Psyllid ID: psy6091

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MQPMALFPYPPPQSNEPYKTLKALINIRKESLRFVKVNDESQRQVYNIEFIFDCDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYNIDKEIIPIAIQCVTTSDDGQEDQKQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQEIYGIENKNNEQYKGCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQIRALQKNSSHVSETSSDNIPPGYDAVSLIEALNGPCAVRHPPLVVSLDPLAECATTAALNRRASAERSGKGSKVSAPSVTSQTQEGEEKSVSDANVPETPDDDSEAEKLSPLLDAATSTQLDRSNSVTDTDTEYYKPTSAGAEYYGTKPSSATAEYYGTKPTSATAEYYGTKPPKIRKTSKSR
cccccccccccccccccccEEEcccEEccccEEEEEccccccccEEEEEEEEEccccEEEEEEEEEEEEccccEEEEcccccccccccEEEEcccccccEEccccEEEcccccccccccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEccccccEEEcccEEEEccccEEEEHHHHccccccccccccccccccccccEEEEccccccEEEEccccccccHHHHHHHHcccccccccccccccEEEEEEcccccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccEEEEccEEEccccEEEEEccccccccEEEEEEEEEccccEEEEEEEEEEEEcccccEEEEcccccccccccEEEccccccEEEEccccEEcHcHccHHHcccccccccEEEEEEEEEccccccccccccEEEEEEEEEcccccEEEEEEEEEEEEccEEEEEEEEEEEEccccccccccccccccccEEEEEEcccccEEEEccccHEccHHHHHHHHHHHccccccccHHHHHHHHEHHccccccccccccccccccccEEHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccHcccccccccHHHHccccccccccccccccccccEcEccccc
mqpmalfpypppqsnepykTLKALINIRKESLRFvkvndesqrqvYNIEFifdcdvpcsitvhFFVTedimgntisyipkksnpcpvvktfhykkgasqlfcqpgvtfipsqyeddelmynIDKEIIPIaiqcvttsddgqedqkqchttiavvdhhaddsytlkglkqkLYVDGLCYLLQEIYgienknneqykgcedcedggsecvicmcdirdtlilpcrhlclchscadslryqanncpicraPFRALLQIRALQKnsshvsetssdnippgydAVSLIEAlngpcavrhpplvvsldplaecATTAALNRRAsaersgkgskvsapsvtsqtqegeeksvsdanvpetpdddseaeklsplldaatstqldrsnsvtdtdteyykptsagaeyygtkpssataeyygtkptsataeyygtkppkirktsksr
mqpmalfpypppqsnePYKTLKALINIRKESLRFVKVNDESQRQVYNIEFIFDCDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYNIDKEIIPIAIQCVTTSDDGQEDQKQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQEIYGIENKNNEQYKGCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQIRALQKNSShvsetssdnippGYDAVSLIEALNGPCAVRHPPLVVSLDPLAECATTAALNRRasaersgkgskvsapsvtsqtqegeeksvsdanvpetpdddseaEKLSPLldaatstqldrsnsvtdtdteyykptsagaeyygtkpssaTAEYYGTkptsataeyygtkppkirktsksr
MQPMALFPYPPPQSNEPYKTLKALINIRKESLRFVKVNDESQRQVYNIEFIFDCDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYNIDKEIIPIAIQCVTTSDDGQEDQKQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQEIYGIENKNNEQYKGCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQIRALQKNSSHVSETSSDNIPPGYDAVSLIEALNGPCAVRHPPLVVSLDPLAECATTAALNRRASAERSGKGSKVSAPSVTSQTQEGEEKSVSDANVPETPDDDSEAEKLSPLLDAATSTQLDRSNSVTDTDTEYYKPTSAGAEYYGTKPSSATAEYYGTKPTSATAEYYGTKPPKIRKTSKSR
