Psyllid ID: psy5960

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MTLKHHPKRVRHYDRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHFDIDEDWMVLGVSRSANADEGKSLELANADEGRRHVT
ccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEcccccccEEEEEEccccccccccccccccEEEcccccccccccccccccccccccccEEEEEEccccccccccccccccccc
cccccEEEEEEEccHHHHHHHHHHHHHHHHcccccEEEEcccccccEEEEEEcccccccccccccccccEEEccccccccccEEEEccccEcHHHHHHHHHHHHHHHcccccccccHHHcc
mtlkhhpkrvrhydrgRLRDELRRALDVWskhskltfrevnddRADILIYFEkenhwdgypfdgpgkilahaffpgsgrggdahfdidedWMVLgvsrsanadegkslelanadegrrhvt
mtlkhhpkrvrhydrgrlrdELRRALdvwskhskltfrevnddrADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHFDIDEDWMVLGVSrsanadegkslelanadegrrhvt
MTLKHHPKRVRHYDRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHFDIDEDWMVLGVSRSANADEGKSLELANADEGRRHVT
********************ELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHFDIDEDWMVLGV*************************
MTLKHHPKRVRHYDRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHFDIDEDWMVLGVSRSANADEGKSLELA**********
**********RHYDRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHFDIDEDWMVLGVSRSANADEGKSLELANA********
***KHHPKRVRHYDRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHFDIDEDWMVLGVSRSANADEGKSLELA**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLKHHPKRVRHYDRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHFDIDEDWMVLGVSRSANADEGKSLELANADEGRRHVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
Q02853 492 Stromelysin-3 OS=Mus musc yes N/A 0.652 0.160 0.544 3e-18
Q499S5 491 Stromelysin-3 OS=Rattus n yes N/A 0.652 0.160 0.544 5e-18
P33436 662 72 kDa type IV collagenas no N/A 0.611 0.111 0.540 2e-17
P21692 469 Interstitial collagenase yes N/A 0.917 0.236 0.420 2e-17
P33434 662 72 kDa type IV collagenas no N/A 0.611 0.111 0.540 2e-17
P24347 488 Stromelysin-3 OS=Homo sap yes N/A 0.636 0.157 0.545 2e-17
Q11005 477 Stromelysin-3 OS=Xenopus N/A N/A 0.636 0.161 0.532 3e-17
P50757 662 72 kDa type IV collagenas yes N/A 0.611 0.111 0.527 5e-17
P08253 660 72 kDa type IV collagenas no N/A 0.611 0.112 0.527 6e-17
P28053 469 Interstitial collagenase no N/A 0.884 0.228 0.417 7e-17
>sp|Q02853|MMP11_MOUSE Stromelysin-3 OS=Mus musculus GN=Mmp11 PE=1 SV=2 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 54/79 (68%)

Query: 15  RGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFF 74
           R ++R  +  AL VWS+ + LTF EV++ RADI+I F +  H D  PFDGPG ILAHAFF
Sbjct: 127 REQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDFARYWHGDNLPFDGPGGILAHAFF 186

Query: 75  PGSGRGGDAHFDIDEDWMV 93
           P + R GD HFD DE W +
Sbjct: 187 PKTHREGDVHFDYDETWTI 205
May play an important role in the progression of epithelial malignancies.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|Q499S5|MMP11_RAT Stromelysin-3 OS=Rattus norvegicus GN=Mmp11 PE=1 SV=1 Back     alignment and function description
>sp|P33436|MMP2_RAT 72 kDa type IV collagenase OS=Rattus norvegicus GN=Mmp2 PE=2 SV=2 Back     alignment and function description
>sp|P21692|MMP1_PIG Interstitial collagenase OS=Sus scrofa GN=MMP1 PE=1 SV=2 Back     alignment and function description
>sp|P33434|MMP2_MOUSE 72 kDa type IV collagenase OS=Mus musculus GN=Mmp2 PE=2 SV=1 Back     alignment and function description
>sp|P24347|MMP11_HUMAN Stromelysin-3 OS=Homo sapiens GN=MMP11 PE=1 SV=3 Back     alignment and function description
>sp|Q11005|MMP11_XENLA Stromelysin-3 OS=Xenopus laevis GN=mmp11 PE=1 SV=1 Back     alignment and function description
>sp|P50757|MMP2_RABIT 72 kDa type IV collagenase OS=Oryctolagus cuniculus GN=MMP2 PE=2 SV=1 Back     alignment and function description
>sp|P08253|MMP2_HUMAN 72 kDa type IV collagenase OS=Homo sapiens GN=MMP2 PE=1 SV=2 Back     alignment and function description
>sp|P28053|MMP1_BOVIN Interstitial collagenase OS=Bos taurus GN=MMP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
328721273 642 PREDICTED: matrix metalloproteinase-17-l 0.768 0.144 0.602 2e-27
328783162 419 PREDICTED: matrix metalloproteinase-25-l 0.809 0.233 0.598 2e-25
307207361 282 Matrix metalloproteinase-25 [Harpegnatho 0.809 0.347 0.578 2e-24
383861584 595 PREDICTED: matrix metalloproteinase-24-l 0.809 0.164 0.578 2e-24
332027325183 Matrix metalloproteinase-25 [Acromyrmex 0.809 0.535 0.558 5e-24
345480289 672 PREDICTED: matrix metalloproteinase-24-l 0.917 0.165 0.547 6e-24
350398989 645 PREDICTED: matrix metalloproteinase-15-l 0.818 0.153 0.578 6e-24
242002936 566 conserved hypothetical protein [Pediculu 0.859 0.183 0.571 2e-23
322789997158 hypothetical protein SINV_02809 [Solenop 0.809 0.620 0.539 3e-23
198460006 713 GA24215 [Drosophila pseudoobscura pseudo 0.785 0.133 0.54 1e-22
>gi|328721273|ref|XP_001945941.2| PREDICTED: matrix metalloproteinase-17-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%)

Query: 1   MTLKHHPKRVRHYDRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGY 60
           +T     +R+   D G +R +L +A  VW+K+SKLTFREVN + ADIL++FEK  H DGY
Sbjct: 142 LTWSLRTRRLDKVDHGWVRSDLNKAFQVWAKYSKLTFREVNSESADILVFFEKGYHGDGY 201

Query: 61  PFDGPGKILAHAFFPGSGRGGDAHFDIDEDWMV 93
           PFDGPG++LAHAFFPG+GRGGDAHFD +E+W+V
Sbjct: 202 PFDGPGQVLAHAFFPGTGRGGDAHFDEEEEWLV 234

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328783162|ref|XP_001120736.2| PREDICTED: matrix metalloproteinase-25-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307207361|gb|EFN85111.1| Matrix metalloproteinase-25 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383861584|ref|XP_003706265.1| PREDICTED: matrix metalloproteinase-24-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332027325|gb|EGI67409.1| Matrix metalloproteinase-25 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345480289|ref|XP_003424120.1| PREDICTED: matrix metalloproteinase-24-like isoform 2 [Nasonia vitripennis] gi|345480291|ref|XP_001607648.2| PREDICTED: matrix metalloproteinase-24-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350398989|ref|XP_003485375.1| PREDICTED: matrix metalloproteinase-15-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242002936|ref|XP_002422548.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212505338|gb|EEB09810.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322789997|gb|EFZ15073.1| hypothetical protein SINV_02809 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|198460006|ref|XP_002138767.1| GA24215 [Drosophila pseudoobscura pseudoobscura] gi|198136874|gb|EDY69325.1| GA24215 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
FB|FBgn0033438 758 Mmp2 "Matrix metalloproteinase 0.694 0.110 0.607 1.4e-23
UNIPROTKB|Q5ZMQ8263 MMP7 "Uncharacterized protein" 0.785 0.361 0.515 5.1e-19
UNIPROTKB|F1NN56 553 MMP9 "Uncharacterized protein" 0.909 0.198 0.462 2.3e-18
UNIPROTKB|F1NGT3 555 MMP9 "Uncharacterized protein" 0.909 0.198 0.462 2.3e-18
UNIPROTKB|Q7T1F1134 MMP11 "Stromelysin-3" [Gallus 0.652 0.589 0.531 2.8e-18
UNIPROTKB|F1PSL8 489 MMP11 "Uncharacterized protein 0.652 0.161 0.544 4.5e-18
UNIPROTKB|E9PED7 354 MMP11 "Stromelysin-3" [Homo sa 0.768 0.262 0.453 4.6e-18
MGI|MGI:97008 492 Mmp11 "matrix metallopeptidase 0.652 0.160 0.544 4.6e-18
UNIPROTKB|E2R288267 MMP7 "Uncharacterized protein" 0.834 0.378 0.462 7.5e-18
UNIPROTKB|F1PU00267 MMP7 "Uncharacterized protein" 0.834 0.378 0.462 7.5e-18
FB|FBgn0033438 Mmp2 "Matrix metalloproteinase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 281 (104.0 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 51/84 (60%), Positives = 61/84 (72%)

Query:    14 DRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAF 73
             D  ++   ++ ALDVW+ HSKLTFREV  D+ADI I F +  H DGY FDGPG++LAHAF
Sbjct:   160 DASKVERMVQTALDVWANHSKLTFREVYSDQADIQILFARRAHGDGYKFDGPGQVLAHAF 219

Query:    74 FPGSGRGGDAHFDIDEDWMVLGVS 97
             +PG GRGGDAHFD DE W   G S
Sbjct:   220 YPGEGRGGDAHFDADETWNFDGES 243
GO:0004222 "metalloendopeptidase activity" evidence=ISS;IDA;NAS
GO:0048477 "oogenesis" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0006508 "proteolysis" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031012 "extracellular matrix" evidence=IEA
GO:0030425 "dendrite" evidence=IMP
GO:0034769 "basement membrane disassembly" evidence=IMP
GO:0007561 "imaginal disc eversion" evidence=IMP
GO:0046529 "imaginal disc fusion, thorax closure" evidence=IMP
GO:0007426 "tracheal outgrowth, open tracheal system" evidence=IMP
GO:0071711 "basement membrane organization" evidence=IMP
GO:0035202 "tracheal pit formation in open tracheal system" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
GO:0040037 "negative regulation of fibroblast growth factor receptor signaling pathway" evidence=IDA
GO:0042060 "wound healing" evidence=IMP
GO:0002218 "activation of innate immune response" evidence=IDA
UNIPROTKB|Q5ZMQ8 MMP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NN56 MMP9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGT3 MMP9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q7T1F1 MMP11 "Stromelysin-3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PSL8 MMP11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PED7 MMP11 "Stromelysin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97008 Mmp11 "matrix metallopeptidase 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R288 MMP7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PU00 MMP7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q499S5MMP11_RAT3, ., 4, ., 2, 4, ., -0.54430.65280.1608yesN/A
P50757MMP2_RABIT3, ., 4, ., 2, 4, ., 2, 40.52700.61150.1117yesN/A
P24347MMP11_HUMAN3, ., 4, ., 2, 4, ., -0.54540.63630.1577yesN/A
Q02853MMP11_MOUSE3, ., 4, ., 2, 4, ., -0.54430.65280.1605yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.24LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
pfam00413159 pfam00413, Peptidase_M10, Matrixin 1e-32
cd04278157 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, 5e-32
smart00235139 smart00235, ZnMc, Zinc-dependent metalloprotease 3e-09
cd04277186 cd04277, ZnMc_serralysin_like, Zinc-dependent meta 2e-04
cd04327198 cd04327, ZnMc_MMP_like_3, Zinc-dependent metallopr 0.004
>gnl|CDD|215908 pfam00413, Peptidase_M10, Matrixin Back     alignment and domain information 
 Score =  111 bits (280), Expect = 1e-32
 Identities = 49/92 (53%), Positives = 58/92 (63%), Gaps = 5/92 (5%)

Query: 19  RDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSG 78
           R  +RRA  VWS+ + LTF EV    ADI I F +  H DGYPFDGPG +LAHAFFPG  
Sbjct: 24  RRAIRRAFKVWSEVTPLTFTEVPTGTADIKIGFGRGEHGDGYPFDGPGGVLAHAFFPG-P 82

Query: 79  RGGDAHFDIDEDWMVLGVSRSANADEGKSLEL 110
            GGD HFD DE W V     +++  EG +L L
Sbjct: 83  IGGDIHFDDDEQWTV----GNSSGPEGTNLFL 110

The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis. Length = 159
>gnl|CDD|239805 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>gnl|CDD|214576 smart00235, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information
>gnl|CDD|239804 cd04277, ZnMc_serralysin_like, Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>gnl|CDD|239819 cd04327, ZnMc_MMP_like_3, Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
KOG1565|consensus 469 99.97
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix me 99.89
PF00413154 Peptidase_M10: Matrixin This Prosite motif covers 99.84
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM 99.66
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc 99.49
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloproteas 99.27
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ 99.04
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-fa 98.76
cd04327198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM 98.69
cd04276197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM 97.99
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, 97.5
PF12388211 Peptidase_M57: Dual-action HEIGH metallo-peptidase 96.04
PF02031132 Peptidase_M7: Streptomyces extracellular neutral p 95.07
) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400191 Astacin: Astacin (Peptidase family M12A) This Pros 92.96
cd04281200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 90.56
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloproteas 89.58
cd04273207 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, A 86.34
>KOG1565|consensus Back     alignment and domain information 
Probab=99.97  E-value=2.7e-32  Score=229.62  Aligned_cols=106  Identities=43%  Similarity=0.722  Sum_probs=100.7

Q ss_pred             CCCCCCCChHHHHHHHHHHHHHHhcCCCceEEEecC-CCccEEEEEeeccCCCCCCCCCCCCceeeccCCCCCCCCccee
Q psy5960           7 PKRVRHYDRGRLRDELRRALDVWSKHSKLTFREVND-DRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHF   85 (121)
Q Consensus         7 ~~~p~~l~~~~vr~~i~~AF~~Ws~vs~l~F~ev~~-~~aDI~I~F~~~~H~d~~~FDG~gg~lAHAf~P~~~~~gdiHf   85 (121)
                      .+++++|+..+||.++++||++|++|+||+|.|+.. +.|||+|+|..+.|||++||||++|+|||||+|+.+++|++||
T Consensus       116 ~n~~~~l~~~~vr~~~~~Af~~Ws~vtpl~f~e~~~~~~aDi~i~F~~~~h~d~~PFDG~~g~laHAf~Pg~~~~G~~hf  195 (469)
T KOG1565|consen  116 KNYTPYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGEADIRISFFPGDHGDGFPFDGPGGVLAHAFFPGPGIGGDLHF  195 (469)
T ss_pred             cccCCCCCHHHHHHHHHHHHhhcccCCCCccccCCCCCCCceeeeeeccCCCCCCcccCCCCceecccCCCCCCCCcccc
Confidence            577899999999999999999999999999999998 8999999999999999999999999999999999888899999


Q ss_pred             ccCCCeeecCccCCCCCCCccccceeeecccccc
Q psy5960          86 DIDEDWMVLGVSRSANADEGKSLELANADEGRRH  119 (121)
Q Consensus        86 D~dE~Wt~~~~~~~~~~~~G~sL~~VaaHEig~~  119 (121)
                      |+||.|+++       ...|+||+.||+||||.-
T Consensus       196 D~dE~Wt~~-------~~~g~~l~~Va~HEiGH~  222 (469)
T KOG1565|consen  196 DKDETWTYG-------DSNGVDLFLVAAHEIGHA  222 (469)
T ss_pred             Ccccceecc-------CCccchhHHHhhhhcccc
Confidence            999999997       267999999999999964

>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57 Back     alignment and domain information
>PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site Back     alignment and domain information
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
1hv5_A165 Crystal Structure Of The Stromelysin-3 (Mmp-11) Cat 3e-19
1fbl_A 370 Structure Of Full-Length Porcine Synovial Collagena 6e-18
1ck7_A 631 Gelatinase A (Full-Length) Length = 631 6e-18
1eak_A 421 Catalytic Domain Of Prommp-2 E404q Mutant Length = 1e-17
2y6d_A174 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 2e-17
2ddy_A173 Solution Structure Of Matrilysin (Mmp-7) Complexed 2e-17
1mmp_A170 Matrilysin Complexed With Carboxylate Inhibitor Len 2e-17
2y6c_A165 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 2e-17
1su3_A 450 X-Ray Structure Of Human Prommp-1: New Insights Int 2e-17
1mnc_A163 Structure Of Human Neutrophil Collagenase Reveals L 4e-17
3ayk_A169 Catalytic Fragment Of Human Fibroblast Collagenase 6e-17
2j0t_A170 Crystal Structure Of The Catalytic Domain Of Mmp-1 6e-17
966c_A157 Crystal Structure Of Fibroblast Collagenase-1 Compl 7e-17
3shi_A156 Crystal Structure Of Human Mmp1 Catalytic Domain At 7e-17
1cge_A168 Crystal Structures Of Recombinant 19-Kda Human Fibr 7e-17
1slm_A255 Crystal Structure Of Fibroblast Stromelysin-1: The 8e-17
1cgf_A162 Crystal Structures Of Recombinant 19-Kda Human Fibr 9e-17
1qia_A162 Crystal Structure Of Stromelysin Catalytic Domain L 1e-16
1hfs_A160 Crystal Structure Of The Catalytic Domain Of Human 1e-16
2jnp_A161 Solution Structure Of Matrix Metalloproteinase 3 (M 1e-16
1qic_A161 Crystal Structure Of Stromelysin Catalytic Domain L 1e-16
1ums_A174 Stromelysin-1 Catalytic Domain With Hydrophobic Inh 1e-16
1biw_A173 Design And Synthesis Of Conformationally-Constraine 1e-16
1usn_A165 Crystal Structure Of The Catalytic Domain Of Human 1e-16
1b8y_A167 X-Ray Structure Of Human Stromelysin Catalytic Doma 1e-16
4gr8_A152 Crystal Structure Of The Catalytic Domain Of Human 1e-16
1jaq_A163 Complex Of 1-Hydroxylamine-2-Isobutylmalonyl-Ala-Gl 1e-16
1c8t_A167 Human Stromelysin-1 (E202q) Catalytic Domain Comple 1e-16
2k9c_A152 Paramagnetic Shifts In Solid-State Nmr Of Proteins 1e-16
1caq_A168 X-Ray Structure Of Human Stromelysin Catalytic Doma 2e-16
1kbc_A164 Procarboxypeptidase Ternary Complex Length = 164 2e-16
2d1o_A171 Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Aci 2e-16
3oho_A169 Catalytic Domain Of Stromelysin-1 In Complex With N 2e-16
1a86_A158 Mmp8 With Malonic And Aspartic Acid Based Inhibitor 2e-16
2clt_A 367 Crystal Structure Of The Active Form (Full-Length) 2e-16
3tt4_A159 Human Mmp8 In Complex With L-Glutamate Motif Inhibi 2e-16
1bzs_A165 Crystal Structure Of Mmp8 Complexed With Hmr2909 Le 2e-16
1cgl_A169 Structure Of The Catalytic Domain Of Fibroblast Col 2e-16
1cxv_A164 Structure Of Recombinant Mouse Collagenase-3 (Mmp-1 2e-16
1os2_A165 Ternary Enzyme-Product-Inhibitor Complexes Of Human 2e-16
1rmz_A159 Crystal Structure Of The Catalytic Domain Of Human 2e-16
3f15_A158 Crystal Structure Of The Catalytic Domain Of Human 2e-16
1jk3_A158 Crystal Structure Of Human Mmp-12 (Macrophage Elast 2e-16
1l6j_A 425 Crystal Structure Of Human Matrix Metalloproteinase 2e-16
2poj_A164 Nmr Solution Structure Of The Inhibitor-Free State 2e-16
2k2g_A165 Solution Structure Of The Wild-Type Catalytic Domai 2e-16
2wo8_A164 Mmp12 Complex With A Beta Hydroxy Carboxylic Acid L 2e-16
2w0d_A164 Does A Fast Nuclear Magnetic Resonance Spectroscopy 2e-16
1utt_A159 Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Di 2e-16
2z2d_A164 Solution Structure Of Human Macrophage Elastase (Mm 2e-16
1ros_A163 Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dio 3e-16
1hov_A163 Solution Structure Of A Catalytic Domain Of Mmp-2 C 3e-16
1jiz_A166 Crystal Structure Analysis Of Human Macrophage Elas 3e-16
3ayu_A167 Crystal Structure Of Mmp-2 Active Site Mutant In Co 3e-16
1qib_A161 Crystal Structure Of Gelatinase A Catalytic Domain 3e-16
2jsd_A160 Solution Structure Of Mmp20 Complexed With Nngh Len 3e-16
1uea_A173 Mmp-3TIMP-1 Complex Length = 173 4e-16
3ba0_A 365 Crystal Structure Of Full-Length Human Mmp-12 Lengt 5e-16
2d1n_A166 Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Ac 7e-16
1fls_A165 Solution Structure Of The Catalytic Fragment Of Hum 7e-16
3kry_A164 Crystal Structure Of Mmp-13 In Complex With Sc-7808 7e-16
3ljz_A164 Crystal Structure Of Human Mmp-13 Complexed With An 8e-16
2ow9_A170 Crystal Structure Analysis Of The Mmp13 Catalytic D 8e-16
3kec_A167 Crystal Structure Of Human Mmp-13 Complexed With A 8e-16
456c_A168 Crystal Structure Of Collagenase-3 (Mmp-13) Complex 8e-16
1eub_A171 Solution Structure Of The Catalytic Domain Of Human 9e-16
4a7b_A169 Mmp13 In Complex With A Novel Selective Non Zinc Bi 1e-15
1gkc_A163 Mmp9-inhibitor Complex Length = 163 1e-15
1gkd_A163 Mmp9 Active Site Mutant-Inhibitor Complex Length = 2e-15
2ovx_A159 Mmp-9 Active Site Mutant With Barbiturate Inhibitor 3e-15
1rm8_A169 Crystal Structure Of The Catalytic Domain Of Mmp-16 3e-15
2xs4_A167 Structure Of Karilysin Catalytic Mmp Domain In Comp 6e-15
2xs3_A166 Structure Of Karilysin Catalytic Mmp Domain Length 7e-15
1q3a_A165 Crystal Structure Of The Catalytic Domain Of Human 1e-14
3ma2_D181 Complex Membrane Type-1 Matrix Metalloproteinase (M 2e-14
1bqq_M174 Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Le 2e-14
3v96_B165 Complex Of Matrix Metalloproteinase-10 Catalytic Do 2e-14
>pdb|1HV5|A Chain A, Crystal Structure Of The Stromelysin-3 (Mmp-11) Catalytic Domain Complexed With A Phosphinic Inhibitor Length = 165 Back     alignment and structure 
Iteration: 1

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 54/79 (68%)
Query: 15  RGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFF 74
           R ++R  +  AL VWS+ + LTF EV++ RADI+I F +  H D  PFDGPG ILAHAFF
Sbjct: 27  REQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDFARYWHGDNLPFDGPGGILAHAFF 86
Query: 75  PGSGRGGDAHFDIDEDWMV 93
           P + R GD HFD DE W +
Sbjct: 87  PKTHREGDVHFDYDETWTI 105
>pdb|1FBL|A Chain A, Structure Of Full-Length Porcine Synovial Collagenase (Mmp1) Reveals A C-Terminal Domain Containing A Calcium-Linked, Four-Bladed Beta- Propeller Length = 370 Back     alignment and structure
>pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 Back     alignment and structure
>pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 Back     alignment and structure
>pdb|2Y6D|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 174 Back     alignment and structure
>pdb|2DDY|A Chain A, Solution Structure Of Matrilysin (Mmp-7) Complexed To Constraint Conformational Sulfonamide Inhibitor Length = 173 Back     alignment and structure
>pdb|1MMP|A Chain A, Matrilysin Complexed With Carboxylate Inhibitor Length = 170 Back     alignment and structure
>pdb|2Y6C|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 165 Back     alignment and structure
>pdb|1SU3|A Chain A, X-Ray Structure Of Human Prommp-1: New Insights Into Collagenase Action Length = 450 Back     alignment and structure
>pdb|1MNC|A Chain A, Structure Of Human Neutrophil Collagenase Reveals Large S1' Specificity Pocket Length = 163 Back     alignment and structure
>pdb|3AYK|A Chain A, Catalytic Fragment Of Human Fibroblast Collagenase Complexed With Cgs-27023a, Nmr, Minimized Average Structure Length = 169 Back     alignment and structure
>pdb|2J0T|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-1 In Complex With The Inhibitory Domain Of Timp-1 Length = 170 Back     alignment and structure
>pdb|966C|A Chain A, Crystal Structure Of Fibroblast Collagenase-1 Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 157 Back     alignment and structure
>pdb|3SHI|A Chain A, Crystal Structure Of Human Mmp1 Catalytic Domain At 2.2 A Resolution Length = 156 Back     alignment and structure
>pdb|1CGE|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 168 Back     alignment and structure
>pdb|1SLM|A Chain A, Crystal Structure Of Fibroblast Stromelysin-1: The C-Truncated Human Proenzyme Length = 255 Back     alignment and structure
>pdb|1CGF|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 162 Back     alignment and structure
>pdb|1QIA|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 162 Back     alignment and structure
>pdb|1HFS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With The N-Carboxy-Alkyl Inhibitor L-764,004 Length = 160 Back     alignment and structure
>pdb|2JNP|A Chain A, Solution Structure Of Matrix Metalloproteinase 3 (Mmp-3) In The Presence Of N-Isobutyl-N-[4- Methoxyphenylsulfonyl]glycyl Hydroxamic Acid (Nngh) Length = 161 Back     alignment and structure
>pdb|1QIC|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 161 Back     alignment and structure
>pdb|1UMS|A Chain A, Stromelysin-1 Catalytic Domain With Hydrophobic Inhibitor Bound, Ph 7.0, 32oc, 20 Mm Cacl2, 15% Acetonitrile; Nmr Ensemble Of 20 Structures Length = 174 Back     alignment and structure
>pdb|1BIW|A Chain A, Design And Synthesis Of Conformationally-Constrained Mmp Inhibitors Length = 173 Back     alignment and structure
>pdb|1USN|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With Thiadiazole Inhibitor Pnu-142372 Length = 165 Back     alignment and structure
>pdb|1B8Y|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexed With Non-Peptide Inhibitors: Implications For Inhibitor Selectivity Length = 167 Back     alignment and structure
>pdb|4GR8|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 In Complex With Selective Phosphinic Inhibitor Rxp470c Length = 152 Back     alignment and structure
>pdb|1JAQ|A Chain A, Complex Of 1-Hydroxylamine-2-Isobutylmalonyl-Ala-Gly-Nh2 With The Catalytic Domain Of Matrix Metallo Proteinase-8 (Met80 Form) Length = 163 Back     alignment and structure
>pdb|1C8T|A Chain A, Human Stromelysin-1 (E202q) Catalytic Domain Complexed With Ro-26-2812 Length = 167 Back     alignment and structure
>pdb|2K9C|A Chain A, Paramagnetic Shifts In Solid-State Nmr Of Proteins To Elicit Structural Information Length = 152 Back     alignment and structure
>pdb|1CAQ|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexes With Non-Peptide Inhibitors: Implication For Inhibitor Selectivity Length = 168 Back     alignment and structure
>pdb|1KBC|A Chain A, Procarboxypeptidase Ternary Complex Length = 164 Back     alignment and structure
>pdb|2D1O|A Chain A, Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Acid Inhibitor Length = 171 Back     alignment and structure
>pdb|3OHO|A Chain A, Catalytic Domain Of Stromelysin-1 In Complex With N-Hydroxy-2-(4- Methylphenylsulfonamido)acetamide Length = 169 Back     alignment and structure
>pdb|1A86|A Chain A, Mmp8 With Malonic And Aspartic Acid Based Inhibitor Length = 158 Back     alignment and structure
>pdb|2CLT|A Chain A, Crystal Structure Of The Active Form (Full-Length) Of Human Fibroblast Collagenase. Length = 367 Back     alignment and structure
>pdb|3TT4|A Chain A, Human Mmp8 In Complex With L-Glutamate Motif Inhibitor Length = 159 Back     alignment and structure
>pdb|1BZS|A Chain A, Crystal Structure Of Mmp8 Complexed With Hmr2909 Length = 165 Back     alignment and structure
>pdb|1CGL|A Chain A, Structure Of The Catalytic Domain Of Fibroblast Collagenase Complexed With An Inhibitor Length = 169 Back     alignment and structure
>pdb|1CXV|A Chain A, Structure Of Recombinant Mouse Collagenase-3 (Mmp-13) Length = 164 Back     alignment and structure
>pdb|1OS2|A Chain A, Ternary Enzyme-Product-Inhibitor Complexes Of Human Mmp12 Length = 165 Back     alignment and structure
>pdb|1RMZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor Nngh At 1.3 A Resolution Length = 159 Back     alignment and structure
>pdb|3F15|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor (S)-N-(2,3-Dihydroxypropyl)-4- Methoxy-N-(2-Nitroso-2-Oxoethyl)benzenesulfonamide Length = 158 Back     alignment and structure
>pdb|1JK3|A Chain A, Crystal Structure Of Human Mmp-12 (Macrophage Elastase) At True Atomic Resolution Length = 158 Back     alignment and structure
>pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 Back     alignment and structure
>pdb|2POJ|A Chain A, Nmr Solution Structure Of The Inhibitor-Free State Of Macrophage Metalloelastase (Mmp-12) Length = 164 Back     alignment and structure
>pdb|2K2G|A Chain A, Solution Structure Of The Wild-Type Catalytic Domain Of Human Matrix Metalloproteinase 12 (Mmp-12) In Complex With A Tight-Binding Inhibitor Length = 165 Back     alignment and structure
>pdb|2WO8|A Chain A, Mmp12 Complex With A Beta Hydroxy Carboxylic Acid Length = 164 Back     alignment and structure
>pdb|2W0D|A Chain A, Does A Fast Nuclear Magnetic Resonance Spectroscopy- And X-Ray Crystallography Hybrid Approach Provide Reliable Structural Information Of Ligand-Protein Complexes? A Case Study Of Metalloproteinases. Length = 164 Back     alignment and structure
>pdb|1UTT|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Dioxo-1,3-Dihydro-2h-Isoindol-2-Yl)ethyl-4- (4-Ethoxy[1,1-Biphenyl]-4-Yl)-4-Oxobutanoic Acid Length = 159 Back     alignment and structure
>pdb|2Z2D|A Chain A, Solution Structure Of Human Macrophage Elastase (Mmp-12) Catalytic Domain Complexed With A Gamma-Keto Butanoic Acid Inhibitor Length = 164 Back     alignment and structure
>pdb|1ROS|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dioxo-1,3- Dihydro-2h-Isoindol-2-Yl)ethyl-4-(4-Ethoxy[1, 1-Biphenyl]-4- Yl)-4-Oxobutanoic Acid Length = 163 Back     alignment and structure
>pdb|1HOV|A Chain A, Solution Structure Of A Catalytic Domain Of Mmp-2 Complexed With Sc-74020 Length = 163 Back     alignment and structure
>pdb|1JIZ|A Chain A, Crystal Structure Analysis Of Human Macrophage Elastase Mmp- 12 Length = 166 Back     alignment and structure
>pdb|3AYU|A Chain A, Crystal Structure Of Mmp-2 Active Site Mutant In Complex With App- Drived Decapeptide Inhibitor Length = 167 Back     alignment and structure
>pdb|1QIB|A Chain A, Crystal Structure Of Gelatinase A Catalytic Domain Length = 161 Back     alignment and structure
>pdb|2JSD|A Chain A, Solution Structure Of Mmp20 Complexed With Nngh Length = 160 Back     alignment and structure
>pdb|1UEA|A Chain A, Mmp-3TIMP-1 Complex Length = 173 Back     alignment and structure
>pdb|3BA0|A Chain A, Crystal Structure Of Full-Length Human Mmp-12 Length = 365 Back     alignment and structure
>pdb|2D1N|A Chain A, Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Acid Inhibitor Length = 166 Back     alignment and structure
>pdb|1FLS|A Chain A, Solution Structure Of The Catalytic Fragment Of Human Collagenase-3 (Mmp-13) Complexed With A Hydroxamic Acid Inhibitor Length = 165 Back     alignment and structure
>pdb|3KRY|A Chain A, Crystal Structure Of Mmp-13 In Complex With Sc-78080 Length = 164 Back     alignment and structure
>pdb|3LJZ|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With An Amino-2-Indanol Compound Length = 164 Back     alignment and structure
>pdb|2OW9|A Chain A, Crystal Structure Analysis Of The Mmp13 Catalytic Domain In Complex With Specific Inhibitor Length = 170 Back     alignment and structure
>pdb|3KEC|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With A Phenyl-2h-Tetrazole Compound Length = 167 Back     alignment and structure
>pdb|456C|A Chain A, Crystal Structure Of Collagenase-3 (Mmp-13) Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 168 Back     alignment and structure
>pdb|1EUB|A Chain A, Solution Structure Of The Catalytic Domain Of Human Collagenase-3 (Mmp-13) Complexed To A Potent Non-Peptidic Sulfonamide Inhibitor Length = 171 Back     alignment and structure
>pdb|4A7B|A Chain A, Mmp13 In Complex With A Novel Selective Non Zinc Binding Inhibitor Cmpd22 Length = 169 Back     alignment and structure
>pdb|1GKC|A Chain A, Mmp9-inhibitor Complex Length = 163 Back     alignment and structure
>pdb|1GKD|A Chain A, Mmp9 Active Site Mutant-Inhibitor Complex Length = 163 Back     alignment and structure
>pdb|2OVX|A Chain A, Mmp-9 Active Site Mutant With Barbiturate Inhibitor Length = 159 Back     alignment and structure
>pdb|1RM8|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-16MT3- Mmp: Characterization Of Mt-Mmp Specific Features Length = 169 Back     alignment and structure
>pdb|2XS4|A Chain A, Structure Of Karilysin Catalytic Mmp Domain In Complex With Magnesium Length = 167 Back     alignment and structure
>pdb|2XS3|A Chain A, Structure Of Karilysin Catalytic Mmp Domain Length = 166 Back     alignment and structure
>pdb|1Q3A|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Matrix Metalloproteinase 10 Length = 165 Back     alignment and structure
>pdb|3MA2|D Chain D, Complex Membrane Type-1 Matrix Metalloproteinase (Mt1-Mmp) With Tissue Inhibitor Of Metalloproteinase-1 (Timp-1) Length = 181 Back     alignment and structure
>pdb|1BQQ|M Chain M, Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Length = 174 Back     alignment and structure
>pdb|3V96|B Chain B, Complex Of Matrix Metalloproteinase-10 Catalytic Domain (Mmp-10cd) With Tissue Inhibitor Of Metalloproteinases-1 (Timp-1) Length = 165 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 3e-24
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 5e-23
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 2e-21
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 1e-20
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 2e-20
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 3e-20
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 1e-19
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 3e-19
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 4e-19
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 1e-18
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 5e-18
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 2e-09
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 7e-18
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 8e-18
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 1e-17
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 1e-17
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 1e-16
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 8e-16
1eak_A421 72 kDa type IV collagenase; hydrolase-hydrolase in 1e-08
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 1e-15
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 2e-15
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet fla 8e-08
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 4e-05
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 2e-04
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 Back     alignment and structure
 Score = 94.9 bits (235), Expect = 3e-24
 Identities = 39/78 (50%), Positives = 51/78 (65%)

Query: 14  DRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAF 73
            R  +   + +A  +WS  + LTF +V++ +ADI+I F + +H D  PFDGPG  LAHAF
Sbjct: 107 PRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAF 166

Query: 74  FPGSGRGGDAHFDIDEDW 91
            PG G GGDAHFD DE W
Sbjct: 167 QPGPGIGGDAHFDEDERW 184
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Length = 365 Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Length = 168 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Length = 159 Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Length = 163 Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Length = 167 Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Length = 165 Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Length = 173 Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Length = 168 Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Length = 255 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Length = 159 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Length = 167 Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Length = 174 Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Length = 169 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} PDB: 1bqq_M 1buv_M Length = 181 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Length = 463 Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Length = 479 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 100.0
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 100.0
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 100.0
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 100.0
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 100.0
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 99.97
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 99.97
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 99.97
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 99.97
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 99.97
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 99.97
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 99.97
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 99.97
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 99.96
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 99.96
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 99.96
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 99.95
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 99.95
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 99.94
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 99.79
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 99.75
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 99.74
1sat_A 471 Serratia protease; parallel beta helix, parallel b 99.68
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, m 99.66
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 97.46
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet fla 97.19
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, 96.7
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 94.27
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M Back     alignment and structure
Probab=100.00  E-value=2e-38  Score=237.16  Aligned_cols=108  Identities=37%  Similarity=0.636  Sum_probs=99.8

Q ss_pred             CCCCCCCChHHHHHHHHHHHHHHhcCCCceEEEecC--------CCccEEEEEeeccCCCCCCCCCCCCceeeccCCCCC
Q psy5960           7 PKRVRHYDRGRLRDELRRALDVWSKHSKLTFREVND--------DRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSG   78 (121)
Q Consensus         7 ~~~p~~l~~~~vr~~i~~AF~~Ws~vs~l~F~ev~~--------~~aDI~I~F~~~~H~d~~~FDG~gg~lAHAf~P~~~   78 (121)
                      .+||++|+..+++++|++||++|++|++|+|+||..        ..|||+|.|++++|||++||||+||+|||||+|+.+
T Consensus        18 ~n~t~~l~~~~v~~ai~~Af~~Ws~vt~L~F~ev~~~~~~~~~~~~ADI~I~F~~~~hgd~~~FDG~gg~lAhAf~P~~~   97 (181)
T 3ma2_D           18 QNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPN   97 (181)
T ss_dssp             CCCCTTTCHHHHHHHHHHHHHHHHHHSSCEEEECCHHHHHTTSSCCCSEEEEEECSCCSSSSCCCSSSSEEEEECCSCST
T ss_pred             ccCCCCCCHHHHHHHHHHHHHHHHhcCCcceEEcccccccccccccCcEEEEeecccCCCCCcccCCCCeeeeccCCCCC
Confidence            688999999999999999999999999999999964        489999999999999999999999999999999998


Q ss_pred             CCCcceeccCCCeeecCccCCCCCCCccccceeeecccccc
Q psy5960          79 RGGDAHFDIDEDWMVLGVSRSANADEGKSLELANADEGRRH  119 (121)
Q Consensus        79 ~~gdiHfD~dE~Wt~~~~~~~~~~~~G~sL~~VaaHEig~~  119 (121)
                      ++|++|||++|.|+++..     ...|.+|+.||+||||..
T Consensus        98 ~~Gd~hfd~~e~wt~~~~-----~~~g~~l~~v~~hE~Gh~  133 (181)
T 3ma2_D           98 IGGDTHFDSAEPWTVRNE-----DLNGNDIFLVAVHELGHA  133 (181)
T ss_dssp             TTTCEEEETTSCEECTTS-----CTTSEEHHHHHHHHHHHH
T ss_pred             CCCceEecCccccccCCC-----ccccceeeeeehhhcccc
Confidence            899999999999998742     237999999999999953
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d1i76a_163 d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Hum 3e-20
d1hfca_157 d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Hum 7e-19
d1mmqa_166 d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sap 1e-18
d1hv5a_162 d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus 5e-18
d1xuca1169 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Huma 9e-18
d1hy7a_168 d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo 2e-16
d1y93a1158 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) 5e-16
d2ovxa1159 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human 1e-15
d1rm8a_169 d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16 9e-15
d1qiba_161 d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) 2e-14
d1bqqm_174 d.92.1.11 (M:) Membrane-type matrix metalloprotein 1e-12
d1sata2243 d.92.1.6 (A:4-246) Metalloprotease {Serratia marce 3e-11
d1g9ka2242 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp 7e-11
d1k7ia2241 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrys 4e-10
d1kapp2246 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas ae 2e-08
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Neutrophil collagenase (MMP-8)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 78.3 bits (192), Expect = 3e-20
 Identities = 36/81 (44%), Positives = 46/81 (56%)

Query: 12  HYDRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAH 71
                 +   ++ A ++WS  S L F  ++   ADI I F + +H D  PFDGP  ILAH
Sbjct: 24  QLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAH 83

Query: 72  AFFPGSGRGGDAHFDIDEDWM 92
           AF PG G GGDAHFD +E W 
Sbjct: 84  AFQPGQGIGGDAHFDAEETWT 104
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Length = 243 Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Length = 242 Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Length = 241 Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1hv5a_162 Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI 99.87
d1mmqa_166 Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 99.8
d1i76a_163 Neutrophil collagenase (MMP-8) {Human (Homo sapien 99.77
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.74
d1hy7a_168 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.72
d1xuca1169 Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI 99.72
d2ovxa1159 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.66
d1y93a1158 Macrophage elastase (MMP-12) {Human (Homo sapiens) 99.65
d1qiba_161 Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1k7ia2241 Metalloprotease {Erwinia chrysanthemi [TaxId: 556] 99.61
d1sata2243 Metalloprotease {Serratia marcescens [TaxId: 615]} 99.6
d1kapp2246 Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 99.56
d1rm8a_169 Matrix metalloproteinase-16 (MMP-16) {Human (Homo 99.53
d1bqqm_174 Membrane-type matrix metalloproteinase (CDMT1-MMP) 99.46
d1g9ka2242 Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId 99.43
d1asta_200 Astacin {European fresh water crayfish (Astacus as 93.43
d1c7ka_132 Zinc protease {Streptomyces caespitosus [TaxId: 53 93.33
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Stromelysin-3 (MMP-11)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.87  E-value=7.1e-23  Score=146.21  Aligned_cols=105  Identities=45%  Similarity=0.733  Sum_probs=98.2

Q ss_pred             CCCCCCCChHHHHHHHHHHHHHHhcCCCceEEEecCCCccEEEEEeeccCCCCCCCCCCCCceeeccCCCCCCCCcceec
Q psy5960           7 PKRVRHYDRGRLRDELRRALDVWSKHSKLTFREVNDDRADILIYFEKENHWDGYPFDGPGKILAHAFFPGSGRGGDAHFD   86 (121)
Q Consensus         7 ~~~p~~l~~~~vr~~i~~AF~~Ws~vs~l~F~ev~~~~aDI~I~F~~~~H~d~~~FDG~gg~lAHAf~P~~~~~gdiHfD   86 (121)
                      .++|++++.+++++++++||+.|+++++|+|+||..+++||+|.|....+.+++++++.++++|++++|.....++|.|+
T Consensus        19 ~~~~~~~~~~~~~~~i~~A~~~W~~v~~i~F~ev~~~~~di~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~   98 (162)
T d1hv5a_          19 LRFPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDFARYWHGDNLPFDGPGGILAHAFFPKTHREGDVHFD   98 (162)
T ss_dssp             CSCCTTSCHHHHHHHHHHHHHHHHTTSSCEEEECSSSBCSEEEEEECSCSSSSCCCCSSSSCCEEEECCTTSSSEEEEEE
T ss_pred             EecCCCCCHHHHHHHHHHHHHHHhccCCceEEEeecCCCceEEEEeccccCCcccccCCCceeeeeecCCCccccceeec
Confidence            57899999999999999999999999999999999889999999999999999999999999999999998888899999


Q ss_pred             cCCCeeecCccCCCCCCCccccceeeeccccc
Q psy5960          87 IDEDWMVLGVSRSANADEGKSLELANADEGRR  118 (121)
Q Consensus        87 ~dE~Wt~~~~~~~~~~~~G~sL~~VaaHEig~  118 (121)
                      .++.|+...       ..|.+|+.|++||||.
T Consensus        99 ~~~~~~~~~-------~~g~~~~~v~~HEiGH  123 (162)
T d1hv5a_          99 YDETWTIGD-------NQGTDLLQVAAHEFGH  123 (162)
T ss_dssp             TTSCEESSC-------SSSEEHHHHHHHHHHH
T ss_pred             chhcccccc-------ccCcchhhhhhhhhhh
Confidence            999998763       5788999999999995
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Back     information, alignment and structure
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Back     information, alignment and structure
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]} Back     information, alignment and structure