Psyllid ID: psy6380

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MEFPTYPCKDNYDSLIQAGTTIIILSKRKLEDSSLWLLRDQGKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTNVLKT
ccccccccHHHHHHHHHHcccEEEEEcccccccccHHHccccccccHHHHcccHHHHHHHHHHccccEEccccccccccHHHHHHHHHcccEEEccccccccc
cccccccHHHccccEEEEEEcHcHHHHHHHHcccEEEEccccccccHHHccccHHHHHHHHHHccccEEEcccccccccHHHHHHHHHcccEEccccHHHHHc
mefptypckdnydslIQAGTTIIILSKRKLEDSSLWLLRdqgkrmppvaaylnnpeiicianninvdaihpgygflsEREDFAKAVIGAALEfigpttnvlkt
mefptypckdnydslIQAGTTIIILSKRKLEDSSLWLLRDQGKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAAlefigpttnvlkt
MEFPTYPCKDNYDSLIQAGTTIIILSKRKLEDSSLWLLRDQGKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTNVLKT
*****YPCKDNYDSLIQAGTTIIILSKRKLEDSSLWLLRDQGKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTT*****
***PTYPCKDNYDSLIQAGTTIIILSKRKLEDSSLWLLRDQGKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTN****
MEFPTYPCKDNYDSLIQAGTTIIILSKRKLEDSSLWLLRDQGKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTNVLKT
*EFPTYPCKDNYDSLIQAGTTIIILSKRKLEDSSLWLLRDQGKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFPTYPCKDNYDSLIQAGTTIIILSKRKLEDSSLWLLRDQGKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTNVLKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query103 2.2.26 [Sep-21-2011]
Q29RK2 1178 Pyruvate carboxylase, mit yes N/A 0.592 0.051 0.557 5e-14
P11498 1178 Pyruvate carboxylase, mit yes N/A 0.592 0.051 0.557 5e-14
O17732 1175 Pyruvate carboxylase 1 OS yes N/A 0.708 0.062 0.513 1e-13
Q05920 1178 Pyruvate carboxylase, mit yes N/A 0.592 0.051 0.540 2e-13
P52873 1178 Pyruvate carboxylase, mit yes N/A 0.592 0.051 0.540 2e-13
P32327 1180 Pyruvate carboxylase 2 OS yes N/A 0.757 0.066 0.430 1e-10
P43873 448 Biotin carboxylase OS=Hae yes N/A 0.553 0.127 0.526 3e-10
P11154 1178 Pyruvate carboxylase 1 OS no N/A 0.757 0.066 0.430 4e-10
Q58626 501 Pyruvate carboxylase subu yes N/A 0.563 0.115 0.482 1e-09
Q8X1T3 1175 Pyruvate carboxylase OS=P N/A N/A 0.737 0.064 0.441 1e-09
>sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 Back     alignment and function desciption
 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 45/61 (73%)

Query: 42  GKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTNVL 101
           G+ + PV AYL+ P+II +A   NVDA+HPGYGFLSER DFA+A   A + FIGP+  V+
Sbjct: 87  GRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVV 146

Query: 102 K 102
           +
Sbjct: 147 R 147
Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate.
Bos taurus (taxid: 9913)
EC: 6EC: .EC: 4EC: .EC: 1EC: .EC: 1
>sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 Back     alignment and function description
>sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 Back     alignment and function description
>sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 Back     alignment and function description
>sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 Back     alignment and function description
>sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 Back     alignment and function description
>sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=3 SV=1 Back     alignment and function description
>sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 Back     alignment and function description
>sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 Back     alignment and function description
>sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
380021296 1179 PREDICTED: pyruvate carboxylase, mitocho 0.592 0.051 0.655 7e-16
328788708 1213 PREDICTED: pyruvate carboxylase, mitocho 0.592 0.050 0.655 7e-16
380021294 1196 PREDICTED: pyruvate carboxylase, mitocho 0.592 0.051 0.655 7e-16
405965168 1374 Pyruvate carboxylase, mitochondrial [Cra 0.737 0.055 0.518 1e-15
322799637 1141 hypothetical protein SINV_13812 [Solenop 0.592 0.053 0.639 2e-15
383857581 1196 PREDICTED: pyruvate carboxylase, mitocho 0.592 0.051 0.639 2e-15
307169536 1196 Pyruvate carboxylase, mitochondrial [Cam 0.592 0.051 0.639 2e-15
242025020 1179 pyruvate carboxylase, putative [Pediculu 0.592 0.051 0.672 2e-15
443698790 1152 hypothetical protein CAPTEDRAFT_229262 [ 0.592 0.052 0.622 2e-15
156540073 1196 PREDICTED: pyruvate carboxylase, mitocho 0.592 0.051 0.639 3e-15
>gi|380021296|ref|XP_003694505.1| PREDICTED: pyruvate carboxylase, mitochondrial isoform 2 [Apis florea] Back     alignment and taxonomy information
 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/61 (65%), Positives = 48/61 (78%)

Query: 42  GKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTNVL 101
           G+ +PPV AYLN PEII +A   NVDAIHPGYGFLSER DFA+AVI A + FIGP+  V+
Sbjct: 86  GRGLPPVQAYLNIPEIIKVAKENNVDAIHPGYGFLSERSDFAEAVINAGIRFIGPSPKVV 145

Query: 102 K 102
           +
Sbjct: 146 Q 146

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328788708|ref|XP_003251170.1| PREDICTED: pyruvate carboxylase, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380021294|ref|XP_003694504.1| PREDICTED: pyruvate carboxylase, mitochondrial isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|405965168|gb|EKC30574.1| Pyruvate carboxylase, mitochondrial [Crassostrea gigas] Back     alignment and taxonomy information
>gi|322799637|gb|EFZ20909.1| hypothetical protein SINV_13812 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383857581|ref|XP_003704283.1| PREDICTED: pyruvate carboxylase, mitochondrial [Megachile rotundata] Back     alignment and taxonomy information
>gi|307169536|gb|EFN62178.1| Pyruvate carboxylase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242025020|ref|XP_002432924.1| pyruvate carboxylase, putative [Pediculus humanus corporis] gi|212518433|gb|EEB20186.1| pyruvate carboxylase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|443698790|gb|ELT98600.1| hypothetical protein CAPTEDRAFT_229262 [Capitella teleta] Back     alignment and taxonomy information
>gi|156540073|ref|XP_001600219.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 1 [Nasonia vitripennis] gi|345495988|ref|XP_003427614.1| PREDICTED: pyruvate carboxylase, mitochondrial-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
ZFIN|ZDB-GENE-090908-3 1181 pcl "pyruvate carboxylase, lik 0.592 0.051 0.639 3.8e-15
FB|FBgn0027580 1197 CG1516 [Drosophila melanogaste 0.592 0.050 0.622 8e-15
UNIPROTKB|F1RUV6 341 F1RUV6 "Uncharacterized protei 0.592 0.178 0.557 2.3e-13
ZFIN|ZDB-GENE-000831-1 1181 pc "pyruvate carboxylase" [Dan 0.592 0.051 0.590 4e-13
UNIPROTKB|E9PRE7 489 PC "Pyruvate carboxylase, mito 0.592 0.124 0.557 5.9e-13
UNIPROTKB|B4DN00 529 PC "cDNA FLJ60715, highly simi 0.592 0.115 0.557 6.8e-13
UNIPROTKB|Q29RK2 1178 PC "Pyruvate carboxylase, mito 0.592 0.051 0.557 2.2e-12
UNIPROTKB|F1P6G9 1178 PC "Pyruvate carboxylase" [Can 0.592 0.051 0.557 2.2e-12
UNIPROTKB|P11498 1178 PC "Pyruvate carboxylase, mito 0.592 0.051 0.557 2.2e-12
WB|WBGene00004258 1175 pyc-1 [Caenorhabditis elegans 0.708 0.062 0.513 2.8e-12
ZFIN|ZDB-GENE-090908-3 pcl "pyruvate carboxylase, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 205 (77.2 bits), Expect = 3.8e-15, P = 3.8e-15
 Identities = 39/61 (63%), Positives = 49/61 (80%)

Query:    42 GKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTNVL 101
             GK +PPVAAYL+ P+II +A   NVDAIHPGYGFLSER DFA+A + A + FIGPT +V+
Sbjct:    89 GKGLPPVAAYLHIPDIIKVAKANNVDAIHPGYGFLSERADFAQACVDAGVRFIGPTPDVV 148

Query:   102 K 102
             +
Sbjct:   149 R 149
GO:0016874 "ligase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004075 "biotin carboxylase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006094 "gluconeogenesis" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0004736 "pyruvate carboxylase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
FB|FBgn0027580 CG1516 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUV6 F1RUV6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000831-1 pc "pyruvate carboxylase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E9PRE7 PC "Pyruvate carboxylase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DN00 PC "cDNA FLJ60715, highly similar to Pyruvate carboxylase, mitochondrial (EC 6.4.1.1)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RK2 PC "Pyruvate carboxylase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6G9 PC "Pyruvate carboxylase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P11498 PC "Pyruvate carboxylase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00004258 pyc-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q29RK2PYC_BOVIN6, ., 4, ., 1, ., 10.55730.59220.0517yesN/A
O17732PYC1_CAEEL6, ., 4, ., 1, ., 10.51310.70870.0621yesN/A
P38095LAMA_EMENI6, ., 3, ., 4, ., 60.51920.50480.0419yesN/A
Q05920PYC_MOUSE6, ., 4, ., 1, ., 10.54090.59220.0517yesN/A
P43873ACCC_HAEIN6, ., 4, ., 1, ., 20.52630.55330.1272yesN/A
P11498PYC_HUMAN6, ., 4, ., 1, ., 10.55730.59220.0517yesN/A
P52873PYC_RAT6, ., 4, ., 1, ., 10.54090.59220.0517yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
PRK12999 1146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 1e-21
COG1038 1149 COG1038, PycA, Pyruvate carboxylase [Energy produc 5e-19
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 2e-18
pfam00289108 pfam00289, CPSase_L_chain, Carbamoyl-phosphate syn 1e-17
PRK08654 499 PRK08654, PRK08654, pyruvate carboxylase subunit A 2e-15
COG4770 645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 3e-15
PRK08591 451 PRK08591, PRK08591, acetyl-CoA carboxylase biotin 7e-15
PRK12833 467 PRK12833, PRK12833, acetyl-CoA carboxylase biotin 3e-14
PRK08463 478 PRK08463, PRK08463, acetyl-CoA carboxylase subunit 1e-13
PRK06111 450 PRK06111, PRK06111, acetyl-CoA carboxylase biotin 2e-13
COG0439 449 COG0439, AccC, Biotin carboxylase [Lipid metabolis 2e-13
TIGR00514 449 TIGR00514, accC, acetyl-CoA carboxylase, biotin ca 3e-13
TIGR02712 1201 TIGR02712, urea_carbox, urea carboxylase 1e-12
PRK07178 472 PRK07178, PRK07178, pyruvate carboxylase subunit A 2e-12
PRK08462 445 PRK08462, PRK08462, biotin carboxylase; Validated 5e-11
PRK05586 447 PRK05586, PRK05586, biotin carboxylase; Validated 1e-07
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information 
 Score = 87.5 bits (218), Expect = 1e-21
 Identities = 34/61 (55%), Positives = 41/61 (67%)

Query: 42  GKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTNVL 101
           G+   PV AYL+  EII +A    VDAIHPGYGFLSE  +FA+A   A + FIGPT  VL
Sbjct: 55  GEGKHPVRAYLDIDEIIRVAKQAGVDAIHPGYGFLSENPEFARACAEAGITFIGPTAEVL 114

Query: 102 K 102
           +
Sbjct: 115 R 115

Length = 1146
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|201133 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>gnl|CDD|236325 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236307 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|223516 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|236269 PRK08462, PRK08462, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 100.0
KOG0238|consensus 670 99.97
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 99.97
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 99.94
KOG0369|consensus 1176 99.92
COG0439 449 AccC Biotin carboxylase [Lipid metabolism] 99.91
PRK08654 499 pyruvate carboxylase subunit A; Validated 99.85
KOG0368|consensus 2196 99.82
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 99.8
PRK07178 472 pyruvate carboxylase subunit A; Validated 99.8
PRK08463 478 acetyl-CoA carboxylase subunit A; Validated 99.78
PRK08462 445 biotin carboxylase; Validated 99.78
PRK12833 467 acetyl-CoA carboxylase biotin carboxylase subunit; 99.78
PRK12999 1146 pyruvate carboxylase; Reviewed 99.74
PRK05586 447 biotin carboxylase; Validated 99.74
TIGR00514 449 accC acetyl-CoA carboxylase, biotin carboxylase su 99.69
TIGR02712 1201 urea_carbox urea carboxylase. Members of this fami 99.63
PRK08591 451 acetyl-CoA carboxylase biotin carboxylase subunit; 99.6
PRK06111 450 acetyl-CoA carboxylase biotin carboxylase subunit; 99.33
PLN02735 1102 carbamoyl-phosphate synthase 99.06
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 98.6
PLN02735 1102 carbamoyl-phosphate synthase 97.7
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 97.32
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 97.31
TIGR00877 423 purD phosphoribosylamine--glycine ligase. This enz 97.27
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 97.01
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 96.86
PLN02257 434 phosphoribosylamine--glycine ligase 96.85
PRK13789 426 phosphoribosylamine--glycine ligase; Provisional 96.71
PRK05784 486 phosphoribosylamine--glycine ligase; Provisional 96.67
PRK13790 379 phosphoribosylamine--glycine ligase; Provisional 96.65
PRK00885 420 phosphoribosylamine--glycine ligase; Provisional 96.6
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 96.55
PRK12767 326 carbamoyl phosphate synthase-like protein; Provisi 96.53
PRK14016 727 cyanophycin synthetase; Provisional 96.31
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 96.31
PRK06849 389 hypothetical protein; Provisional 96.04
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 95.74
PRK07206 416 hypothetical protein; Provisional 95.7
PF15632 329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 95.52
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 95.46
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 95.38
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 95.16
PRK01372 304 ddl D-alanine--D-alanine ligase; Reviewed 94.64
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 94.52
TIGR01205 315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 94.29
PLN02948 577 phosphoribosylaminoimidazole carboxylase 93.74
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 93.32
PRK06524 493 biotin carboxylase-like protein; Validated 93.1
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 92.04
PRK14569 296 D-alanyl-alanine synthetase A; Provisional 91.19
PRK01966 333 ddl D-alanyl-alanine synthetase A; Reviewed 91.07
COG0458 400 CarB Carbamoylphosphate synthase large subunit (sp 90.53
PRK14571 299 D-alanyl-alanine synthetase A; Provisional 84.93
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 81.19
CHL00200 263 trpA tryptophan synthase alpha subunit; Provisiona 80.92
PLN02591 250 tryptophan synthase 80.19
cd04730 236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 80.17
PRK14568 343 vanB D-alanine--D-lactate ligase; Provisional 80.06
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-33  Score=241.60  Aligned_cols=89  Identities=37%  Similarity=0.620  Sum_probs=83.8

Q ss_pred             HHHHHcC-cEEEEeecccccccccceecccCCCC---CCCCCCCChHHHHHHHHHcCCceecCCCccCCCCHHHHHHHHh
Q psy6380          13 DSLIQAG-TTIIILSKRKLEDSSLWLLRDQGKRM---PPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIG   88 (103)
Q Consensus        13 ~~~~~~g-~tvai~t~~dl~~a~~~~~AD~~~~~---~~~~sYlni~~Ii~~A~~~g~daIHPGYGFLSEn~~Fa~~~~~   88 (103)
                      ...++.| +|||||||.| +|+.||+|||+++.+   ++.+|||++++||++|+++|||||||||||||||++|+++|++
T Consensus        19 Rtar~lGi~tVAVYSdaD-a~A~hV~~ADEAv~iGpapaaeSYL~~dkIi~Aa~~tGA~AIHPGYGFLSENa~FA~a~~~   97 (645)
T COG4770          19 RTARDLGIRTVAVYSDAD-ADALHVRMADEAVHIGPAPAAESYLDIDKIIDAARRTGAQAIHPGYGFLSENADFAQAVED   97 (645)
T ss_pred             HHHHHcCCceEEEEecCC-CCchhhhhcchhhhcCCCchhhhhccHHHHHHHHHHhCcccccCCccccccCHHHHHHHHH
Confidence            5678999 9999999999 999999999996543   5678999999999999999999999999999999999999999


Q ss_pred             CCCeEeCCChhhhc
Q psy6380          89 AALEFIGPTTNVLK  102 (103)
Q Consensus        89 ~gi~FIGP~~~~m~  102 (103)
                      +|++|||||+++|+
T Consensus        98 aGlvfIGP~~~aI~  111 (645)
T COG4770          98 AGLVFIGPSAGAIR  111 (645)
T ss_pred             CCcEEECCCHHHHH
Confidence            99999999999987

>KOG0238|consensus Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
4hnt_A 1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 2e-11
3hb9_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 2e-11
4hnv_A 1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 2e-11
3bg5_A 1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 2e-11
3ho8_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 2e-11
4hnu_A 1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 2e-11
3hbl_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 2e-11
1ulz_A 451 Crystal Structure Of The Biotin Carboxylase Subunit 2e-09
2dzd_A 461 Crystal Structure Of The Biotin Carboxylase Domain 2e-09
2vqd_A 464 Crystal Structure Of Biotin Carboxylase From Pseudo 3e-09
2vpq_A 451 Crystal Structure Of Biotin Carboxylase From S. Aur 6e-09
3jzf_A 486 Crystal Structure Of Biotin Carboxylase From E. Col 2e-08
1dv2_A 452 The Structure Of Biotin Carboxylase, Mutant E288k, 2e-08
3rup_B 452 Crystal Structure Of E.Coli Biotin Carboxylase In C 2e-08
3g8d_A 444 Crystal Structure Of The Biotin Carboxylase Subunit 2e-08
2gpw_A 469 Crystal Structure Of The Biotin Carboxylase Subunit 2e-08
3rv4_A 452 Crystal Structure Of E.Coli Biotin Carboxylase R16e 2e-08
2gps_A 469 Crystal Structure Of The Biotin Carboxylase Subunit 2e-08
1bnc_A 449 Three-Dimensional Structure Of The Biotin Carboxyla 2e-08
3g8c_A 444 Crystal Stucture Of Biotin Carboxylase In Complex W 2e-08
2qf7_A 1165 Crystal Structure Of A Complete Multifunctional Pyr 2e-08
3tw7_A 1165 Structure Of Rhizobium Etli Pyruvate Carboxylase T8 2e-08
3u9s_A 655 Crystal Structure Of P. Aeruginosa 3-methylcrotonyl 5e-07
3n6r_A 681 Crystal Structure Of The Holoenzyme Of Propionyl-co 7e-05
3va7_A 1236 Crystal Structure Of The Kluyveromyces Lactis Urea 1e-04
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure 
Iteration: 1