*******************TLKALINIRKESLRFVKVNDESQRQVYNIEFIFDCDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYNIDKEIIPIAIQCVTTSD******KQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQEIYGIENKNNEQYKGCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQIRAL*****************GYDAVSLIEALNGPCAVRHPPLVVSLDPLAECATTA******************************************************************************************************************************
*****LFPYPPPQSNEPYKTLKALINIRKESLRFVKVNDESQRQVYNIEFIFDCDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYNIDKEIIPIAIQCVTTSDDGQEDQKQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQEIY*****************DGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQI***********************AVSLIEALN******************************************************************************************************************************************************
MQPMALFPYPPPQSNEPYKTLKALINIRKESLRFVKVNDESQRQVYNIEFIFDCDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYNIDKEIIPIAIQCVT***********CHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQEIYGIENKNNEQYKGCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQIRAL**************IPPGYDAVSLIEALNGPCAVRHPPLVVSLDPLAECATTAAL************************************************KLSPLLDAATSTQLDRSNSVTDTDTEYYKPTSAGAEYYGTKPSSATAEYYGTKPTSATAEYYGTK***********
***MALFPYPPPQSNEPYKTLKALINIRKESLRFVKVNDESQRQVYNIEFIFDCDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYNIDKEIIPIAIQCVTTSDDGQEDQKQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQEIYGIENKN************GGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQIRALQKN********SDNIPPGYDAVSLIEALNGPCAVRHPPLVVSLDPLAECATTAAL****************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQPMALFPYPPPQSNEPYKTLKALINIRKESLRFVKVNDESQRQVYNIEFIFDCDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYNIDKEIIPIAIQCVTTSDDGQEDQKQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQEIYGIENKNNEQYKGCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQIRALQKNSSHVSETSSDNIPPGYDAVSLIEALNGPCAVRHPPLVVSLDPLAECATTAALNRRASAERSGKGSKVSAPSVTSQTQEGEEKSVSDANVPETPDDDSEAEKLSPLLDAATSTQLDRSNSVTDTDTEYYKPTSAGAEYYGTKPSSATAEYYGTKPTSATAEYYGTKPPKIRKTSKSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
Q6INH1 674 RING finger protein 157 O N/A N/A 0.638 0.413 0.487 2e-79
Q96PX1 679 RING finger protein 157 O yes N/A 0.640 0.412 0.487 3e-78
Q3TEL6 685 RING finger protein 157 O yes N/A 0.677 0.432 0.465 6e-78
Q7ZUL9529 Probable E3 ubiquitin-pro no N/A 0.636 0.525 0.459 5e-76
Q9D074532 E3 ubiquitin-protein liga no N/A 0.649 0.533 0.474 1e-74
Q5XIQ4533 E3 ubiquitin-protein liga no N/A 0.855 0.701 0.414 2e-74
O60291552 E3 ubiquitin-protein liga no N/A 0.800 0.634 0.404 1e-73
Q84ME1378 Probable E3 ubiquitin-pro yes N/A 0.585 0.677 0.334 1e-34
Q9LFH6299 Probable E3 ubiquitin-pro no N/A 0.510 0.745 0.362 1e-32
Q9LYW5337 Probable E3 ubiquitin-pro no N/A 0.528 0.685 0.342 2e-32
>sp|Q6INH1|RN157_XENLA RING finger protein 157 OS=Xenopus laevis GN=rnf157 PE=2 SV=1 Back     alignment and function desciption
 Score =  296 bits (758), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 204/310 (65%), Gaps = 31/310 (10%)

Query: 7   FPYPPPQSNEPYKTLKALINIRKESLRFVKVNDE--------SQRQV-YNIEFIFDCDVP 57
           FPY  P   EP KTL++LINIRK++LR V+  +E        S+ +V YN+EF FD D  
Sbjct: 70  FPYTAPSPQEPVKTLRSLINIRKDTLRLVRCTEELKTTGVEGSRPKVHYNVEFTFDTDAR 129

Query: 58  CSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDE 117
            +IT+++  TE+  G   SY+PK SN      T H+K+G SQ FC P  T  PS++ ++E
Sbjct: 130 VAITMYYQATEEFQGGIPSYLPKSSNL--QSDTVHFKRGVSQQFCFPSHTVDPSEWREEE 187

Query: 118 LMYNIDKEIIPIAIQCVTTSDDGQEDQKQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLC 177
           L +++D+E+ P+ +  V   ++G+E     H  +A  + HAD S+ +K LKQK  VDG+ 
Sbjct: 188 LTFDLDREVYPMVVHAVV--EEGEEHLGHSHVLMATFEKHADGSFCVKPLKQKQVVDGVS 245

Query: 178 YLLQEIYGIENKNNEQ-YKGCED-CEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSL 235
           YLLQEIYGIENK N Q  K  ED   D  +ECV+C+ D+RDTLILPCRHLCLC++CAD+L
Sbjct: 246 YLLQEIYGIENKYNSQDSKVAEDELSDNSAECVVCLSDVRDTLILPCRHLCLCNACADTL 305

Query: 236 RYQANNCPICRAPFRALLQIRALQK----------------NSSHVSETSSDNIPPGYDA 279
           RYQA+NCPICR PFRALLQIRA++K                 +S   E +S+++PPGY+ 
Sbjct: 306 RYQASNCPICRLPFRALLQIRAMRKVPGPHSPGGFSPIIAAPTSDSEEHTSEHVPPGYEV 365

Query: 280 VSLIEALNGP 289
           VSL+EALNGP
Sbjct: 366 VSLLEALNGP 375

Xenopus laevis (taxid: 8355)
>sp|Q96PX1|RN157_HUMAN RING finger protein 157 OS=Homo sapiens GN=RNF157 PE=1 SV=3 Back     alignment and function description
>sp|Q3TEL6|RN157_MOUSE RING finger protein 157 OS=Mus musculus GN=Rnf157 PE=2 SV=2 Back     alignment and function description
>sp|Q7ZUL9|MGRN1_DANRE Probable E3 ubiquitin-protein ligase MGRN1 OS=Danio rerio GN=mgrn1 PE=2 SV=1 Back     alignment and function description
>sp|Q9D074|MGRN1_MOUSE E3 ubiquitin-protein ligase MGRN1 OS=Mus musculus GN=Mgrn1 PE=1 SV=2 Back     alignment and function description
>sp|Q5XIQ4|MGRN1_RAT E3 ubiquitin-protein ligase MGRN1 OS=Rattus norvegicus GN=Mgrn1 PE=2 SV=1 Back     alignment and function description
>sp|O60291|MGRN1_HUMAN E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens GN=MGRN1 PE=1 SV=2 Back     alignment and function description
>sp|Q84ME1|LUL3_ARATH Probable E3 ubiquitin-protein ligase LUL3 OS=Arabidopsis thaliana GN=LUL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LFH6|LUL2_ARATH Probable E3 ubiquitin-protein ligase LUL2 OS=Arabidopsis thaliana GN=LUL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYW5|LUL1_ARATH Probable E3 ubiquitin-protein ligase LUL1 OS=Arabidopsis thaliana GN=LUL1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
91090103 614 PREDICTED: similar to mahogunin [Triboli 0.837 0.596 0.485 1e-104
322802324486 hypothetical protein SINV_12589 [Solenop 0.727 0.654 0.553 1e-102
332031505 554 RING finger protein 157 [Acromyrmex echi 0.814 0.642 0.481 1e-100
307178193 554 RING finger protein 157 [Camponotus flor 0.819 0.646 0.485 2e-99
380011558 556 PREDICTED: RING finger protein 157-like 0.732 0.575 0.538 2e-98
242017851 626 mahogunin, putative [Pediculus humanus c 0.803 0.560 0.485 4e-98
307201771 556 RING finger protein 157 [Harpegnathos sa 0.830 0.652 0.462 9e-98
156544223 554 PREDICTED: RING finger protein 157-like 0.695 0.548 0.556 2e-97
350409290 556 PREDICTED: RING finger protein 157-like 0.713 0.561 0.551 1e-96
328793131 557 PREDICTED: RING finger protein 157-like 0.732 0.574 0.534 1e-96
>gi|91090103|ref|XP_970810.1| PREDICTED: similar to mahogunin [Tribolium castaneum] gi|270013734|gb|EFA10182.1| hypothetical protein TcasGA2_TC012374 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 212/437 (48%), Positives = 279/437 (63%), Gaps = 71/437 (16%)

Query: 19  KTLKALINIRKESLRFVKV----------NDESQRQV-------YNIEFIFDCDVPCSIT 61
           KTLK+L+NIRKESLRFV+           N+   R +       +NIEF FDCDV C+IT
Sbjct: 82  KTLKSLVNIRKESLRFVRAPADYSKPAEKNERDIRDIELGKSSTFNIEFTFDCDVRCAIT 141

Query: 62  VHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYN 121
           +++F TE+   + ++Y+P+  +P    +TFHYK+GA+Q FCQ    F PS+Y ++EL+Y+
Sbjct: 142 IYYFCTEEFTPSGVTYLPR--DPNTTSETFHYKRGANQQFCQMTHVFDPSKYTEEELLYD 199

Query: 122 IDKEIIPIAIQCVTTSDDGQEDQKQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQ 181
           +D+EIIPIAI CV  +++G E+ +Q HTTIA  +  +D +Y LK LKQKL+VDGLCYLLQ
Sbjct: 200 VDREIIPIAIHCV--AEEGAEEMRQSHTTIATAEKLSDGTYVLKALKQKLFVDGLCYLLQ 257

Query: 182 EIYGIENKNNEQYKGCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANN 241
           EIYGIENKNN++  G ++ ED GSECVICMCD+RDTLILPCRHLCLC+SCADSLRYQANN
Sbjct: 258 EIYGIENKNNDKQSGDDETEDNGSECVICMCDVRDTLILPCRHLCLCNSCADSLRYQANN 317

Query: 242 CPICRAPFRALLQIRALQK----NSSHVS--ETSSDNIPPGYDAVSLIEALNGPCAVRHP 295
           CPICRAPFRALLQIRALQK    N + ++  + S DNIPPGY+AVSLIEALNGPC  R P
Sbjct: 318 CPICRAPFRALLQIRALQKCANPNLAQINPPDGSCDNIPPGYEAVSLIEALNGPCIPRQP 377

Query: 296 PLVVS---LDPLAECATTAALNRRASAERS---GKGS----------------------- 326
           P  +      P +E A  AA     SA+R+    KGS                       
Sbjct: 378 PSAMPDLVETPESEHAIQAAQILNRSADRTPLKSKGSDPTTPEYGVLMTTRVEEDTKETP 437

Query: 327 -------KVSAPSVTSQTQEGEEKSVSDANVPETPDDDSEAEKLSPLLDAATSTQ----- 374
                  K+S+P +  +  +  +     +   E  D+DS+AEKLSPLL  + + +     
Sbjct: 438 KCPLLEQKISSPRLKHRIHDAVKHVNEKSEKDENGDEDSDAEKLSPLLQNSENLRNGSLA 497

Query: 375 ---LDRSNSVTDTDTEY 388
              +D    + DTDT++
Sbjct: 498 LNMVDVVEPIDDTDTDH 514

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322802324|gb|EFZ22720.1| hypothetical protein SINV_12589 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332031505|gb|EGI70977.1| RING finger protein 157 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307178193|gb|EFN66991.1| RING finger protein 157 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380011558|ref|XP_003689868.1| PREDICTED: RING finger protein 157-like [Apis florea] Back     alignment and taxonomy information
>gi|242017851|ref|XP_002429399.1| mahogunin, putative [Pediculus humanus corporis] gi|212514318|gb|EEB16661.1| mahogunin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307201771|gb|EFN81444.1| RING finger protein 157 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156544223|ref|XP_001606752.1| PREDICTED: RING finger protein 157-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350409290|ref|XP_003488682.1| PREDICTED: RING finger protein 157-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328793131|ref|XP_624563.2| PREDICTED: RING finger protein 157-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
FB|FBgn0030514 789 CG9941 [Drosophila melanogaste 0.546 0.302 0.562 3.3e-91
UNIPROTKB|F1RWM8 686 RNF157 "Uncharacterized protei 0.606 0.386 0.505 1.2e-73
UNIPROTKB|E1C804536 MGRN1 "Uncharacterized protein 0.803 0.654 0.426 9.6e-73
ZFIN|ZDB-GENE-110401-3549 mgrn1b "mahogunin, ring finger 0.860 0.684 0.405 1.6e-72
MGI|MGI:2447670532 Mgrn1 "mahogunin, ring finger 0.807 0.663 0.432 2e-72
UNIPROTKB|E9PB19531 MGRN1 "E3 ubiquitin-protein li 0.814 0.670 0.422 5.3e-72
RGD|1311862533 Mgrn1 "mahogunin ring finger 1 0.796 0.652 0.428 5.3e-72
UNIPROTKB|Q5XIQ4533 Mgrn1 "E3 ubiquitin-protein li 0.796 0.652 0.428 5.3e-72
MGI|MGI:2442484 685 Rnf157 "ring finger protein 15 0.606 0.386 0.494 6e-72
UNIPROTKB|F1P3G8 632 RNF157 "Uncharacterized protei 0.599 0.414 0.491 4.7e-70
FB|FBgn0030514 CG9941 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 732 (262.7 bits), Expect = 3.3e-91, Sum P(3) = 3.3e-91
 Identities = 144/256 (56%), Positives = 186/256 (72%)

Query:    46 YNIEFIFDCDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPG 105
             YNIEF FD D  C+IT+++F +ED+  + ++ +P++       +T+HY+KG +Q F QP 
Sbjct:   162 YNIEFTFDSDAKCAITIYYFCSEDVSPSGVTLVPREGLTS---ETYHYEKGINQCFSQPS 218

Query:   106 VTFIPSQYEDDELMYNIDKEIIPIAIQCVTTSDDGQEDQKQCHTTIAVVDHHADD-SYTL 164
               F P Q  +DEL Y+  +E  P+AI CV   ++G ++ +Q HTTI V+DHH ++ SY L
Sbjct:   219 HVFNPQQMPEDELGYSPGREQYPVAIHCVV--EEGSDECRQSHTTICVIDHHPENGSYVL 276

Query:   165 KGLKQKLYVDGLCYLLQEIYGIENKNNEQYKGCEDCEDGGSECVICMCDIRDTLILPCRH 224
             + LKQK++VDGLCYLLQEIYGIENK   +    E+ +D GSECVICM + RDTLILPCRH
Sbjct:   277 RALKQKIFVDGLCYLLQEIYGIENKAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRH 336

Query:   225 LCLCHSCADSLRYQANNCPICRAPFRALLQIRALQKN-SSHV----SETSSD------NI 273
             LCLC+SCADSLRYQANNCPICRAPFRALLQIRA+QK  S+HV    + TS+       ++
Sbjct:   337 LCLCNSCADSLRYQANNCPICRAPFRALLQIRAVQKGISTHVLHQNTPTSAAGEPAPVDV 396

Query:   274 PPGYDAVSLIEALNGP 289
             PPGY  VSLIEALNGP
Sbjct:   397 PPGYIPVSLIEALNGP 412
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|F1RWM8 RNF157 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C804 MGRN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110401-3 mgrn1b "mahogunin, ring finger 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2447670 Mgrn1 "mahogunin, ring finger 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E9PB19 MGRN1 "E3 ubiquitin-protein ligase MGRN1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311862 Mgrn1 "mahogunin ring finger 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XIQ4 Mgrn1 "E3 ubiquitin-protein ligase MGRN1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2442484 Rnf157 "ring finger protein 157" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3G8 RNF157 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-13
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 6e-08
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-07
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-07
smart0018440 smart00184, RING, Ring finger 1e-04
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 3e-04
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 0.003
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 0.004
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 63.9 bits (156), Expect = 2e-13
 Identities = 23/43 (53%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 206 ECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAP 248
            CVIC+   R+ + LPC HLCLC  CA  LR +   CPICR P
Sbjct: 4   LCVICLERPRNVVFLPCGHLCLCEECAKRLRSK-KKCPICRQP 45

Length = 49
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
KOG4265|consensus349 100.0
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.3
KOG4172|consensus62 99.27
PHA02929238 N1R/p28-like protein; Provisional 98.7
KOG1571|consensus355 98.69
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.68
KOG0823|consensus230 98.66
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.65
KOG0317|consensus293 98.61
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.59
KOG4275|consensus350 98.54
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.38
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.37
KOG1100|consensus207 98.35
KOG1785|consensus563 98.33
PHA02926242 zinc finger-like protein; Provisional 98.3
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.29
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.23
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.22
PF1463444 zf-RING_5: zinc-RING finger domain 98.21
KOG0320|consensus187 98.18
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.17
KOG4628|consensus348 98.17
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.16
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.15
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.09
KOG2164|consensus513 97.94
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.89
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.86
KOG2177|consensus 386 97.79
KOG0802|consensus543 97.77
KOG0824|consensus324 97.67
KOG0287|consensus 442 97.59
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.57
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.52
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.4
KOG1039|consensus344 97.34
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.33
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.26
KOG0978|consensus698 96.98
KOG4692|consensus489 96.93
KOG4159|consensus398 96.78
KOG0828|consensus636 96.62
KOG0311|consensus 381 96.53
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.26
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.87
KOG0804|consensus493 95.84
KOG0825|consensus 1134 95.66
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 95.62
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.97
COG5152259 Uncharacterized conserved protein, contains RING a 94.83
KOG0297|consensus 391 94.72
PF04641260 Rtf2: Rtf2 RING-finger 94.71
KOG1813|consensus313 94.54
KOG4367|consensus 699 93.69
KOG3039|consensus303 93.67
KOG1814|consensus445 93.44
COG52191525 Uncharacterized conserved protein, contains RING Z 93.43
KOG2879|consensus298 93.41
KOG1001|consensus674 93.29
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 93.19
KOG2660|consensus331 92.72
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.68
KOG3002|consensus299 92.36
KOG4739|consensus233 92.02
KOG1002|consensus791 91.17
KOG4185|consensus296 90.47
KOG4445|consensus368 90.34
KOG3800|consensus300 90.06
KOG2932|consensus389 89.23
KOG0827|consensus 465 89.14
KOG1428|consensus3738 89.01
KOG2113|consensus394 88.83
KOG1645|consensus 463 88.53
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 88.46
KOG1734|consensus328 87.7
PHA02825162 LAP/PHD finger-like protein; Provisional 86.97
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 86.84
PF10272358 Tmpp129: Putative transmembrane protein precursor; 86.6
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 86.49
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 86.18
COG5222427 Uncharacterized conserved protein, contains RING Z 86.01
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 85.6
PHA03096284 p28-like protein; Provisional 85.47
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 84.93
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 82.61
PHA02862156 5L protein; Provisional 82.55
KOG3842|consensus429 81.71
KOG0826|consensus357 80.51
>KOG4265|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.9e-55  Score=438.48  Aligned_cols=254  Identities=41%  Similarity=0.670  Sum_probs=214.2

Q ss_pred             CCCccCCCCC-CCCCCCcceeeeeeeeccCeeeeEecc---------------------------CcCCCceeEEEEEEe
Q psy6091           2 QPMALFPYPP-PQSNEPYKTLKALINIRKESLRFVKVN---------------------------DESQRQVYNIEFIFD   53 (437)
Q Consensus         2 ~~p~~fpy~~-p~~~e~~~tlrn~VNIrKdSlRlv~~~---------------------------~~~~~~~y~v~FtFD   53 (437)
                      +||+.|||.. |+.|.+.+++..+||+||+|++++..+                           |..+++.|+++|+||
T Consensus        65 ~rp~~~Py~~~~~~h~~~~~~~~l~~~r~~s~~~~~~~~~~~~~~~av~i~~d~~l~k~~~~l~~d~~~P~~~~~sf~fd  144 (349)
T KOG4265|consen   65 SRPVLFPYYFTPLSHAPIRPLIDLVNYRKPSLLLVCAPPDQYLHQKAVTIRNDVNLDKETLRLDPDPLTPGLLLLSFTFD  144 (349)
T ss_pred             cccccCCCCCCCcccccccchhhcccccccccceEecCCCccccccceeccchhhcccceEEeccCCCCcceeEEEEEec
Confidence            4788888887 666666666655555555555444332                           123788999999999


Q ss_pred             ccCCeEEEEEEeEEEcccCCceeeecCCCCCCCceeEEEecCCCCceecCCceeecCCCCCcchhcccCCCceeeEEEEE
Q psy6091          54 CDVPCSITVHFFVTEDIMGNTISYIPKKSNPCPVVKTFHYKKGASQLFCQPGVTFIPSQYEDDELMYNIDKEIIPIAIQC  133 (437)
Q Consensus        54 A~~~csItIyf~a~E~~~~~~~~~~p~~~~~~l~s~t~~f~kGl~Q~F~qps~~iD~s~~~e~eL~~~~~~~~~PlvI~~  133 (437)
                      |+.+|+|+|+|||+|+..++.+.+.+..    +.+.||+|++|++|+|.|+++.||++.|++++|.+..++.+||++|++
T Consensus       145 a~~~g~itV~~fakE~~~c~~~~~~~~~----~~~~t~~f~~gl~Q~F~q~s~~~D~~~~~~~~L~~~~~~~vyplsi~~  220 (349)
T KOG4265|consen  145 ALAQGAITVLFFAKEEVLCGLVLLVPDE----LPSITVHFEKGLGQLFLQPSTGIDFSVMSIDDLSLSLDRRVYPLSISA  220 (349)
T ss_pred             cccCccEEEEEecccccccccccccccc----CCCeeEEcccchhhhhcCCccccchhhcchhhhcccccCCeeeEEEEE
Confidence            9999999999999999999988777653    568999999999999999998899999999999999999999999999


Q ss_pred             EeecCC-CCcccccceEEEEEEEecCCCceeeeeeeeEEeeCCeEEEeeeeeccccCCCCcCCCCCCCCCCccccccccc
Q psy6091         134 VTTSDD-GQEDQKQCHTTIAVVDHHADDSYTLKGLKQKLYVDGLCYLLQEIYGIENKNNEQYKGCEDCEDGGSECVICMC  212 (437)
Q Consensus       134 ~~~s~e-g~~~~~qsq~t~av~ek~~dg~~~vkvlKQkl~v~g~~Y~lQEIYGien~~~~~~~~d~d~ed~~~eC~ICl~  212 (437)
                      ++...+ +..-..+.+++.++.++.++|.++++++||++|++|+.|++||||||+++..+....  ++.+++++|+|||+
T Consensus       221 ~~~~~~~~~~~~~~~~~tq~v~~~~~~G~~~~~~~kQ~~~v~g~~y~LqEiyGien~~v~~~~~--~~~~~gkeCVICls  298 (349)
T KOG4265|consen  221 EVQPSDVVESMGVFHVITQAVYEKDEKGSIKIKVLKQILWVDGTRYLLQEIYGIENSTVEGTDA--DESESGKECVICLS  298 (349)
T ss_pred             EEeccccccccceeeEEEeeeeccCcCCceeeeeeeeEEEEeCceeeeehhhccccCCCCCCcc--ccccCCCeeEEEec
Confidence            984211 222334566788888888799999999999999999999999999999887654322  25578999999999


Q ss_pred             cccCeEEECcCCccccHhhHHHHhccCCCCccccccccceEEEEecccC
Q psy6091         213 DIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQIRALQKN  261 (437)
Q Consensus       213 ~~~d~vlLPC~H~C~C~~Ca~~l~~qs~~CPiCR~~I~~ll~I~~~~~~  261 (437)
                      +.+|+++|||||+|+|.+|++.|+.|.++|||||++|..+++|.+.++.
T Consensus       299 e~rdt~vLPCRHLCLCs~Ca~~Lr~q~n~CPICRqpi~~ll~i~~~~~~  347 (349)
T KOG4265|consen  299 ESRDTVVLPCRHLCLCSGCAKSLRYQTNNCPICRQPIEELLEIYVNKED  347 (349)
T ss_pred             CCcceEEecchhhehhHhHHHHHHHhhcCCCccccchHhhheecccccc
Confidence            9999999999999999999999999999999999999999999988764

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG3842|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2ea5_A68 Solution Structure Of The Ring Domain Of The Human 1e-04
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 7e-04
>pdb|2EA5|A Chain A, Solution Structure Of The Ring Domain Of The Human Cell Growth Regulator With Ring Finger Domain 1 Protein Length = 68 Back     alignment and structure 
Iteration: 1

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 4/51 (7%)
Query: 196 GCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICR 246
           G E  E+   +CV+C     + ++LPCRH CLC  C    +     CP+CR
Sbjct: 7   GVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQ----QCPMCR 53
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2ea5_A68 Cell growth regulator with ring finger domain prot 2e-18
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 2e-17
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 1e-15
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 7e-14
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 1e-13
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 8e-12
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-07
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-07
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-06
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-06
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-06
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 8e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 8e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-05
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 1e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 5e-05
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 6e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 6e-05
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 8e-05
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 1e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-04
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 3e-04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 3e-04
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-04
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 4e-04
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 4e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 4e-04
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 5e-04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 6e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 7e-04
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
 Score = 77.9 bits (192), Expect = 2e-18
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 4/61 (6%)

Query: 196 GCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRALLQI 255
           G E  E+   +CV+C     + ++LPCRH CLC  C    +     CP+CR   +    +
Sbjct: 7   GVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQ----QCPMCRQFVQESFAL 62

Query: 256 R 256
            
Sbjct: 63  S 63
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.45
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.41
2ea5_A68 Cell growth regulator with ring finger domain prot 99.35
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.16
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.16
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.12
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.08
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.07
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.04
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.01
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.01
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.99
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.98
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.98
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.97
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.97
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.97
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.97
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.95
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.95
2ect_A78 Ring finger protein 126; metal binding protein, st 98.94
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.94
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.91
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.9
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.88
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.86
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.85
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.85
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.84
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.84
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.83
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.82
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.79
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.76
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.75
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.74
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.74
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.73
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.72
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.72
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.71
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.7
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.69
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.69
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.66
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.66
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.63
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.63
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.62
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.59
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.54
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.51
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.5
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.49
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.46
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.45
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.41
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.41
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.37
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.28
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.28
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.25
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.08
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.05
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.63
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.61
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.58
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.57
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.52
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.21
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.66
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.17
3nw0_A238 Non-structural maintenance of chromosomes element 90.52
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 84.34
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
Probab=99.45  E-value=3.8e-14  Score=109.41  Aligned_cols=56  Identities=27%  Similarity=0.605  Sum_probs=50.9

Q ss_pred             CCccccccccccccCeEEE--CcCCccccHhhHHHHhccCCCCccccccccceEEEEe
Q psy6091         202 DGGSECVICMCDIRDTLIL--PCRHLCLCHSCADSLRYQANNCPICRAPFRALLQIRA  257 (437)
Q Consensus       202 d~~~eC~ICl~~~~d~vlL--PC~H~C~C~~Ca~~l~~qs~~CPiCR~~I~~ll~I~~  257 (437)
                      ....+|+|||+..++++++  ||||+|+|..|+..|..+...||+||++|..+++|..
T Consensus         5 ~~~~~C~IC~~~~~~~~~~~~pCgH~~~C~~C~~~~~~~~~~CPiCR~~i~~~i~i~~   62 (63)
T 2vje_B            5 NLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFI   62 (63)
T ss_dssp             GGGSBCTTTSSSBSCEEEEETTEEEEEECHHHHHHHHHTTCBCTTTCCBCCEEEEEEE
T ss_pred             CcCCCCcccCCcCCCeEEEecCCCCHhHHHHHHHHHHHhCCcCCCcCchhhceEEEec
Confidence            3467999999999999888  9999999999999998888899999999999998753
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 437
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-11
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-08
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-08
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 9e-08
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 9e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-06
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 3e-04
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 0.001
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.003
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.9 bits (137), Expect = 3e-11
 Identities = 17/65 (26%), Positives = 23/65 (35%)

Query: 192 EQYKGCEDCEDGGSECVICMCDIRDTLILPCRHLCLCHSCADSLRYQANNCPICRAPFRA 251
           EQY+   +       C IC  + +D  I PC HL            +   CP CR   + 
Sbjct: 11  EQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKG 70

Query: 252 LLQIR 256
              I 
Sbjct: 71  TEPIV 75
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.03
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.94
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.88
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.81
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.81
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.81
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.71
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.7
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.66
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.64
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.48
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.48
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.43
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.35
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.26
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.27
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.15  E-value=5e-12  Score=100.22  Aligned_cols=53  Identities=34%  Similarity=0.725  Sum_probs=45.8

Q ss_pred             ccccccccccccCeEEECcCCccccHhhHHHHhc-cCCCCccccccccceEEEEe
Q psy6091         204 GSECVICMCDIRDTLILPCRHLCLCHSCADSLRY-QANNCPICRAPFRALLQIRA  257 (437)
Q Consensus       204 ~~eC~ICl~~~~d~vlLPC~H~C~C~~Ca~~l~~-qs~~CPiCR~~I~~ll~I~~  257 (437)
                      ...|.||++...+++++||||. ||..|...|.. +.+.||+||..|...-.|.+
T Consensus        23 ~~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~i   76 (79)
T d1fbva4          23 FQLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIVV   76 (79)
T ss_dssp             TTBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCSSC
T ss_pred             CCCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCceeec
Confidence            3579999999999999999999 99999999975 56789999999987654443
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure