi~~l~~l~~~e~~~~~l~~l~~~a~~v~~~-~~~~g~~i~~n~G~   79 (103)
                      +..+|||||.++|   |+|++|.++||+    |+|++++.+|++++.  +++..++..+++++++ ..++|||+++|+|+
T Consensus        13 p~~ivyede~~~a---f~D~~P~~~gH~LViPk~H~~~~~~l~~~~~--~~~~~~~~~~~~~~~~~~~~~g~~i~~n~g~   87 (111)
T d1kpfa_          13 PAKIIFEDDRCLA---FHDISPQAPTHFLVIPKKHISQISVAEDDDE--SLLGHLMIVGKKCAADLGLNKGYRMVVNEGS   87 (111)
T ss_dssp             CCCEEEECSSEEE---EECSSCSSSEEEEEEESSCCSCGGGCCGGGH--HHHHHHHHHHHHHHHHTTCTTCEEEECCCHH
T ss_pred             CccEEEeCCCEEE---EecCCCCCCceEEEeecchhcchhhhhhHHH--HHHHHHHHHHHHHHHHhCCCCCEEEEEeCCc
Confidence            5689999999999   999999999999    999999999999887  8899999999999887 44789999999999


Q ss_pred             cCCCCcceeeeeeEcCCCCCCCCC
Q psy5902          80 EAVQFSGHLHLHVLGGRPLHWPPG  103 (103)
Q Consensus        80 ~agQ~V~HlHlHvip~~~~~~~~g  103 (103)
                      .|||+|+|+|+|||||++++||||
T Consensus        88 ~agq~V~HlH~Hiip~~~l~wppg  111 (111)
T d1kpfa_          88 DGGQSVYHVHLHVLGGRQMHWPPG  111 (111)
T ss_dssp             HHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             cCCcccceeEEEEeCCCcCCCCcC
Confidence            999999999999999999999998
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure