Psyllid ID: psy639


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
AEDRRRHSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSDCVEYYYLSKKRENYKRAIPTNNMLMKETLP
cHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccc
cHHHHHHHHcccccccccHHHHHHHHHHHccccccccHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHcccHcHHHHHHHHHcHHHcccc
aedrrrhslsvippiicdprhpftgprfinnngrvtdyEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLerrtpsdcvEYYYLSKkrenykraiptnnmlmketlp
aedrrrhslsvippiicdprhpftgprfinnngRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLiasflerrtpsDCVEYYylskkrenykraiptnnmlmketlp
AEDRRRHSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSDCVEYYYLSKKRENYKRAIPTNNMLMKETLP
**********VIPPIICDPRHPFTGPRFINNNGRVTDYE********AKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSDCVEYYYLSKKR*******************
******HSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSDCVEYYYLSKKREN*****************
********LSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSDCVEYYYLSKKRENYKRAIPTNNMLMKETLP
****RRHSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSDCVEYYYLSKKRENYKRAIPTNNM*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AEDRRRHSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSDCVEYYYLSKKRENYKRAIPTNNMLMKETLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q9Y618 2525 Nuclear receptor corepres yes N/A 0.859 0.038 0.48 1e-21
Q9WU42 2472 Nuclear receptor corepres yes N/A 0.807 0.037 0.510 2e-21
Q60974 2453 Nuclear receptor corepres no N/A 0.859 0.039 0.48 9e-21
O75376 2440 Nuclear receptor corepres no N/A 0.859 0.040 0.48 9e-21
Q4KKX4 2494 Nuclear receptor corepres yes N/A 0.859 0.039 0.47 1e-20
Q8QG78 2498 Nuclear receptor corepres N/A N/A 0.859 0.039 0.46 9e-20
Q55DP9 1448 Myb-like protein P OS=Dic yes N/A 0.824 0.064 0.319 4e-10
P25357 1226 Probable DNA-binding prot yes N/A 0.815 0.075 0.326 4e-07
Q10369 661 Uncharacterized protein C yes N/A 0.824 0.142 0.257 1e-05
P34333 1866 Gex-3-interacting protein no N/A 0.438 0.026 0.38 8e-05
>sp|Q9Y618|NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens GN=NCOR2 PE=1 SV=2 Back     alignment and function desciption
 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 68/100 (68%), Gaps = 2/100 (2%)

Query: 3   DRRRHSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDK 62
           +++   L+VIPP++ D        +FIN NG + D     +DR    MW++QE+E FR+K
Sbjct: 386 EKQMRQLAVIPPMLYDADQQRI--KFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREK 443

Query: 63  YIHHQKNFGLIASFLERRTPSDCVEYYYLSKKRENYKRAI 102
           ++ H KNFGLIASFLER+T ++CV YYYL+KK ENYK  +
Sbjct: 444 FMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLV 483




Transcriptional corepressor of NR4A2/NURR1 and acts through histone deacetylases (HDACs) to keep promoters of NR4A2/NURR1 target genes in a repressed deacetylated state (By similarity). Mediates the transcriptional repression activity of some nuclear receptors by promoting chromatin condensation, thus preventing access of the basal transcription. Isoform 1 and isoform 5 have different affinities for different nuclear receptors.
Homo sapiens (taxid: 9606)
>sp|Q9WU42|NCOR2_MOUSE Nuclear receptor corepressor 2 OS=Mus musculus GN=Ncor2 PE=1 SV=3 Back     alignment and function description
>sp|Q60974|NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus GN=Ncor1 PE=1 SV=1 Back     alignment and function description
>sp|O75376|NCOR1_HUMAN Nuclear receptor corepressor 1 OS=Homo sapiens GN=NCOR1 PE=1 SV=2 Back     alignment and function description
>sp|Q4KKX4|NCOR1_XENTR Nuclear receptor corepressor 1 OS=Xenopus tropicalis GN=ncor1 PE=2 SV=1 Back     alignment and function description
>sp|Q8QG78|NCOR1_XENLA Nuclear receptor corepressor 1 OS=Xenopus laevis GN=ncor1 PE=1 SV=1 Back     alignment and function description
>sp|Q55DP9|MYBP_DICDI Myb-like protein P OS=Dictyostelium discoideum GN=mybP PE=3 SV=1 Back     alignment and function description
>sp|P25357|SNT1_YEAST Probable DNA-binding protein SNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT1 PE=1 SV=2 Back     alignment and function description
>sp|Q10369|YDBJ_SCHPO Uncharacterized protein C22E12.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.19 PE=4 SV=2 Back     alignment and function description
>sp|P34333|GEI8_CAEEL Gex-3-interacting protein 8 OS=Caenorhabditis elegans GN=gei-8 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
328714668 1765 PREDICTED: hypothetical protein LOC10016 0.850 0.054 0.533 7e-25
241595414 985 hypothetical protein IscW_ISCW008711 [Ix 0.973 0.112 0.436 9e-22
242011439 686 conserved hypothetical protein [Pediculu 0.868 0.144 0.475 2e-21
195447120 3427 GK25336 [Drosophila willistoni] gi|19416 0.868 0.028 0.475 1e-20
270011930 675 hypothetical protein TcasGA2_TC006021 [T 0.868 0.146 0.475 1e-20
327276102 2536 PREDICTED: nuclear receptor corepressor 0.859 0.038 0.48 2e-20
443718694 361 hypothetical protein CAPTEDRAFT_73417, p 0.868 0.274 0.445 2e-20
170032616 1138 nuclear receptor co-repressor 1 [Culex q 0.868 0.086 0.475 2e-20
405953548 2229 Nuclear receptor corepressor 1 [Crassost 0.912 0.046 0.455 2e-20
195396703 1340 GJ16603 [Drosophila virilis] gi|19414673 0.868 0.073 0.465 5e-20
>gi|328714668|ref|XP_001952203.2| PREDICTED: hypothetical protein LOC100162838 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 76/103 (73%), Gaps = 6/103 (5%)

Query: 2   EDRRRHSLSVIPPIICDP--RHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVF 59
           ED++  S +VIPP++ DP  RH  T   ++NNNG V DY+ E  +R    +WTQQE+EVF
Sbjct: 445 EDKKMRSYAVIPPLMLDPHERH-LT---YLNNNGLVLDYKTEYNERKYVNIWTQQEKEVF 500

Query: 60  RDKYIHHQKNFGLIASFLERRTPSDCVEYYYLSKKRENYKRAI 102
           +D++I H KNFG IAS+L+++ PSDCV+YYYLSK +E YKR +
Sbjct: 501 KDRFIAHPKNFGAIASYLDKKCPSDCVQYYYLSKPKEEYKRLL 543




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|241595414|ref|XP_002404471.1| hypothetical protein IscW_ISCW008711 [Ixodes scapularis] gi|215502354|gb|EEC11848.1| hypothetical protein IscW_ISCW008711 [Ixodes scapularis] Back     alignment and taxonomy information
>gi|242011439|ref|XP_002426457.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510569|gb|EEB13719.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195447120|ref|XP_002071073.1| GK25336 [Drosophila willistoni] gi|194167158|gb|EDW82059.1| GK25336 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|270011930|gb|EFA08378.1| hypothetical protein TcasGA2_TC006021 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|327276102|ref|XP_003222810.1| PREDICTED: nuclear receptor corepressor 2-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|443718694|gb|ELU09203.1| hypothetical protein CAPTEDRAFT_73417, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|170032616|ref|XP_001844176.1| nuclear receptor co-repressor 1 [Culex quinquefasciatus] gi|167873006|gb|EDS36389.1| nuclear receptor co-repressor 1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|405953548|gb|EKC21189.1| Nuclear receptor corepressor 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|195396703|ref|XP_002056968.1| GJ16603 [Drosophila virilis] gi|194146735|gb|EDW62454.1| GJ16603 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
UNIPROTKB|C9J330493 NCOR2 "Nuclear receptor corepr 0.859 0.198 0.48 4e-21
UNIPROTKB|E7EVU5537 NCOR1 "Nuclear receptor corepr 0.885 0.188 0.475 5.2e-21
UNIPROTKB|E7EW50545 NCOR1 "Nuclear receptor corepr 0.885 0.185 0.475 5.4e-21
UNIPROTKB|J3KS51546 NCOR1 "Nuclear receptor corepr 0.885 0.184 0.475 5.4e-21
UNIPROTKB|E9PGV6 914 NCOR1 "Nuclear receptor corepr 0.885 0.110 0.475 1.5e-20
UNIPROTKB|J9P1J2 1449 NCOR1 "Uncharacterized protein 0.885 0.069 0.475 3e-20
UNIPROTKB|C9JQE8 1451 NCOR2 "Nuclear receptor corepr 0.859 0.067 0.48 3e-20
UNIPROTKB|F1RFN4 1262 F1RFN4 "Uncharacterized protei 0.859 0.077 0.48 3.2e-20
UNIPROTKB|J9NUC7 1409 NCOR2 "Uncharacterized protein 0.859 0.069 0.48 3.7e-20
UNIPROTKB|F1SDC8 1952 NCOR1 "Uncharacterized protein 0.885 0.051 0.475 4.3e-20
UNIPROTKB|C9J330 NCOR2 "Nuclear receptor corepressor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 254 (94.5 bits), Expect = 4.0e-21, P = 4.0e-21
 Identities = 48/100 (48%), Positives = 68/100 (68%)

Query:     3 DRRRHSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDK 62
             +++   L+VIPP++ D        +FIN NG + D     +DR    MW++QE+E FR+K
Sbjct:   386 EKQMRQLAVIPPMLYDADQQRI--KFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREK 443

Query:    63 YIHHQKNFGLIASFLERRTPSDCVEYYYLSKKRENYKRAI 102
             ++ H KNFGLIASFLER+T ++CV YYYL+KK ENYK  +
Sbjct:   444 FMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLV 483




GO:0000118 "histone deacetylase complex" evidence=IEA
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0000785 "chromatin" evidence=IEA
GO:0001012 "RNA polymerase II regulatory region DNA binding" evidence=IEA
GO:0001701 "in utero embryonic development" evidence=IEA
GO:0003007 "heart morphogenesis" evidence=IEA
GO:0003682 "chromatin binding" evidence=IEA
GO:0003714 "transcription corepressor activity" evidence=IEA
GO:0007595 "lactation" evidence=IEA
GO:0010243 "response to organic nitrogen" evidence=IEA
GO:0016604 "nuclear body" evidence=IEA
GO:0016922 "ligand-dependent nuclear receptor binding" evidence=IEA
GO:0021537 "telencephalon development" evidence=IEA
GO:0021846 "cell proliferation in forebrain" evidence=IEA
GO:0032355 "response to estradiol stimulus" evidence=IEA
GO:0032403 "protein complex binding" evidence=IEA
GO:0035259 "glucocorticoid receptor binding" evidence=IEA
GO:0042593 "glucose homeostasis" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0045599 "negative regulation of fat cell differentiation" evidence=IEA
GO:0046965 "retinoid X receptor binding" evidence=IEA
GO:0050872 "white fat cell differentiation" evidence=IEA
GO:0060206 "estrous cycle phase" evidence=IEA
UNIPROTKB|E7EVU5 NCOR1 "Nuclear receptor corepressor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EW50 NCOR1 "Nuclear receptor corepressor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KS51 NCOR1 "Nuclear receptor corepressor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGV6 NCOR1 "Nuclear receptor corepressor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1J2 NCOR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9JQE8 NCOR2 "Nuclear receptor corepressor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFN4 F1RFN4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NUC7 NCOR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDC8 NCOR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9WU42NCOR2_MOUSENo assigned EC number0.51060.80700.0372yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 1e-05
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-05
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 6e-05
cd1166146 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Doma 2e-04
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
 Score = 39.1 bits (92), Expect = 1e-05
 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 1/46 (2%)

Query: 51 WTQQEREVFRDKYIHH-QKNFGLIASFLERRTPSDCVEYYYLSKKR 95
          WT++E E+  +    + + N+  IA  L  RT   C E +    K 
Sbjct: 4  WTEEEDELLIELVKKYGKNNWEKIAKELPGRTAEQCRERWRNLLKP 49


Length = 49

>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212559 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Domain of MTA3 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG1878|consensus 1672 99.79
KOG4329|consensus 445 99.6
KOG1194|consensus 534 99.48
KOG4167|consensus 907 99.39
KOG3554|consensus 693 99.29
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.24
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.1
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.95
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.47
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.01
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.6
PLN03212 249 Transcription repressor MYB5; Provisional 97.36
KOG1279|consensus 506 97.22
PLN03091 459 hypothetical protein; Provisional 97.08
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 96.89
KOG4468|consensus 782 96.71
KOG0457|consensus 438 96.43
PLN03212 249 Transcription repressor MYB5; Provisional 95.68
KOG1878|consensus 1672 95.65
KOG0048|consensus 238 95.64
PLN03091 459 hypothetical protein; Provisional 94.81
KOG0049|consensus 939 90.7
KOG1194|consensus534 89.62
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 87.57
KOG0048|consensus 238 86.25
KOG0049|consensus 939 86.04
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 85.92
KOG1079|consensus 739 84.74
KOG0050|consensus 617 83.72
COG5147 512 REB1 Myb superfamily proteins, including transcrip 83.17
KOG2009|consensus 584 81.52
>KOG1878|consensus Back     alignment and domain information
Probab=99.79  E-value=9.1e-21  Score=170.03  Aligned_cols=102  Identities=38%  Similarity=0.745  Sum_probs=96.3

Q ss_pred             hhhhhhcccCCCCccCCCCCCCCCCeeecCCCCCcCcHHHHHhchhCCCCCHHHHHHHHHHHhhcCCChHHHHhhcCCCC
Q psy639            2 EDRRRHSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRT   81 (114)
Q Consensus         2 ~~k~~~~~A~IP~m~~~~~~~~~~~~f~d~N~lv~dp~~~~~~~~~~~~WTeeE~~~F~~~~~~~~K~F~~Ia~~lp~Ks   81 (114)
                      .+++|+++|+||+|+.|.... .+.+|++.|++..||..+|+.++.++.|+++|++.|...|.+|+|+|+.|++++..||
T Consensus       180 ~~k~~r~~a~iP~~~~D~~~~-v~nkle~~N~~~~d~nkv~k~~~~~n~Ws~~Ek~~fk~rf~~H~knf~~~as~~erkS  258 (1672)
T KOG1878|consen  180 AEKQMRQLAVIPRMLTDSARQ-VRNKLENMNSLMKDPNKVHKDRQRMNEWSPEEKELFKSRFAQHVKNFGLIASFFERKS  258 (1672)
T ss_pred             chhhhhhhhccCcccccchhh-hhhhhccCCccccCcccccchHHHhhhccccccccccchhhhcCcchhhhhhhhcccc
Confidence            478999999999999984442 6789999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHhHhhhccccchHHhhhhh
Q psy639           82 PSDCVEYYYLSKKRENYKRAIPT  104 (114)
Q Consensus        82 ~~ecv~~YY~~Kk~~~~k~l~~~  104 (114)
                      +.|||.|||++|++.+|+.+.++
T Consensus       259 v~d~vlfyy~nkkte~yk~~~~r  281 (1672)
T KOG1878|consen  259 VSDCVLFYYLNKKTENYKKLVRR  281 (1672)
T ss_pred             hhhceeeeeecccchhHHhhhcc
Confidence            99999999999999999999993



>KOG4329|consensus Back     alignment and domain information
>KOG1194|consensus Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>KOG3554|consensus Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG1279|consensus Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4468|consensus Back     alignment and domain information
>KOG0457|consensus Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG1878|consensus Back     alignment and domain information
>KOG0048|consensus Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049|consensus Back     alignment and domain information
>KOG1194|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0048|consensus Back     alignment and domain information
>KOG0049|consensus Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1079|consensus Back     alignment and domain information
>KOG0050|consensus Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2009|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
4a69_C94 Structure Of Hdac3 Bound To Corepressor And Inosito 1e-22
1xc5_A71 Solution Structure Of The Smrt Deacetylase Activati 2e-18
2eqr_A61 Solution Structure Of The First Sant Domain From Hu 2e-15
>pdb|4A69|C Chain C, Structure Of Hdac3 Bound To Corepressor And Inositol Tetraphosphate Length = 94 Back     alignment and structure

Iteration: 1

Score = 101 bits (251), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 48/91 (52%), Positives = 64/91 (70%), Gaps = 2/91 (2%) Query: 9 LSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQK 68 L+VIPP++ D +FIN NG + D +DR MW++QE+E FR+K++ H K Sbjct: 6 LAVIPPMLYDADQ--QRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPK 63 Query: 69 NFGLIASFLERRTPSDCVEYYYLSKKRENYK 99 NFGLIASFLER+T ++CV YYYL+KK ENYK Sbjct: 64 NFGLIASFLERKTVAECVLYYYLTKKNENYK 94
>pdb|1XC5|A Chain A, Solution Structure Of The Smrt Deacetylase Activation Domain Length = 71 Back     alignment and structure
>pdb|2EQR|A Chain A, Solution Structure Of The First Sant Domain From Human Nuclear Receptor Corepressor 1 Length = 61 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 1e-26
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 5e-21
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 2e-15
2crg_A70 Metastasis associated protein MTA3; transcription 2e-13
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 8e-12
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 2e-09
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 3e-08
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 5e-07
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 8e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-04
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
 Score = 93.8 bits (233), Expect = 1e-26
 Identities = 48/93 (51%), Positives = 64/93 (68%), Gaps = 2/93 (2%)

Query: 7  HSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHH 66
            L+VIPP++ D        +FIN NG + D     +DR    MW++QE+E FR+K++ H
Sbjct: 4  RQLAVIPPMLYDADQ--QRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQH 61

Query: 67 QKNFGLIASFLERRTPSDCVEYYYLSKKRENYK 99
           KNFGLIASFLER+T ++CV YYYL+KK ENYK
Sbjct: 62 PKNFGLIASFLERKTVAECVLYYYLTKKNENYK 94


>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 100.0
2crg_A70 Metastasis associated protein MTA3; transcription 99.86
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.85
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.84
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 99.71
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.55
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.33
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.64
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.92
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.91
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 98.86
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.82
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.75
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 98.74
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 98.72
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 98.69
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 98.64
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 98.6
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 98.59
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.57
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.5
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.42
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.4
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.37
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.36
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.35
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.31
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.3
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.27
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 98.14
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.12
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.11
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.09
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.07
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.06
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.01
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 97.99
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 97.83
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 97.69
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 97.6
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 97.38
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 97.13
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 96.69
1ofc_X 304 ISWI protein; nuclear protein, chromatin remodelin 96.57
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 96.56
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 96.52
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 96.25
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.26
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.25
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 93.67
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 93.48
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 92.35
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 84.12
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
Probab=100.00  E-value=3.3e-41  Score=226.24  Aligned_cols=93  Identities=52%  Similarity=0.927  Sum_probs=68.5

Q ss_pred             hhhcccCCCCccCCCCCCCCCCeeecCCCCCcCcHHHHHhchhCCCCCHHHHHHHHHHHhhcCCChHHHHhhcCCCChHH
Q psy639            5 RRHSLSVIPPIICDPRHPFTGPRFINNNGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSD   84 (114)
Q Consensus         5 ~~~~~A~IP~m~~~~~~~~~~~~f~d~N~lv~dp~~~~~~~~~~~~WTeeE~~~F~~~~~~~~K~F~~Ia~~lp~Ks~~e   84 (114)
                      +||++|+||||++|+++  +++.|+|+||||+||+++++.++.++.||++|+++|+++|.+|||+|++||++||+||++|
T Consensus         2 ~~r~~A~IP~m~~d~~~--~~~~f~d~n~lv~dp~~~~~~r~~~~~WT~eE~~~F~~~~~~~gK~F~~Ia~~l~~Kt~~~   79 (94)
T 4a69_C            2 AMRQLAVIPPMLYDADQ--QRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAE   79 (94)
T ss_dssp             ----------------------CCBCTTSBBSCHHHHHHHHHHTCCCCHHHHHHHHHHHHHSTTCHHHHHHTCTTCCHHH
T ss_pred             cchhcccCCCccCCHHH--HhheecccCCcccCHHHHHhccCCCCCCCHHHHHHHHHHHHHcCCCHHHHHHHcCCCCHHH
Confidence            69999999999999987  6899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhHhhhccccchHH
Q psy639           85 CVEYYYLSKKRENYK   99 (114)
Q Consensus        85 cv~~YY~~Kk~~~~k   99 (114)
                      ||+|||+|||+.+||
T Consensus        80 cV~~YY~~Kk~~~Yk   94 (94)
T 4a69_C           80 CVLYYYLTKKNENYK   94 (94)
T ss_dssp             HHHHHHHHSCC----
T ss_pred             HHHHHhccccCcCCC
Confidence            999999999999986



>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-15
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 1e-13
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-09
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 9e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 7e-04
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Nuclear receptor corepressor 2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.0 bits (153), Expect = 2e-15
 Identities = 39/68 (57%), Positives = 51/68 (75%)

Query: 32 NGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSDCVEYYYL 91
          NG + D     +DR    MW++QE+E FR+K++ H KNFGLIASFLER+T ++CV YYYL
Sbjct: 1  NGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYL 60

Query: 92 SKKRENYK 99
          +KK ENYK
Sbjct: 61 TKKNENYK 68


>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.87
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.86
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.63
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.28
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.0
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.92
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.88
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.8
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.61
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.59
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.47
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.13
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 97.97
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 97.93
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.51
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 97.2
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.17
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 96.98
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.11
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Nuclear receptor corepressor 2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=5.8e-24  Score=132.68  Aligned_cols=68  Identities=57%  Similarity=1.030  Sum_probs=65.7

Q ss_pred             CCCCcCcHHHHHhchhCCCCCHHHHHHHHHHHhhcCCChHHHHhhcCCCChHHHHhHhhhccccchHH
Q psy639           32 NGRVTDYEAEMRDRAQAKMWTQQEREVFRDKYIHHQKNFGLIASFLERRTPSDCVEYYYLSKKRENYK   99 (114)
Q Consensus        32 N~lv~dp~~~~~~~~~~~~WTeeE~~~F~~~~~~~~K~F~~Ia~~lp~Ks~~ecv~~YY~~Kk~~~~k   99 (114)
                      ||+|+||...++.+...+.||++|.++|.+++.+||++|..||..||+||..||++|||.||++.+|+
T Consensus         1 ng~v~dp~~~~~~~~~~~~WT~eE~~~f~~~~~~~G~~w~~Ia~~~~~rt~~q~~~~yy~~kk~~~~K   68 (68)
T d1xc5a1           1 NGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK   68 (68)
T ss_dssp             CCSSCCCCTTTTSTTTTTCCCTTTHHHHHHHHHHTTSCSSSHHHHTTTSCHHHHHHHHHHHTTTSCCC
T ss_pred             CCcccchHHHHccccCCCCCCHHHHHHHHHHHHHHCCcHHHHHHHcCCCCHHHHHHHHHHHHCccCCC
Confidence            89999999999988999999999999999999999999999999999999999999999999998874



>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure