Psyllid ID: psy6258


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MNRAEMSSVELTDVELGGATIFPSLNLTVFPEKGSAVFWHNAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKWGKLLLSGVF
cccEEEEEEEEccccccccccccccccEEccccccEEEEccccccccccccccccccccccccHHHHHHHcccccccccccccccccccEEEcccccEEEEEEcccccccccccccccccccccccHHHHHccccc
cccEEEHHEHHccccccccEEccccccEEcccccEEEEEEcccccccccccccccccccccccEEEEEEEEEccccccccccEccccccEEccccccEEEEEEcccccccccccccccccEEEcccEEEEEEcccc
mnraemssveltdvelggatifpslnltvfpekgsaVFWHNAHANTLLDYWMyhsgcpvalgnKWGKLLLSGltdvelggatifpslnltvfpekgsAVFWYNAHANTLLDYrmyhsgcpvalgnkwgkLLLSGVF
MNRAEMSSVELTDVELGGATIFPSLNLTVFPEKGSAVFWHNAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKWGKLLLSGVF
MNRAEMSSVELTDVELGGATIFPSLNLTVFPEKGSAVFWHNAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKWGKLLLSGVF
**********LTDVELGGATIFPSLNLTVFPEKGSAVFWHNAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKWGKLLLS***
MNRAEMSSVELTDVELGGATIFPSLNLTVFPEKGSAVFWHNAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKWGKLLLSGVF
**********LTDVELGGATIFPSLNLTVFPEKGSAVFWHNAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKWGKLLLSGVF
MNRAEMSSVELTDVELGGATIFPSLNLTVFPEKGSAVFWHNAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKWGKLLLSGVF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRAEMSSVELTDVELGGATIFPSLNLTVFPEKGSAVFWHNAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKWGKLLLSGVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
P54001534 Prolyl 4-hydroxylase subu yes N/A 0.477 0.121 0.484 3e-13
Q5RAG8534 Prolyl 4-hydroxylase subu yes N/A 0.477 0.121 0.484 3e-13
Q60715534 Prolyl 4-hydroxylase subu yes N/A 0.477 0.121 0.484 3e-13
P13674534 Prolyl 4-hydroxylase subu no N/A 0.477 0.121 0.484 3e-13
O15460535 Prolyl 4-hydroxylase subu no N/A 0.433 0.110 0.508 6e-13
Q1RMU3534 Prolyl 4-hydroxylase subu yes N/A 0.477 0.121 0.484 6e-13
Q60716537 Prolyl 4-hydroxylase subu no N/A 0.433 0.109 0.508 6e-13
Q5ZLK5534 Prolyl 4-hydroxylase subu yes N/A 0.477 0.121 0.469 8e-13
P16924516 Prolyl 4-hydroxylase subu no N/A 0.477 0.125 0.469 1e-12
Q20065539 Prolyl 4-hydroxylase subu yes N/A 0.477 0.120 0.439 2e-09
>sp|P54001|P4HA1_RAT Prolyl 4-hydroxylase subunit alpha-1 OS=Rattus norvegicus GN=P4ha1 PE=2 SV=2 Back     alignment and function desciption
 Score = 73.9 bits (180), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 1/66 (1%)

Query: 62  GNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPV 121
           GN+    L   ++DV  GGAT+FP +  +V+P+KG+AVFWYN  A+   DY   H+ CPV
Sbjct: 447 GNRIATWLFY-MSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPV 505

Query: 122 ALGNKW 127
            +GNKW
Sbjct: 506 LVGNKW 511




Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
Rattus norvegicus (taxid: 10116)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 1EC: .EC: 2
>sp|Q5RAG8|P4HA1_PONAB Prolyl 4-hydroxylase subunit alpha-1 OS=Pongo abelii GN=P4HA1 PE=2 SV=1 Back     alignment and function description
>sp|Q60715|P4HA1_MOUSE Prolyl 4-hydroxylase subunit alpha-1 OS=Mus musculus GN=P4ha1 PE=2 SV=2 Back     alignment and function description
>sp|P13674|P4HA1_HUMAN Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens GN=P4HA1 PE=1 SV=2 Back     alignment and function description
>sp|O15460|P4HA2_HUMAN Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens GN=P4HA2 PE=1 SV=1 Back     alignment and function description
>sp|Q1RMU3|P4HA1_BOVIN Prolyl 4-hydroxylase subunit alpha-1 OS=Bos taurus GN=P4HA1 PE=1 SV=1 Back     alignment and function description
>sp|Q60716|P4HA2_MOUSE Prolyl 4-hydroxylase subunit alpha-2 OS=Mus musculus GN=P4ha2 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLK5|P4HA2_CHICK Prolyl 4-hydroxylase subunit alpha-2 OS=Gallus gallus GN=P4HA2 PE=2 SV=1 Back     alignment and function description
>sp|P16924|P4HA1_CHICK Prolyl 4-hydroxylase subunit alpha-1 OS=Gallus gallus GN=P4HA1 PE=1 SV=1 Back     alignment and function description
>sp|Q20065|P4HA2_CAEEL Prolyl 4-hydroxylase subunit alpha-2 OS=Caenorhabditis elegans GN=phy-2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
347972274 514 AGAP004611-PA [Anopheles gambiae str. PE 0.404 0.107 0.618 4e-15
170029530 522 prolyl 4-hydroxylase subunit alpha-1 [Cu 0.485 0.126 0.537 4e-15
92096574 508 LOC557059 protein [Danio rerio] 0.404 0.108 0.6 8e-14
239915958 490 prolyl 4-hydroxylase alpha II-like precu 0.404 0.112 0.6 8e-14
170064953 509 prolyl 4-hydroxylase alpha subunit 1 [Cu 0.485 0.129 0.507 7e-13
344252711 584 Prolyl 4-hydroxylase subunit alpha-2 [Cr 0.448 0.104 0.540 1e-12
56118630 527 prolyl 4-hydroxylase, alpha polypeptide 0.492 0.127 0.485 1e-12
157114983 448 prolyl 4-hydroxylase alpha subunit 1, pu 0.470 0.142 0.5 1e-12
195341558 485 GM12146 [Drosophila sechellia] gi|194131 0.411 0.115 0.571 1e-12
281348666 505 hypothetical protein PANDA_000722 [Ailur 0.463 0.124 0.523 1e-12
>gi|347972274|ref|XP_001237637.3| AGAP004611-PA [Anopheles gambiae str. PEST] gi|333469330|gb|EAU76664.3| AGAP004611-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score = 86.3 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 34/55 (61%), Positives = 43/55 (78%)

Query: 73  LTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKW 127
           L+DV +GGAT+FP L L VFP+KGSA+FWYN HAN  +D+R  H  CPV +G+KW
Sbjct: 437 LSDVAIGGATVFPQLGLGVFPQKGSAIFWYNLHANGTVDHRTLHGACPVFVGSKW 491




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170029530|ref|XP_001842645.1| prolyl 4-hydroxylase subunit alpha-1 [Culex quinquefasciatus] gi|167863229|gb|EDS26612.1| prolyl 4-hydroxylase subunit alpha-1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|92096574|gb|AAI15350.1| LOC557059 protein [Danio rerio] Back     alignment and taxonomy information
>gi|239915958|ref|NP_001070123.2| prolyl 4-hydroxylase alpha II-like precursor [Danio rerio] Back     alignment and taxonomy information
>gi|170064953|ref|XP_001867740.1| prolyl 4-hydroxylase alpha subunit 1 [Culex quinquefasciatus] gi|167882143|gb|EDS45526.1| prolyl 4-hydroxylase alpha subunit 1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|344252711|gb|EGW08815.1| Prolyl 4-hydroxylase subunit alpha-2 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|56118630|ref|NP_001007975.1| prolyl 4-hydroxylase, alpha polypeptide 2 precursor [Xenopus (Silurana) tropicalis] gi|51513259|gb|AAH80485.1| p4ha2 protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|157114983|ref|XP_001658090.1| prolyl 4-hydroxylase alpha subunit 1, putative [Aedes aegypti] gi|108877085|gb|EAT41310.1| AAEL007032-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|195341558|ref|XP_002037373.1| GM12146 [Drosophila sechellia] gi|194131489|gb|EDW53532.1| GM12146 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|281348666|gb|EFB24250.1| hypothetical protein PANDA_000722 [Ailuropoda melanoleuca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
ZFIN|ZDB-GENE-060929-954508 zgc:152670 "zgc:152670" [Danio 0.404 0.108 0.6 1.2e-14
UNIPROTKB|I3L5Y0525 P4HA2 "Uncharacterized protein 0.536 0.139 0.472 7.1e-14
FB|FBgn0052201520 CG32201 [Drosophila melanogast 0.485 0.126 0.447 3.1e-13
FB|FBgn0051014540 PH4alphaSG1 "prolyl-4-hydroxyl 0.463 0.116 0.537 1.2e-12
FB|FBgn0051524536 CG31524 [Drosophila melanogast 0.404 0.102 0.545 1.5e-12
FB|FBgn0051015525 PH4alphaPV "prolyl-4-hydroxyla 0.404 0.104 0.527 2.3e-12
UNIPROTKB|E2RLA2534 P4HA1 "Uncharacterized protein 0.477 0.121 0.484 2.4e-12
UNIPROTKB|E2RLB8534 P4HA1 "Uncharacterized protein 0.477 0.121 0.484 2.4e-12
UNIPROTKB|P13674534 P4HA1 "Prolyl 4-hydroxylase su 0.477 0.121 0.484 2.4e-12
UNIPROTKB|A1X898534 P4HA1 "Uncharacterized protein 0.477 0.121 0.484 2.4e-12
ZFIN|ZDB-GENE-060929-954 zgc:152670 "zgc:152670" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 195 (73.7 bits), Expect = 1.2e-14, P = 1.2e-14
 Identities = 33/55 (60%), Positives = 43/55 (78%)

Query:    73 LTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKW 127
             ++DVE+GGAT+F ++ + V PEKGSAVFWYN H N  LD +  H+GCPV +GNKW
Sbjct:   431 MSDVEVGGATVFTNVGVAVKPEKGSAVFWYNLHKNGELDLKTKHAGCPVLVGNKW 485


GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016706 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0016702 "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen" evidence=IEA
GO:0031418 "L-ascorbic acid binding" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0004656 "procollagen-proline 4-dioxygenase activity" evidence=IEA
UNIPROTKB|I3L5Y0 P4HA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0052201 CG32201 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051014 PH4alphaSG1 "prolyl-4-hydroxylase-alpha SG1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051524 CG31524 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051015 PH4alphaPV "prolyl-4-hydroxylase-alpha PV" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLA2 P4HA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLB8 P4HA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P13674 P4HA1 "Prolyl 4-hydroxylase subunit alpha-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A1X898 P4HA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
smart00702165 smart00702, P4Hc, Prolyl 4-hydroxylase alpha subun 5e-12
smart00702165 smart00702, P4Hc, Prolyl 4-hydroxylase alpha subun 4e-11
PLN00052310 PLN00052, PLN00052, prolyl 4-hydroxylase; Provisio 1e-05
PLN00052310 PLN00052, PLN00052, prolyl 4-hydroxylase; Provisio 2e-04
>gnl|CDD|214780 smart00702, P4Hc, Prolyl 4-hydroxylase alpha subunit homologues Back     alignment and domain information
 Score = 59.3 bits (144), Expect = 5e-12
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 10/59 (16%)

Query: 73  LTDVELGGATIFPSLNL----TVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKW 127
           L DVE GG  +FP L L    TV P+KG  +F+ + H       R  H  CPV  G++W
Sbjct: 106 LNDVEEGGELVFPGLRLMVVATVKPKKGDLLFFPSGHG------RSLHGVCPVTRGSRW 158


Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor. Length = 165

>gnl|CDD|214780 smart00702, P4Hc, Prolyl 4-hydroxylase alpha subunit homologues Back     alignment and domain information
>gnl|CDD|177683 PLN00052, PLN00052, prolyl 4-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|177683 PLN00052, PLN00052, prolyl 4-hydroxylase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
PLN00052310 prolyl 4-hydroxylase; Provisional 99.96
KOG1591|consensus289 99.95
PLN00052310 prolyl 4-hydroxylase; Provisional 99.84
KOG1591|consensus289 99.81
smart00702178 P4Hc Prolyl 4-hydroxylase alpha subunit homologues 99.76
smart00702178 P4Hc Prolyl 4-hydroxylase alpha subunit homologues 99.47
PRK05467226 Fe(II)-dependent oxygenase superfamily protein; Pr 99.45
PF13640100 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; 98.93
PRK05467226 Fe(II)-dependent oxygenase superfamily protein; Pr 98.84
PHA02869 418 C4L/C10L-like gene family protein; Provisional 98.78
PHA02813 354 hypothetical protein; Provisional 98.63
PF13640100 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; 98.26
PHA02813 354 hypothetical protein; Provisional 97.66
PHA02869 418 C4L/C10L-like gene family protein; Provisional 97.63
COG3128229 PiuC Uncharacterized iron-regulated protein [Funct 96.46
PF0317198 2OG-FeII_Oxy: 2OG-Fe(II) oxygenase superfamily Ent 95.54
COG3128229 PiuC Uncharacterized iron-regulated protein [Funct 95.08
PF1366170 2OG-FeII_Oxy_4: 2OG-Fe(II) oxygenase superfamily 94.75
PF12851171 Tet_JBP: Oxygenase domain of the 2OGFeDO superfami 94.21
KOG3710|consensus280 93.99
PF03336 339 Pox_C4_C10: Poxvirus C4/C10 protein; InterPro: IPR 93.92
PF09859173 Oxygenase-NA: Oxygenase, catalysing oxidative meth 93.84
PF13759101 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB 93.8
PHA02866 333 Hypothetical protein; Provisional 93.35
TIGR02466201 conserved hypothetical protein. This family consis 92.96
PF09859173 Oxygenase-NA: Oxygenase, catalysing oxidative meth 92.47
PHA02923 315 hypothetical protein; Provisional 91.63
PF1366170 2OG-FeII_Oxy_4: 2OG-Fe(II) oxygenase superfamily 90.25
PF0317198 2OG-FeII_Oxy: 2OG-Fe(II) oxygenase superfamily Ent 88.9
KOG3710|consensus280 87.33
TIGR02408277 ectoine_ThpD ectoine hydroxylase. Both ectoine and 82.89
>PLN00052 prolyl 4-hydroxylase; Provisional Back     alignment and domain information
Probab=99.96  E-value=2.4e-30  Score=207.14  Aligned_cols=93  Identities=29%  Similarity=0.545  Sum_probs=84.1

Q ss_pred             ecccCccccccccCcCCccccCcccceeeeeccccccccCcccCCCC------------------ceEEecccCeEEEEE
Q psy6258          41 NAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSL------------------NLTVFPEKGSAVFWY  102 (136)
Q Consensus        41 n~~~~~h~D~~s~H~~~pv~~G~R~aT~l~~yLnd~~~GG~t~Fp~~------------------~~~v~p~~G~al~~~  102 (136)
                      +++|+.|.|++..-. .....|+|++|+++ ||||+++||+|+||++                  +++|+|+||+||+|+
T Consensus       142 Gq~Y~~H~D~~~~~~-~~~~gg~R~aTvL~-YLndv~~GGeT~FP~~~~~~~~~~~~~~s~c~~~gl~VkPkkG~ALlF~  219 (310)
T PLN00052        142 GQKYEPHFDYFHDKI-NQALGGHRYATVLM-YLSTVDKGGETVFPNAEGWENQPKDDTFSECAHKGLAVKPVKGDAVLFF  219 (310)
T ss_pred             CCCCCCCCCcccccc-ccccCCceeEEEEE-EeccCCCCCceecCCcccccccccccchhhhhcCCeEeccCcceEEEEe
Confidence            678999999976421 12357899999999 9999999999999998                  799999999999999


Q ss_pred             ecCCCCCCCccceeccCccccCcEEEEEecccc
Q psy6258         103 NAHANTLLDYRMYHSGCPVALGNKWGKLLLSGV  135 (136)
Q Consensus       103 ~~~~~~~~d~~~~H~~~pv~~G~K~~~~~w~~~  135 (136)
                      |+++||..|++|+|+||||++|+||++|+|+.+
T Consensus       220 nl~~dG~~D~~SlHagcPVi~G~Kw~atkWi~~  252 (310)
T PLN00052        220 SLHIDGVPDPLSLHGSCPVIEGEKWSAPKWIHI  252 (310)
T ss_pred             ccCCCCCCCcccccCCCeeecCeEEEEEEeeec
Confidence            999999999999999999999999999999964



>KOG1591|consensus Back     alignment and domain information
>PLN00052 prolyl 4-hydroxylase; Provisional Back     alignment and domain information
>KOG1591|consensus Back     alignment and domain information
>smart00702 P4Hc Prolyl 4-hydroxylase alpha subunit homologues Back     alignment and domain information
>smart00702 P4Hc Prolyl 4-hydroxylase alpha subunit homologues Back     alignment and domain information
>PRK05467 Fe(II)-dependent oxygenase superfamily protein; Provisional Back     alignment and domain information
>PF13640 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; PDB: 3DKQ_B 3GZE_D 3HQR_A 2Y34_A 2G1M_A 2G19_A 3OUI_A 3OUJ_A 2HBU_A 2Y33_A Back     alignment and domain information
>PRK05467 Fe(II)-dependent oxygenase superfamily protein; Provisional Back     alignment and domain information
>PHA02869 C4L/C10L-like gene family protein; Provisional Back     alignment and domain information
>PHA02813 hypothetical protein; Provisional Back     alignment and domain information
>PF13640 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; PDB: 3DKQ_B 3GZE_D 3HQR_A 2Y34_A 2G1M_A 2G19_A 3OUI_A 3OUJ_A 2HBU_A 2Y33_A Back     alignment and domain information
>PHA02813 hypothetical protein; Provisional Back     alignment and domain information
>PHA02869 C4L/C10L-like gene family protein; Provisional Back     alignment and domain information
>COG3128 PiuC Uncharacterized iron-regulated protein [Function unknown] Back     alignment and domain information
>PF03171 2OG-FeII_Oxy: 2OG-Fe(II) oxygenase superfamily Entry for Lysyl hydrolases This Prosite entry is a sub-family of the Pfam entry; InterPro: IPR005123 This domain is found in members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily [], as well as the C-terminal of prolyl 4-hydroxylase alpha subunit Back     alignment and domain information
>COG3128 PiuC Uncharacterized iron-regulated protein [Function unknown] Back     alignment and domain information
>PF13661 2OG-FeII_Oxy_4: 2OG-Fe(II) oxygenase superfamily Back     alignment and domain information
>PF12851 Tet_JBP: Oxygenase domain of the 2OGFeDO superfamily ; InterPro: IPR024779 TETs are 2OG- and Fe(II)-dependent oxygenases that catalyse the conversion of 5 methyl-Cytosine (5-MC) to 5-hydroxymethyl-cytosine (hmC) in cultured cells and in vitro [] Back     alignment and domain information
>KOG3710|consensus Back     alignment and domain information
>PF03336 Pox_C4_C10: Poxvirus C4/C10 protein; InterPro: IPR005004 This is a family of proteins expressed by members of the Poxviridae Back     alignment and domain information
>PF09859 Oxygenase-NA: Oxygenase, catalysing oxidative methylation of damaged DNA; InterPro: IPR018655 This family of various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A Back     alignment and domain information
>PHA02866 Hypothetical protein; Provisional Back     alignment and domain information
>TIGR02466 conserved hypothetical protein Back     alignment and domain information
>PF09859 Oxygenase-NA: Oxygenase, catalysing oxidative methylation of damaged DNA; InterPro: IPR018655 This family of various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PHA02923 hypothetical protein; Provisional Back     alignment and domain information
>PF13661 2OG-FeII_Oxy_4: 2OG-Fe(II) oxygenase superfamily Back     alignment and domain information
>PF03171 2OG-FeII_Oxy: 2OG-Fe(II) oxygenase superfamily Entry for Lysyl hydrolases This Prosite entry is a sub-family of the Pfam entry; InterPro: IPR005123 This domain is found in members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily [], as well as the C-terminal of prolyl 4-hydroxylase alpha subunit Back     alignment and domain information
>KOG3710|consensus Back     alignment and domain information
>TIGR02408 ectoine_ThpD ectoine hydroxylase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3itq_A216 Crystal Structure Of A Prolyl 4-Hydroxylase From Ba 8e-10
>pdb|3ITQ|A Chain A, Crystal Structure Of A Prolyl 4-Hydroxylase From Bacillus Anthracis Length = 216 Back     alignment and structure

Iteration: 1

Score = 58.9 bits (141), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 32/79 (40%), Positives = 41/79 (51%), Gaps = 3/79 (3%) Query: 49 DYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANT 108 DY+ HS + N L+ L DVE GG T FP LNL+V P KG AV++ + + Sbjct: 129 DYFAEHSR---SAANNRISTLVXYLNDVEEGGETFFPKLNLSVHPRKGXAVYFEYFYQDQ 185 Query: 109 LLDYRMYHSGCPVALGNKW 127 L+ H G PV G KW Sbjct: 186 SLNELTLHGGAPVTKGEKW 204

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3itq_A216 Prolyl 4-hydroxylase, alpha subunit domain protei; 1e-24
3itq_A216 Prolyl 4-hydroxylase, alpha subunit domain protei; 4e-23
2jig_A224 Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A { 8e-21
2jig_A224 Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A { 4e-19
>3itq_A Prolyl 4-hydroxylase, alpha subunit domain protei; double-stranded beta helix, alpha-keto dependent non-heme iron oxygenase; 1.40A {Bacillus anthracis str} Length = 216 Back     alignment and structure
 Score = 92.9 bits (231), Expect = 1e-24
 Identities = 27/60 (45%), Positives = 34/60 (56%)

Query: 69  LLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCPVALGNKWG 128
           L+  L DVE GG T FP LNL+V P KG AV++   + +  L+    H G PV  G KW 
Sbjct: 146 LVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWI 205


>3itq_A Prolyl 4-hydroxylase, alpha subunit domain protei; double-stranded beta helix, alpha-keto dependent non-heme iron oxygenase; 1.40A {Bacillus anthracis str} Length = 216 Back     alignment and structure
>2jig_A Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A {Chlamydomonas reinhardtii} PDB: 3gze_A 2v4a_A 2jij_A Length = 224 Back     alignment and structure
>2jig_A Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A {Chlamydomonas reinhardtii} PDB: 3gze_A 2v4a_A 2jij_A Length = 224 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
3itq_A216 Prolyl 4-hydroxylase, alpha subunit domain protei; 99.94
2jig_A224 Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A { 99.94
3itq_A216 Prolyl 4-hydroxylase, alpha subunit domain protei; 99.8
2jig_A224 Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A { 99.8
3dkq_A243 PKHD-type hydroxylase SBAL_3634; putative oxygenas 99.67
3dkq_A243 PKHD-type hydroxylase SBAL_3634; putative oxygenas 99.22
2hbt_A247 EGL nine homolog 1; prolyl hydroxylase, hypoxia in 98.95
2hbt_A247 EGL nine homolog 1; prolyl hydroxylase, hypoxia in 98.24
2rg4_A216 Uncharacterized protein; rhodobacterales, oceanico 95.79
3kt7_A 633 PKHD-type hydroxylase TPA1; double-stranded beta h 94.42
2rg4_A216 Uncharacterized protein; rhodobacterales, oceanico 88.67
2a1x_A308 Phytanoyl-COA dioxygenase; beta jelly roll, double 85.31
3kt7_A 633 PKHD-type hydroxylase TPA1; double-stranded beta h 83.73
>3itq_A Prolyl 4-hydroxylase, alpha subunit domain protei; double-stranded beta helix, alpha-keto dependent non-heme iron oxygenase; 1.40A {Bacillus anthracis str} Back     alignment and structure
Probab=99.94  E-value=3.2e-28  Score=185.33  Aligned_cols=92  Identities=35%  Similarity=0.539  Sum_probs=83.0

Q ss_pred             ecccCccccccccCcCCccccCcccceeeeeccccccccCcccCCCCceEEecccCeEEEEEecCCCCCCCccceeccCc
Q psy6258          41 NAHANTLLDYWMYHSGCPVALGNKWGKLLLSGLTDVELGGATIFPSLNLTVFPEKGSAVFWYNAHANTLLDYRMYHSGCP  120 (136)
Q Consensus        41 n~~~~~h~D~~s~H~~~pv~~G~R~aT~l~~yLnd~~~GG~t~Fp~~~~~v~p~~G~al~~~~~~~~~~~d~~~~H~~~p  120 (136)
                      +++|+.|.|++...  .+...|+|.+|+++ ||||+++||+|+||+++++|+|++|+||+|+|++++|+.|.+++|++||
T Consensus       121 G~~y~~H~D~~~~~--~~~~~~~R~~T~l~-YLnd~~~GGeT~Fp~~~~~V~P~~G~al~f~~~~~~g~~d~~~lH~~~P  197 (216)
T 3itq_A          121 DQQYKAHYDYFAEH--SRSAANNRISTLVM-YLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAP  197 (216)
T ss_dssp             TCCEEEECSSCCTT--SGGGGGCEEEEEEE-ECSCCSEECCEEETTTTEEECCCTTCEEEEECCCSSHHHHHTTCEEECC
T ss_pred             CCccccccCCCcCC--CcccCCceEEEEEE-ecccCCcCceeEecCCCCEEecCCCeEEEEeccCCCCCCCCccccccce
Confidence            56778889986543  22346899999999 9999999999999999999999999999999999999999999999999


Q ss_pred             cccCcEEEEEecccc
Q psy6258         121 VALGNKWGKLLLSGV  135 (136)
Q Consensus       121 v~~G~K~~~~~w~~~  135 (136)
                      |.+|+||++|+|+..
T Consensus       198 V~~G~K~v~~~W~~~  212 (216)
T 3itq_A          198 VTKGEKWIATQWVRR  212 (216)
T ss_dssp             EEESCEEEEEEEEES
T ss_pred             eccccEEEEEeeEec
Confidence            999999999999863



>2jig_A Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A {Chlamydomonas reinhardtii} PDB: 3gze_A 2v4a_A 2jij_A Back     alignment and structure
>3itq_A Prolyl 4-hydroxylase, alpha subunit domain protei; double-stranded beta helix, alpha-keto dependent non-heme iron oxygenase; 1.40A {Bacillus anthracis str} Back     alignment and structure
>2jig_A Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A {Chlamydomonas reinhardtii} PDB: 3gze_A 2v4a_A 2jij_A Back     alignment and structure
>3dkq_A PKHD-type hydroxylase SBAL_3634; putative oxygenase, structural genomics, JOI for structural genomics, JCSG; 2.26A {Shewanella baltica OS155} Back     alignment and structure
>3dkq_A PKHD-type hydroxylase SBAL_3634; putative oxygenase, structural genomics, JOI for structural genomics, JCSG; 2.26A {Shewanella baltica OS155} Back     alignment and structure
>2hbt_A EGL nine homolog 1; prolyl hydroxylase, hypoxia inducible factor, HIF, 2- oxoglutarate, oxygenase, oxidoreductase; HET: UN9; 1.60A {Homo sapiens} PDB: 2hbu_A* 2g1m_A* 3hqu_A* 3hqr_A* 2y33_A* 2y34_A* 2g19_A* 3ouj_A* 3ouh_A* 3oui_A* Back     alignment and structure
>2hbt_A EGL nine homolog 1; prolyl hydroxylase, hypoxia inducible factor, HIF, 2- oxoglutarate, oxygenase, oxidoreductase; HET: UN9; 1.60A {Homo sapiens} PDB: 2hbu_A* 2g1m_A* 3hqu_A* 3hqr_A* 2y33_A* 2y34_A* 2g19_A* 3ouj_A* 3ouh_A* 3oui_A* Back     alignment and structure
>2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A Back     alignment and structure
>3kt7_A PKHD-type hydroxylase TPA1; double-stranded beta helix fold, dioxygenase, iron, mRNP complex, prolyl hydroxylase; HET: AKG; 1.77A {Saccharomyces cerevisiae} PDB: 3kt1_A 3kt4_A 3mgu_A Back     alignment and structure
>2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A Back     alignment and structure
>2a1x_A Phytanoyl-COA dioxygenase; beta jelly roll, double-stranded beta-helix, structural GENO structural genomics consortium, SGC, oxidoreductase; HET: AKG; 2.50A {Homo sapiens} SCOP: b.82.2.9 Back     alignment and structure
>3kt7_A PKHD-type hydroxylase TPA1; double-stranded beta helix fold, dioxygenase, iron, mRNP complex, prolyl hydroxylase; HET: AKG; 1.77A {Saccharomyces cerevisiae} PDB: 3kt1_A 3kt4_A 3mgu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d2a1xa1296 Phytanoyl-CoA dioxygenase, PhyH {Human (Homo sapie 90.1
>d2a1xa1 b.82.2.9 (A:43-338) Phytanoyl-CoA dioxygenase, PhyH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: Clavaminate synthase-like
family: PhyH-like
domain: Phytanoyl-CoA dioxygenase, PhyH
species: Human (Homo sapiens) [TaxId: 9606]
Probab=90.10  E-value=0.47  Score=33.64  Aligned_cols=57  Identities=16%  Similarity=0.208  Sum_probs=38.2

Q ss_pred             cccceeeeecccccc-ccCcccC-CCC--------------------------------ceEEecccCeEEEEEecCCCC
Q psy6258          63 NKWGKLLLSGLTDVE-LGGATIF-PSL--------------------------------NLTVFPEKGSAVFWYNAHANT  108 (136)
Q Consensus        63 ~R~aT~l~~yLnd~~-~GG~t~F-p~~--------------------------------~~~v~p~~G~al~~~~~~~~~  108 (136)
                      ....++++ +|.|+. +.|.+.+ |..                                .+.+.-++|++++|.      
T Consensus       145 ~~~~~~wi-~L~d~~~~nG~l~vipGSHk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~k~Gdvli~~------  217 (296)
T d2a1xa1         145 DLIVCAWT-AMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFH------  217 (296)
T ss_dssp             GGEEEEEE-ESSCBCTTBTCEEECTTGGGSCCCCCCC-----------CCCCC-CCCSCCEEECBCTTCEEEEC------
T ss_pred             cccceeeE-eeeeccccccccceecccccccccccccccccCCcccccccccchhhccceEEeeecCCcEEEEC------
Confidence            34567777 999975 4455544 532                                134556899999996      


Q ss_pred             CCCccceeccCcccc-CcEEEE
Q psy6258         109 LLDYRMYHSGCPVAL-GNKWGK  129 (136)
Q Consensus       109 ~~d~~~~H~~~pv~~-G~K~~~  129 (136)
                         .+++|++.|..+ ...+..
T Consensus       218 ---~~l~Hgs~~N~S~~~R~~l  236 (296)
T d2a1xa1         218 ---PLLIHGSGQNKTQGFRKAI  236 (296)
T ss_dssp             ---TTCCEEECCBCSSSCEEEE
T ss_pred             ---CCeeecCCCCCCcCceEEE
Confidence               489999999775 344443