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 35/55 (63%)
Query: 42  GKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGP 96
           G  + P  +YLN   II +A   NVDAIHPGYGFLSE E FA+      ++FIGP
Sbjct: 77  GSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEGIKFIGP 131
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>pdb|1ULZ|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit Of Pyruvate Carboxylase Length = 451 Back     alignment and structure
>pdb|2DZD|A Chain A, Crystal Structure Of The Biotin Carboxylase Domain Of Pyruvate Carboxylase Length = 461 Back     alignment and structure
>pdb|2VQD|A Chain A, Crystal Structure Of Biotin Carboxylase From Pseudomonas Aeruginosa Complexed With Ampcp Length = 464 Back     alignment and structure
>pdb|2VPQ|A Chain A, Crystal Structure Of Biotin Carboxylase From S. Aureus Complexed With Amppnp Length = 451 Back     alignment and structure
>pdb|3JZF|A Chain A, Crystal Structure Of Biotin Carboxylase From E. Coli In Complex With Benzimidazoles Series Length = 486 Back     alignment and structure
>pdb|1DV2|A Chain A, The Structure Of Biotin Carboxylase, Mutant E288k, Complexed With Atp Length = 452 Back     alignment and structure
>pdb|3G8D|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E296a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli Length = 444 Back     alignment and structure
>pdb|2GPW|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, F363a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|2GPS|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E23r Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|1BNC|A Chain A, Three-Dimensional Structure Of The Biotin Carboxylase Subunit Of Acetyl-Coa Carboxylase Length = 449 Back     alignment and structure
>pdb|3G8C|A Chain A, Crystal Stucture Of Biotin Carboxylase In Complex With Biotin, Bicarbonate, Adp And Mg Ion Length = 444 Back     alignment and structure
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 Back     alignment and structure
>pdb|3U9S|A Chain A, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc) 750 Kd Holoenzyme, Coa Complex Length = 655 Back     alignment and structure
>pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 Back     alignment and structure
>pdb|3VA7|A Chain A, Crystal Structure Of The Kluyveromyces Lactis Urea Carboxylase Length = 1236 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 3e-24
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 5e-23
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 6e-23
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin car 7e-19
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 2e-18
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 2e-18
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 6e-18
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 7e-18
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 9e-18
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 1e-17
2w70_A 449 Biotin carboxylase; ligase, ATP-binding, fatty aci 1e-17
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 5e-17
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
 Score = 94.3 bits (235), Expect = 3e-24
 Identities = 30/61 (49%), Positives = 36/61 (59%)

Query: 42  GKRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALEFIGPTTNVL 101
           G  + P  +YLN   II +A   NVDAIHPGYGFLSE E FA+      ++FIGP    L
Sbjct: 54  GSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEGIKFIGPHLEHL 113

Query: 102 K 102
            
Sbjct: 114 D 114
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Length = 461 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Length = 451 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Length = 446 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Length = 451 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Length = 554 Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Length = 449 Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Length = 587 Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Length = 540 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 99.81
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 99.8
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 99.77
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 99.77
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 99.7
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 99.69
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 99.64
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 99.64
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 99.53
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 99.52
2w70_A 449 Biotin carboxylase; ligase, ATP-binding, fatty aci 99.47
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin car 99.46
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 99.46
4dim_A 403 Phosphoribosylglycinamide synthetase; structural g 98.8
3vmm_A 474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 98.75
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 98.61
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 98.54
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 98.49
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 98.34
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 98.07
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.94
2yw2_A 424 Phosphoribosylamine--glycine ligase; glycinamide r 97.85
4fu0_A 357 D-alanine--D-alanine ligase 7; vancomycin resistan 97.78
2ip4_A 417 PURD, phosphoribosylamine--glycine ligase; GAR syn 97.74
2qk4_A 452 Trifunctional purine biosynthetic protein adenosi; 97.72
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.55
2pn1_A 331 Carbamoylphosphate synthase large subunit; ZP_0053 97.54
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.52
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 97.3
3vot_A 425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 97.3
2xcl_A 422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 97.19
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 97.16
2yrx_A 451 Phosphoribosylglycinamide synthetase; glycinamide 97.13
3lp8_A 442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 97.1
3mjf_A 431 Phosphoribosylamine--glycine ligase; structural ge 96.96
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 96.76
1vkz_A 412 Phosphoribosylamine--glycine ligase; TM1250, struc 96.34
3i12_A 364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 95.95
2fb9_A 322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 94.63
3e5n_A 386 D-alanine-D-alanine ligase A; bacterial blight; 2. 94.58
3eth_A 355 Phosphoribosylaminoimidazole carboxylase ATPase su 94.51
1ehi_A 377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 94.41
2z04_A 365 Phosphoribosylaminoimidazole carboxylase ATPase su 94.16
2d59_A144 Hypothetical protein PH1109; COA binding, structur 93.94
2i87_A 364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 93.7
3lwb_A 373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 93.56
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 93.4
2duw_A145 Putative COA-binding protein; ligand binding prote 93.31
3se7_A 346 VANA; alpha-beta structure, D-alanine-D-lactate li 93.06
3ln7_A 757 Glutathione biosynthesis bifunctional protein GSH; 92.86
1iuk_A140 Hypothetical protein TT1466; structural genomics, 92.84
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 92.39
3r5x_A 307 D-alanine--D-alanine ligase; alpha-beta structure, 92.26
3tqt_A 372 D-alanine--D-alanine ligase; cell envelope; 1.88A 91.88
1iow_A 306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 90.43
1uc8_A 280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 89.87
4eg0_A 317 D-alanine--D-alanine ligase; structural genomics, 89.51
2pvp_A 367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 87.03
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 84.76
1e4e_A 343 Vancomycin/teicoplanin A-type resistance protein; 84.15
3k3p_A 383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 83.96
2yv1_A 294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 82.48
2fp4_A 305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 80.97
2yv2_A 297 Succinyl-COA synthetase alpha chain; COA-binding d 80.18
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
Probab=99.81  E-value=1.3e-20  Score=159.32  Aligned_cols=85  Identities=21%  Similarity=0.397  Sum_probs=77.0

Q ss_pred             cC-cEEEEeecccc-cccccceecccCCCC---CCCCCCCChHHHHHHHHHcCCceecCCCccCCCCHHHHHHHHhCCCe
Q psy6380          18 AG-TTIIILSKRKL-EDSSLWLLRDQGKRM---PPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAALE   92 (103)
Q Consensus        18 ~g-~tvai~t~~dl-~~a~~~~~AD~~~~~---~~~~sYlni~~Ii~~A~~~g~daIHPGYGFLSEn~~Fa~~~~~~gi~   92 (103)
                      .| +||||||+.|. +++.|+++||+...+   ++.++|+|++.|+++|++.++|+|||||||+|||+.|++.|+++||.
T Consensus        87 ~Gi~tVav~s~~D~~~~a~~~~~ADe~v~i~~~~~~~syld~~~Il~~a~~~~vdaV~pG~GflsEn~~~a~~le~~Gi~  166 (587)
T 3jrx_A           87 RAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKLPELLCKNGVA  166 (587)
T ss_dssp             TSSEEEEEECHHHHHTTCHHHHHSSEEEECCCSSGGGTTTCHHHHHHHHHHTTCSEEECCSSTTTTCTHHHHHHHTTTCE
T ss_pred             CCceEEEEecccccCcCChhhHhCCEEEEeCCCCccccccCHHHHHHHHHHhCCCEEEeCCCccccCHHHHHHHHHCCCC
Confidence            38 99999998775 789999999986432   44579999999999999999999999999999999999999999999


Q ss_pred             EeCCChhhhc
Q psy6380          93 FIGPTTNVLK  102 (103)
Q Consensus        93 FIGP~~~~m~  102 (103)
                      |+||++++|+
T Consensus       167 ~iGp~~~ai~  176 (587)
T 3jrx_A          167 FLGPPSEAMW  176 (587)
T ss_dssp             ESSCCHHHHH
T ss_pred             eeCCCHHHHH
Confidence            9999999975
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 103
d1w96a2170 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N s 7e-11
d1ulza2114 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term 2e-10
d2j9ga2114 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term 5e-09
>d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PreATP-grasp domain
superfamily: PreATP-grasp domain
family: BC N-terminal domain-like
domain: Acetyl-CoA carboxylase, BC-N subdomain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 53.5 bits (128), Expect = 7e-11
 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 43  KRMPPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIGAA--LEFIGPTTNV 100
                   Y N   I+ IA   +VDA+  G+G  SE     + +  +   + FIGP  N 
Sbjct: 107 PGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNA 166

Query: 101 LKT 103
           +++
Sbjct: 167 MRS 169
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 114 Back     information, alignment and structure
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d2j9ga2114 Biotin carboxylase (BC), N-terminal domain {Escher 100.0
d1ulza2114 Biotin carboxylase (BC), N-terminal domain {Aquife 100.0
d1w96a2170 Acetyl-CoA carboxylase, BC-N subdomain {Baker's ye 99.98
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 96.35
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.02
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 95.98
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 95.55
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.85
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 94.67
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 93.75
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 90.8
d2q02a1 271 Putative cytoplasmic protein STM4435 {Salmonella t 86.61
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PreATP-grasp domain
superfamily: PreATP-grasp domain
family: BC N-terminal domain-like
domain: Biotin carboxylase (BC), N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=5.7e-38  Score=219.50  Aligned_cols=90  Identities=38%  Similarity=0.601  Sum_probs=83.6

Q ss_pred             HHHHHcC-cEEEEeecccccccccceecccCCCC---CCCCCCCChHHHHHHHHHcCCceecCCCccCCCCHHHHHHHHh
Q psy6380          13 DSLIQAG-TTIIILSKRKLEDSSLWLLRDQGKRM---PPVAAYLNNPEIICIANNINVDAIHPGYGFLSEREDFAKAVIG   88 (103)
Q Consensus        13 ~~~~~~g-~tvai~t~~dl~~a~~~~~AD~~~~~---~~~~sYlni~~Ii~~A~~~g~daIHPGYGFLSEn~~Fa~~~~~   88 (103)
                      .+.++.| +||+|||+.| +++.|++++|+...+   ++.++|||++.|+++|+++||||||||||||||||+|+++|++
T Consensus        19 ra~~elgi~tvavys~~D-~~~~h~~~ade~v~lg~~~~~~sYl~~~~Ii~~A~~~~~dAiHPGyGFLSEn~~Fa~~~~~   97 (114)
T d2j9ga2          19 RACKELGIKTVAVHSSAD-RDLKHVLLADETVCIGPAPSVKSYLNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVER   97 (114)
T ss_dssp             HHHHHHTCEEEEEEEGGG-TTCHHHHHSSEEEEEECSSGGGTTTCHHHHHHHHHHHTCSEEECCSSTTTTCHHHHHHHHH
T ss_pred             HHHHHhCCceEEEecccc-ccccceecCCceeecCCCchhhhhcCHHHHHHHHHHhCCceeecchhhhhhhHHHHHHHHH
Confidence            5788999 9999999999 999999999996432   5567999999999999999999999999999999999999999


Q ss_pred             CCCeEeCCChhhhcC
Q psy6380          89 AALEFIGPTTNVLKT  103 (103)
Q Consensus        89 ~gi~FIGP~~~~m~~  103 (103)
                      +||+||||++++|++
T Consensus        98 agi~FIGP~~~~i~~  112 (114)
T d2j9ga2          98 SGFIFIGPKAETIRL  112 (114)
T ss_dssp             TTCEESSCCHHHHHH
T ss_pred             CCCEEECcCHHHHHH
Confidence            999999999999973
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure