Psyllid ID: psy6452


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----
MVSSGYFWGRGLPLKLTETEEANNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMICTIMKFGKEITTVLEEDTNSGTQDTITNNSVEMDENTVKTEALSTRTFCDHELQSIEDDILVQLECLHIDNNKAQEYIVSMNVDRTPGFKLQNNDNDQNTKVTNAMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPDFLNFKVLKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFYAQRKYWMFLTISLLCYLMGL
cccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHcHHHHccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHcccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHccccccEEEccccccccccccccHHHcccccccEEEcccccccccccccccccccEEEccccccccccHHHHHcccccccccccEEEccccccccccHHHHHccccccEEEcccccccccccccccccccEEEccccccccccHHHHHHHcccccEEEccccccccccccHHHHcccccccccccccccEEcccccHHccccHHHHHccccccEEEcccccccccccccccccccccHHHHccccccEEEccccccccccHHccccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHHHccccc
ccccccEEccccccccccccHccccccccccccccccccccccccEEcHEcHHHcccccEEEEccccccccEEEEccccEEEEcHHccccEEEcccccccEEEEEEccccccccccHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccccccccccHHHHHHccEEEccccccccccccccccccccccccccHHcccccHHcEEEcccccccccccHHHcccccccEEEccccccccccHHHHHHHHcccEEEcccccHHccccccHHHHHHHHHccEEEccccccccccHHccccccEEEEccccccccccHHHHcHHHHHHHHHHHcccccccccccccHHHHHccccccEEEccccccccccHHHHccccEEEEccccccccccHHHHccccccEEEccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcHHHHHHHccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccccHHccccccEEEccccccccccHHHHHHHccc
mvssgyfwgrglplklteteeanngtpedntdfgpdeneepvptqidmeadisqleaptfttitrgppkpmlslrwDHTVHLIGekvlnpiihtcekcekpimIYGRMICTIMKFGKEITTVLEedtnsgtqdtitnnsvemdentvkteaLSTRTFCDHELQSIEDDILVQLECLHIDNNKAQEYIVSmnvdrtpgfklqnndndqntkvTNAMDIAMELIDTELnccnkqyhdiftvnlshqDINFVQESMSqkltnltvldlshnnhqdINFVQESMSQKLTNLIVLDLshnklselpdflnfkvLKELdishnnfesmplcLQVHFyvhipykhsqsdishnnfesmplcLQVHFCKLvkldishnqikilhkprcthtlqtfsmnhnigmkipeWFWYQEFLClkelnmsstdpffehlPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKnikylncsndidhrksqdFVNVLWELPLSILYLSSIQELHLSNVqlncipedignlicleklnishnkvyklpeSFANLKSLKILDVSYnkltmlpdgfVMLSNLTTFYAQRKYWMFLTISLLCYLMGL
mvssgyfwgrglplklteteeanngtpedntdfgpdENEEPVPTQIDMEADISQLEaptfttitrgppkPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMICTIMKFGKEITTVLeedtnsgtqdtitnnsvemdenTVKTEALSTRTFCDHELQSIEDDILVQLECLHIDNNKAQEYIVSMNVDRTpgfklqnndndqnTKVTNAMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPDFLNFKVLKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFYAQRKYWMFLTISLLCYLMGL
MVSSGYFWGRGLPLKLTETEEANNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMICTIMKFGKEITTVLEEDTNSGTQDTITNNSVEMDENTVKTEALSTRTFCDHELQSIEDDILVQLECLHIDNNKAQEYIVSMNVDRTPGFKLQNNDNDQNTKVTNAMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPDFLNFKVLKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFYAQRKYWMFLTISLLCYLMGL
*****YFWGRGLP***********************************************TTI******PMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMICTIMKFGKEITTVLE**************************ALSTRTFCDHELQSIEDDILVQLECLHIDNNKAQEYIVSMNVDRTPGFK**********KVTNAMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPDFLNFKVLKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFYAQRKYWMFLTISLLCYLM**
***SGYFWGRGLPLK*******************************DMEADISQLEAPT******G**KPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMICTIMKFGKEITTVLEEDTNSGTQDTITNNSVEMDENTVKTEALSTRTFCDHELQSIEDDILVQLECLHIDNNKAQEYIVSMNVDRTPGFKLQNNDNDQNTKVTNAMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPDFLNFKVLKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFYAQRKYWMFLTISLLCYLMGL
MVSSGYFWGRGLPLKLTETEEANNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMICTIMKFGKEITTVLEEDTNSGTQDTITNNSVEMDENTVKTEALSTRTFCDHELQSIEDDILVQLECLHIDNNKAQEYIVSMNVDRTPGFKLQNNDNDQNTKVTNAMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPDFLNFKVLKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFYAQRKYWMFLTISLLCYLMGL
*****YFWGRGLPLKLTET***********TDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMICTIMKFGKEITTVLEEDTNSGTQDTITNNSVEMDENTVKTEALSTRTFCDHELQSIEDDILVQLECLHIDNNKAQEYIVSMNVDRTPGFKLQNNDNDQNTKVTNAMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPDFLNFKVLKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFYAQRKYWMFLTISLLCYLMGL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSSGYFWGRGLPLKLTETEEANNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMICTIMKFGKEITTVLEEDTNSGTQDTITNNSVEMDENTVKTEALSTRTFCDHELQSIEDDILVQLECLHIDNNKAQEYIVSMNVDRTPGFKLQNNDNDQNTKVTNAMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPDFLNFKVLKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFYAQRKYWMFLTISLLCYLMGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query594 2.2.26 [Sep-21-2011]
Q9Y4C4 1052 Malignant fibrous histioc yes N/A 0.505 0.285 0.263 5e-17
Q5F4C4529 Leucine-rich repeat prote yes N/A 0.590 0.663 0.269 1e-16
A6QLV3582 Leucine-rich repeat prote no N/A 0.602 0.615 0.274 1e-16
Q5RAV5582 Leucine-rich repeat prote no N/A 0.602 0.615 0.274 1e-16
Q9UQ13582 Leucine-rich repeat prote no N/A 0.602 0.615 0.274 1e-16
O88520582 Leucine-rich repeat prote yes N/A 0.601 0.613 0.275 2e-16
Q6AYI5582 Leucine-rich repeat prote yes N/A 0.597 0.609 0.265 3e-16
Q8AVI4577 Leucine-rich repeat prote N/A N/A 0.590 0.608 0.266 1e-14
Q1L8Y7561 Leucine-rich repeat prote yes N/A 0.595 0.631 0.264 1e-14
Q3V1N1 1048 Malignant fibrous histioc no N/A 0.563 0.319 0.248 4e-14
>sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 Back     alignment and function desciption
 Score = 89.7 bits (221), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 152/346 (43%), Gaps = 46/346 (13%)

Query: 235 DIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSH 294
           DI  +NL +  +  V E +   L +L VL L  N    +      +   LT L   D+SH
Sbjct: 64  DIEALNLGNNGLEEVPEGLGSALGSLRVLVLRRNRFARLPPAVAELGHHLTEL---DVSH 120

Query: 295 NKLSELPDFL--NFKVLKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMP 352
           N+L+ L   +    + L++L++SHN   ++P   Q+    H+     + D+S N    +P
Sbjct: 121 NRLTALGAEVVSALRELRKLNLSHNQLPALPA--QLGALAHL----EELDVSFNRLAHLP 174

Query: 353 LCLQVHFCKLVKLDISHNQIKILHKPRCTH---TLQTFSMNHNIGMKIPEWFWYQEFLCL 409
             L     +L  LD+ HNQ+     PR       L+   ++ N    +PE     +   L
Sbjct: 175 DSLSC-LSRLRTLDVDHNQLTAF--PRQLLQLVALEELDVSSNRLRGLPE-----DISAL 226

Query: 410 KELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLH--MQNTAAVMSNVSQLKYLKNI 467
           + L +           +WL           F  L SL   M +   + +  +Q   L+ +
Sbjct: 227 RALKI-----------LWLSGAELGTLPAGFCELASLESLMLDNNGLQALPAQFSCLQRL 275

Query: 468 KYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKL 527
           K LN S+           N+  E P ++L L+ ++EL+LS  QL  +P  I  L  L  L
Sbjct: 276 KMLNLSS-----------NLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTL 324

Query: 528 NISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTF 573
            + +N++  LP+S   L  L+ L +  N++ +LPD F  LS +  +
Sbjct: 325 WLDNNRIRYLPDSIVELTGLEELVLQGNQIAVLPDHFGQLSRVGLW 370





Homo sapiens (taxid: 9606)
>sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 Back     alignment and function description
>sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 Back     alignment and function description
>sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=2 SV=2 Back     alignment and function description
>sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 Back     alignment and function description
>sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 Back     alignment and function description
>sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 Back     alignment and function description
>sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query594
307203524444 E3 ubiquitin-protein ligase Hakai [Harpe 0.126 0.168 0.728 4e-26
383851562427 PREDICTED: E3 ubiquitin-protein ligase H 0.161 0.224 0.628 6e-26
307179314415 E3 ubiquitin-protein ligase Hakai [Campo 0.154 0.221 0.612 2e-25
328785507359 PREDICTED: hypothetical protein LOC55234 0.127 0.211 0.710 3e-25
380029147429 PREDICTED: uncharacterized protein LOC10 0.127 0.177 0.723 3e-25
340722230428 PREDICTED: hypothetical protein LOC10064 0.127 0.177 0.723 3e-25
350396283407 PREDICTED: hypothetical protein LOC10074 0.127 0.186 0.723 4e-25
170060921323 conserved hypothetical protein [Culex qu 0.161 0.297 0.61 4e-25
345479656491 PREDICTED: hypothetical protein LOC10011 0.109 0.132 0.815 1e-24
322794151422 hypothetical protein SINV_12098 [Solenop 0.124 0.175 0.707 1e-24
>gi|307203524|gb|EFN82557.1| E3 ubiquitin-protein ligase Hakai [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  126 bits (316), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/81 (72%), Positives = 67/81 (82%), Gaps = 6/81 (7%)

Query: 35  PDENEEPV---PT---QIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVL 88
           P+E E PV   P+   Q D+EADISQLEAPTFTTI RGPP+PML LRWDH V+LIGEKVL
Sbjct: 60  PEEQETPVAQPPSIEQQFDLEADISQLEAPTFTTINRGPPEPMLRLRWDHRVNLIGEKVL 119

Query: 89  NPIIHTCEKCEKPIMIYGRMI 109
           NP+IH C+KC KPI+IYGRMI
Sbjct: 120 NPMIHCCDKCSKPILIYGRMI 140




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383851562|ref|XP_003701301.1| PREDICTED: E3 ubiquitin-protein ligase Hakai-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307179314|gb|EFN67678.1| E3 ubiquitin-protein ligase Hakai [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328785507|ref|XP_624726.3| PREDICTED: hypothetical protein LOC552347 [Apis mellifera] Back     alignment and taxonomy information
>gi|380029147|ref|XP_003698243.1| PREDICTED: uncharacterized protein LOC100864501 [Apis florea] Back     alignment and taxonomy information
>gi|340722230|ref|XP_003399511.1| PREDICTED: hypothetical protein LOC100649743 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350396283|ref|XP_003484499.1| PREDICTED: hypothetical protein LOC100743484 [Bombus impatiens] Back     alignment and taxonomy information
>gi|170060921|ref|XP_001866016.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167879253|gb|EDS42636.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|345479656|ref|XP_001600401.2| PREDICTED: hypothetical protein LOC100115770 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322794151|gb|EFZ17360.1| hypothetical protein SINV_12098 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query594
FB|FBgn0032812452 Hakai "Hakai" [Drosophila mela 0.116 0.152 0.742 4.8e-23
DICTYBASE|DDB_G0294094510 lrrA "leucine-rich repeat-cont 0.533 0.621 0.283 2.4e-18
UNIPROTKB|E2R260582 SHOC2 "Uncharacterized protein 0.734 0.749 0.252 3.4e-18
MGI|MGI:3045299 853 Lrrd1 "leucine rich repeats an 0.535 0.372 0.280 4.4e-18
UNIPROTKB|A6QLV3582 SHOC2 "Leucine-rich repeat pro 0.734 0.749 0.252 4.4e-18
UNIPROTKB|Q9UQ13582 SHOC2 "Leucine-rich repeat pro 0.734 0.749 0.252 4.4e-18
UNIPROTKB|F2Z5G0582 SHOC2 "Uncharacterized protein 0.734 0.749 0.252 4.4e-18
UNIPROTKB|Q5RAV5582 SHOC2 "Leucine-rich repeat pro 0.734 0.749 0.252 4.4e-18
RGD|1308146582 Shoc2 "soc-2 (suppressor of cl 0.734 0.749 0.247 9.5e-18
MGI|MGI:1927197582 Shoc2 "soc-2 (suppressor of cl 0.734 0.749 0.254 1.2e-17
FB|FBgn0032812 Hakai "Hakai" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 290 (107.1 bits), Expect = 4.8e-23, P = 4.8e-23
 Identities = 52/70 (74%), Positives = 64/70 (91%)

Query:    41 PVPTQ-IDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCE 99
             PV +Q IDMEADISQLEAPTFTT++RGPP+PML L+W+H V LIGEKVLNP+IH C++C+
Sbjct:   116 PVMSQTIDMEADISQLEAPTFTTLSRGPPEPMLRLKWNHKVSLIGEKVLNPMIHCCDQCD 175

Query:   100 KPIMIYGRMI 109
             KPI++YGRMI
Sbjct:   176 KPILVYGRMI 185




GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0007427 "epithelial cell migration, open tracheal system" evidence=IMP
GO:0007391 "dorsal closure" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0008258 "head involution" evidence=IMP
GO:0040003 "chitin-based cuticle development" evidence=IMP
GO:0045296 "cadherin binding" evidence=IPI
GO:0016023 "cytoplasmic membrane-bounded vesicle" evidence=IDA
GO:0060429 "epithelium development" evidence=IMP
GO:0007015 "actin filament organization" evidence=IMP
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0035282 "segmentation" evidence=IMP
GO:0007494 "midgut development" evidence=IMP
DICTYBASE|DDB_G0294094 lrrA "leucine-rich repeat-containing protein (LRR)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E2R260 SHOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:3045299 Lrrd1 "leucine rich repeats and death domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLV3 SHOC2 "Leucine-rich repeat protein SHOC-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UQ13 SHOC2 "Leucine-rich repeat protein SHOC-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5G0 SHOC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAV5 SHOC2 "Leucine-rich repeat protein SHOC-2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|1308146 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1927197 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-05
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 53.0 bits (127), Expect = 2e-07
 Identities = 58/236 (24%), Positives = 89/236 (37%), Gaps = 16/236 (6%)

Query: 240 NLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSE 299
           +LS   I  +   +   L NL  LDLS N+  D+  +       L+NL  LDLS NK+S+
Sbjct: 146 DLSDNKIESLPSPLRN-LPNLKNLDLSFNDLSDLPKL----LSNLSNLNNLDLSGNKISD 200

Query: 300 LPDFLNFKV-LKELDISHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVH 358
           LP  +     L+ELD+S+N+   +   L            S  ++S+N  E +P  +   
Sbjct: 201 LPPEIELLSALEELDLSNNSIIELLSSL------SNLKNLSGLELSNNKLEDLPESIGNL 254

Query: 359 FCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTD 418
              L  LD+S+NQI  +        L+   ++ N              L    LN+  T 
Sbjct: 255 SN-LETLDLSNNQISSISSLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLNLLLTL 313

Query: 419 PFFE---HLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLN 471
              E   +  +   N +   E      L  L   N    + N      L      N
Sbjct: 314 KALELKLNSILLNNNILSNGETSSPEALSILESLNNLWTLDNALDESNLNRYIVKN 369


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 594
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194|consensus 873 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194|consensus 873 100.0
KOG0472|consensus565 100.0
KOG0472|consensus565 99.97
KOG0444|consensus 1255 99.97
KOG0444|consensus 1255 99.97
KOG0618|consensus 1081 99.97
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.94
KOG0618|consensus 1081 99.94
KOG4237|consensus498 99.92
KOG4237|consensus498 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.86
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
KOG0617|consensus264 99.64
KOG0617|consensus264 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.57
KOG3207|consensus505 99.45
KOG0532|consensus 722 99.41
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.34
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.33
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.29
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.26
KOG2932|consensus389 99.2
KOG3207|consensus 505 99.19
KOG0531|consensus414 99.16
KOG0532|consensus 722 99.16
KOG1259|consensus490 99.15
KOG1909|consensus382 99.11
KOG0531|consensus414 99.06
KOG1259|consensus490 99.05
KOG1909|consensus382 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
PLN03150623 hypothetical protein; Provisional 98.8
PLN03150623 hypothetical protein; Provisional 98.71
KOG4658|consensus889 98.67
KOG4658|consensus889 98.62
KOG1859|consensus 1096 98.61
KOG2982|consensus418 98.48
KOG2982|consensus 418 98.47
KOG4579|consensus177 98.44
KOG1859|consensus 1096 98.43
KOG4579|consensus177 98.39
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.31
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.29
KOG1644|consensus233 98.15
KOG2120|consensus419 98.11
PRK15386 426 type III secretion protein GogB; Provisional 98.1
KOG2120|consensus419 98.08
KOG1644|consensus233 98.03
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.01
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.94
PRK15386 426 type III secretion protein GogB; Provisional 97.94
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.73
KOG2739|consensus260 97.41
KOG3665|consensus 699 97.39
KOG2123|consensus388 97.36
KOG3665|consensus 699 97.31
KOG2123|consensus388 97.14
KOG2739|consensus260 97.12
KOG4341|consensus483 96.99
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.94
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.86
KOG0473|consensus 326 95.62
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.11
smart0037026 LRR Leucine-rich repeats, outliers. 95.11
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.86
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.37
KOG4341|consensus483 94.15
KOG4308|consensus 478 94.14
KOG0473|consensus 326 93.93
KOG4308|consensus 478 93.27
smart0037026 LRR Leucine-rich repeats, outliers. 93.18
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.18
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.02
KOG3864|consensus221 86.56
KOG4242|consensus553 84.85
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.05
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 82.5
KOG1947|consensus 482 81.71
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 81.4
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.9e-38  Score=368.21  Aligned_cols=436  Identities=21%  Similarity=0.220  Sum_probs=276.2

Q ss_pred             hhhhccCccEEecCCCCCc-ccChhh---hccCcEEEccCccccccccccccCCCCCccccCCCCc-------ccccccc
Q psy6452         145 NTVKTEALSTRTFCDHELQ-SIEDDI---LVQLECLHIDNNKAQEYIVSMNVDRTPGFKLQNNDND-------QNTKVTN  213 (594)
Q Consensus       145 ~~~~~~~L~~l~l~~n~l~-~ip~~~---l~~L~~L~Ls~N~i~~~~~~~~~~~l~~l~~~~~~~~-------~~~~~~~  213 (594)
                      ...+..+|+.+++++|+++ .+|..+   +++|++|+|++|++++..+...+..+..+.+......       ....-+.
T Consensus        88 ~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~  167 (968)
T PLN00113         88 AIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLK  167 (968)
T ss_pred             HHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCC
Confidence            3344556666666666664 566554   4566666666666665544444444444433332221       1112234


Q ss_pred             cccccccccccccccCccCCCcccEEEccCCCCcccchHhhhcCCCCCEEECCCCCCCCccccchhhhhcCCCCCEEEcC
Q psy6452         214 AMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLS  293 (594)
Q Consensus       214 ~~~l~~n~~~~~~~~~~~~l~~L~~L~Ls~n~l~~l~~~~f~~l~~L~~L~Ls~N~l~~i~~l~~~~~~~l~~L~~L~Ls  293 (594)
                      .++++.|.+.+.++..+.++++|++|+|++|.++...+..+..+++|++|+|++|.+++  .+|. .++.+++|++|+++
T Consensus       168 ~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~--~~p~-~l~~l~~L~~L~L~  244 (968)
T PLN00113        168 VLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSG--EIPY-EIGGLTSLNHLDLV  244 (968)
T ss_pred             EEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCC--cCCh-hHhcCCCCCEEECc
Confidence            45555666666666666777777777777777765555556677777777777777654  2333 34667777777777


Q ss_pred             CCCCC-CCC-CcCCCcCccEEeccCCcccc-CchhhhhccccccCCCcceEEcCCCCCCCCChhhhccCCCCcEEECCCC
Q psy6452         294 HNKLS-ELP-DFLNFKVLKELDISHNNFES-MPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHN  370 (594)
Q Consensus       294 ~N~l~-~lp-~~~~l~~L~~L~Ls~N~l~~-lp~~~~~~~~~~~~~~L~~L~Ls~N~l~~i~~~~~~~l~~L~~L~Ls~N  370 (594)
                      +|.++ .+| .|.++++|++|++++|.+++ +|..+...      .+|+.|++++|.+....+..+.++++|+.|++++|
T Consensus       245 ~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l------~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n  318 (968)
T PLN00113        245 YNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSL------QKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSN  318 (968)
T ss_pred             CceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhc------cCcCEEECcCCeeccCCChhHcCCCCCcEEECCCC
Confidence            77766 444 46677777777777777764 45444322      46777777777776555555566777777777777


Q ss_pred             CCCCCCCcc--ccCCccEEeCCCCCCC-CCCchhhhcccCcccEEECcCCCCccCCccHHHhhhccc-------------
Q psy6452         371 QIKILHKPR--CTHTLQTFSMNHNIGM-KIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMEL-------------  434 (594)
Q Consensus       371 ~l~~l~~~~--~~~~L~~L~L~~N~~~-~ip~~~~~~~~~~L~~L~Ls~n~~~~~~lp~~~~~~~~~-------------  434 (594)
                      .+++..+..  ..++|+.|++++|.+. .+|..+  ..+++|+.|++++|+ +.+.+|.++.....+             
T Consensus       319 ~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l--~~~~~L~~L~Ls~n~-l~~~~p~~~~~~~~L~~L~l~~n~l~~~  395 (968)
T PLN00113        319 NFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNL--GKHNNLTVLDLSTNN-LTGEIPEGLCSSGNLFKLILFSNSLEGE  395 (968)
T ss_pred             ccCCcCChhHhcCCCCCEEECcCCCCcCcCChHH--hCCCCCcEEECCCCe-eEeeCChhHhCcCCCCEEECcCCEeccc
Confidence            776544332  2346777777777554 445443  566677777777653 455555544321111             


Q ss_pred             --ccccccCCCcEEEcCCccccccCccccccCCCcceEeCCCCcCcccccccc--------------cccccCcccccCC
Q psy6452         435 --KENGVFSNLISLHMQNTAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQDFV--------------NVLWELPLSILYL  498 (594)
Q Consensus       435 --~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~--------------n~~~~ip~~~~~l  498 (594)
                        ..+..+++|+.|++++|.+++..+..+..+++|+.|++++|.+........              +..+.+|..+ ..
T Consensus       396 ~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~  474 (968)
T PLN00113        396 IPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GS  474 (968)
T ss_pred             CCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-cc
Confidence              112345677777777777777777777777777777777764432211000              2233444433 34


Q ss_pred             CCCcEEeCccccCc-cccccccCCCCCcEEEccCCCCc-ccCccccCCCCCCEEECcCCCCC-ccCcccccCCCCcEEEc
Q psy6452         499 SSIQELHLSNVQLN-CIPEDIGNLICLEKLNISHNKVY-KLPESFANLKSLKILDVSYNKLT-MLPDGFVMLSNLTTFYA  575 (594)
Q Consensus       499 ~~L~~L~Ls~N~l~-~ip~~~~~l~~L~~L~Ls~N~l~-~lp~~~~~l~~L~~L~Ls~N~l~-~ip~~l~~l~~L~~L~L  575 (594)
                      ++|+.|++++|+++ .+|..+..+++|+.|+|++|++. .+|..+..+++|++|+|++|+++ .+|..+..+++|++|+|
T Consensus       475 ~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L  554 (968)
T PLN00113        475 KRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDL  554 (968)
T ss_pred             ccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEEC
Confidence            67888888888887 66777888899999999999998 56778889999999999999998 67888999999999999


Q ss_pred             cCCCCcccCHhHHhhhhC
Q psy6452         576 QRKYWMFLTISLLCYLMG  593 (594)
Q Consensus       576 ~~N~l~~l~~~~~~~l~~  593 (594)
                      ++|+++..-+..+..+.+
T Consensus       555 s~N~l~~~~p~~l~~l~~  572 (968)
T PLN00113        555 SQNQLSGEIPKNLGNVES  572 (968)
T ss_pred             CCCcccccCChhHhcCcc
Confidence            999998544455554443



>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG4242|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-05
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-04
3pmh_G 290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 3e-04
1ook_G 290 Crystal Structure Of The Complex Of Platelet Recept 3e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 3e-04
1p9a_G 290 Crystal Structure Of N-terminal Domain Of Human Pla 3e-04
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 3e-04
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 4e-04
1m0z_A 290 Crystal Structure Of The Von Willebrand Factor Bind 4e-04
1sq0_B 288 Crystal Structure Of The Complex Of The Wild-Type V 4e-04
1m10_B 290 Crystal Structure Of The Complex Of Glycoprotein Ib 4e-04
1p8v_A 279 Crystal Structure Of The Complex Of Platelet Recept 4e-04
1u0n_D 265 The Ternary Von Willebrand Factor A1-Glycoprotein I 5e-04
1gwb_B 281 Structure Of Glycoprotein 1b Length = 281 5e-04
3p72_A 269 Structure Of Platelet Glycoprotein 1b Alpha With A 5e-04
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Iteration: 1

Score = 48.1 bits (113), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 5/70 (7%) Query: 256 KLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPD--FLNFKVLKELD 313 KLTNLT L+L+HN Q + + + KLTNL LDLS+N+L LP+ F LK+L Sbjct: 131 KLTNLTYLNLAHNQLQSL---PKGVFDKLTNLTELDLSYNQLQSLPEGVFDKLTQLKDLR 187 Query: 314 ISHNNFESMP 323 + N +S+P Sbjct: 188 LYQNQLKSVP 197
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-32
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-32
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 6e-19
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-22
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-20
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-17
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-12
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-11
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-08
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 7e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 4e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
 Score =  140 bits (354), Expect = 5e-35
 Identities = 50/341 (14%), Positives = 97/341 (28%), Gaps = 75/341 (21%)

Query: 256 KLTNLTVLDLSHNNHQDINFVQESMS-QKLTNLIVLDLSHNKLSELPDFLNFKVLKELDI 314
               + +  + +NN   +     S S QK+  L +LD  HNK+  L  F     L +L +
Sbjct: 546 TGPKIQIFYMGYNN---LEEFPASASLQKMVKLGLLDCVHNKVRHLEAFGTNVKLTDLKL 602

Query: 315 SHNNFESMPLCLQVHFYVHIPYKHSQS----DISHNNFESMPLCLQVHFC-KLVKLDISH 369
            +N  E +P               +        SHN  + +P          +  +D S+
Sbjct: 603 DYNQIEEIPEDF---------CAFTDQVEGLGFSHNKLKYIPNIFNAKSVYVMGSVDFSY 653

Query: 370 NQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLL 429
           N+I    +                   I       + +    + +S  +   +  P  L 
Sbjct: 654 NKIGSEGR------------------NISCSMDDYKGINASTVTLSYNE--IQKFPTELF 693

Query: 430 NHMELKENGVFSNLISLHMQN-------TAAVMSNVSQLKYLKNIKYLNCSNDIDHRKSQ 482
                      S + ++ + N         ++       K    +  ++           
Sbjct: 694 ATG--------SPISTIILSNNLMTSIPENSLKPKDGNYKNTYLLTTIDLRF-------- 737

Query: 483 DFVNVLWELPLSILY--LSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVY----- 535
              N L  L        L  +  + +S    +  P    N   L+   I H +       
Sbjct: 738 ---NKLTSLSDDFRATTLPYLSNMDVSYNCFSSFPTQPLNSSQLKAFGIRHQRDAEGNRI 794

Query: 536 --KLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFY 574
             + P       SL  L +  N +  + +   +   L    
Sbjct: 795 LRQWPTGITTCPSLIQLQIGSNDIRKVDEK--LTPQLYILD 833


>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query594
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.31
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.1
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.62
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.45
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.32
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.84
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.66
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.64
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.51
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.5
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 94.58
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
Probab=100.00  E-value=3.5e-40  Score=367.68  Aligned_cols=420  Identities=17%  Similarity=0.166  Sum_probs=266.1

Q ss_pred             cchhhhccCccEEecCCCCCcccChhh---hccCcEEEccCccccccccccccCCCCCccccCCCCcccc----------
Q psy6452         143 DENTVKTEALSTRTFCDHELQSIEDDI---LVQLECLHIDNNKAQEYIVSMNVDRTPGFKLQNNDNDQNT----------  209 (594)
Q Consensus       143 ~~~~~~~~~L~~l~l~~n~l~~ip~~~---l~~L~~L~Ls~N~i~~~~~~~~~~~l~~l~~~~~~~~~~~----------  209 (594)
                      +....+..+|+++++++|.++.+++..   +++|++|+|++|+++++.+. .+.+++.++...+......          
T Consensus        50 ~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-~~~~l~~L~~L~L~~n~i~~l~~~~~~~l  128 (606)
T 3t6q_A           50 NTTFSRLINLTFLDLTRCQIYWIHEDTFQSQHRLDTLVLTANPLIFMAET-ALSGPKALKHLFFIQTGISSIDFIPLHNQ  128 (606)
T ss_dssp             TTTSTTCTTCSEEECTTCCCCEECTTTTTTCTTCCEEECTTCCCSEECTT-TTSSCTTCCEEECTTSCCSCGGGSCCTTC
T ss_pred             hhHhccCccceEEECCCCccceeChhhccCccccCeeeCCCCcccccChh-hhcccccccEeeccccCcccCCcchhccC
Confidence            445556678889999999998886554   77899999999999877643 3444444443333322222          


Q ss_pred             cccccccccccccccccccCccCCCcccEEEccCCCCcccchHhhhcCCCCC--EEECCCCCCCCccccchhhhhc----
Q psy6452         210 KVTNAMDIAMELIDTELNCCNKQYHDIFTVNLSHQDINFVQESMSQKLTNLT--VLDLSHNNHQDINFVQESMSQK----  283 (594)
Q Consensus       210 ~~~~~~~l~~n~~~~~~~~~~~~l~~L~~L~Ls~n~l~~l~~~~f~~l~~L~--~L~Ls~N~l~~i~~l~~~~~~~----  283 (594)
                      .-...++++.|.+.......+..+++|++|++++|.++.+++..|..+++|+  .|++++|.+++   +++..|..    
T Consensus       129 ~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~l~L~l~~n~l~~---~~~~~~~~~~L~  205 (606)
T 3t6q_A          129 KTLESLYLGSNHISSIKLPKGFPTEKLKVLDFQNNAIHYLSKEDMSSLQQATNLSLNLNGNDIAG---IEPGAFDSAVFQ  205 (606)
T ss_dssp             TTCCEEECCSSCCCCCCCCTTCCCTTCCEEECCSSCCCEECHHHHHTTTTCCSEEEECTTCCCCE---ECTTTTTTCEEE
T ss_pred             CcccEEECCCCcccccCcccccCCcccCEEEcccCcccccChhhhhhhcccceeEEecCCCccCc---cChhHhhhcccc
Confidence            2244556666666654334444478888888888888888777788888888  78888887654   22222211    


Q ss_pred             ---------------------------------------------CC--CCCEEEcCCCCCCCCCC--cCCCcCccEEec
Q psy6452         284 ---------------------------------------------LT--NLIVLDLSHNKLSELPD--FLNFKVLKELDI  314 (594)
Q Consensus       284 ---------------------------------------------l~--~L~~L~Ls~N~l~~lp~--~~~l~~L~~L~L  314 (594)
                                                                   +.  +|+.|++++|.++.++.  |..+++|++|++
T Consensus       206 ~L~l~~~~~~~~~~~~l~~~~l~~l~~~~~~~~~~~~i~~~~~~~l~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l  285 (606)
T 3t6q_A          206 SLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINLQKHYFFNISSNTFHCFSGLQELDL  285 (606)
T ss_dssp             EEECTTCSCHHHHHHHTTTCEEEEEECCCCTTSCCCCCCGGGGGGGGGSEEEEEECTTCCCSSCCTTTTTTCTTCSEEEC
T ss_pred             ccccCCchhHHHHhhhccccchhheechhhccccccccChhHhchhhcCceeEEEeecCccCccCHHHhccccCCCEEec
Confidence                                                         11  56667777777776653  667777777777


Q ss_pred             cCCccccCchhhhhccccccCCCcceEEcCCCCCCCCChhhhccCCCCcEEECCCCCCCC-CCCc--cccCCccEEeCCC
Q psy6452         315 SHNNFESMPLCLQVHFYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKI-LHKP--RCTHTLQTFSMNH  391 (594)
Q Consensus       315 s~N~l~~lp~~~~~~~~~~~~~~L~~L~Ls~N~l~~i~~~~~~~l~~L~~L~Ls~N~l~~-l~~~--~~~~~L~~L~L~~  391 (594)
                      ++|.++.+|..+..      .++|++|++++|.++.+++..+.++++|++|++++|.+.+ ++..  ...++|++|++++
T Consensus       286 ~~n~l~~lp~~l~~------l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~  359 (606)
T 3t6q_A          286 TATHLSELPSGLVG------LSTLKKLVLSANKFENLCQISASNFPSLTHLSIKGNTKRLELGTGCLENLENLRELDLSH  359 (606)
T ss_dssp             TTSCCSCCCSSCCS------CTTCCEEECTTCCCSBGGGGCGGGCTTCSEEECCSCSSCCBCCSSTTTTCTTCCEEECCS
T ss_pred             cCCccCCCChhhcc------cccCCEEECccCCcCcCchhhhhccCcCCEEECCCCCcccccchhhhhccCcCCEEECCC
Confidence            77777777765432      2567777777777777766666677777777777777663 3322  2335677777777


Q ss_pred             CCCCCCCc-hhhhcccCcccEEECcCCCCccCCccHHHhhhcccccccccCCCcEEEcCCccccccCcc-ccccCCCcce
Q psy6452         392 NIGMKIPE-WFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVS-QLKYLKNIKY  469 (594)
Q Consensus       392 N~~~~ip~-~~~~~~~~~L~~L~Ls~n~~~~~~lp~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~-~~~~l~~L~~  469 (594)
                      |.+..++. ...+..+++|+.|++++|. +.+..|.         .+..+++|+.|++++|.+++..+. .+..+++|++
T Consensus       360 n~l~~~~~~~~~~~~l~~L~~L~l~~n~-l~~~~~~---------~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~  429 (606)
T 3t6q_A          360 DDIETSDCCNLQLRNLSHLQSLNLSYNE-PLSLKTE---------AFKECPQLELLDLAFTRLKVKDAQSPFQNLHLLKV  429 (606)
T ss_dssp             SCCCEEEESTTTTTTCTTCCEEECCSCS-CEEECTT---------TTTTCTTCSEEECTTCCEECCTTCCTTTTCTTCCE
T ss_pred             CccccccCcchhcccCCCCCEEECCCCc-CCcCCHH---------HhcCCccCCeEECCCCcCCCcccchhhhCcccCCE
Confidence            76665531 1113567777777777764 2222222         234455667777777766655443 3666667777


Q ss_pred             EeCCCCcCcccccccccccccCcccccCCCCCcEEeCccccCcc--cc--ccccCCCCCcEEEccCCCCccc-CccccCC
Q psy6452         470 LNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNC--IP--EDIGNLICLEKLNISHNKVYKL-PESFANL  544 (594)
Q Consensus       470 L~Ls~n~~~~~~~~~~n~~~~ip~~~~~l~~L~~L~Ls~N~l~~--ip--~~~~~l~~L~~L~Ls~N~l~~l-p~~~~~l  544 (594)
                      |++++|          ...+..|..+..+++|++|++++|.++.  ++  ..+..+++|++|+|++|+++.+ |..|..+
T Consensus       430 L~l~~n----------~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l  499 (606)
T 3t6q_A          430 LNLSHS----------LLDISSEQLFDGLPALQHLNLQGNHFPKGNIQKTNSLQTLGRLEILVLSFCDLSSIDQHAFTSL  499 (606)
T ss_dssp             EECTTC----------CCBTTCTTTTTTCTTCCEEECTTCBCGGGEECSSCGGGGCTTCCEEECTTSCCCEECTTTTTTC
T ss_pred             EECCCC----------ccCCcCHHHHhCCCCCCEEECCCCCCCccccccchhhccCCCccEEECCCCccCccChhhhccc
Confidence            777665          3333445556666777777777777663  22  3466677777777777777765 4466777


Q ss_pred             CCCCEEECcCCCCCc-cCcccccCCCCcEEEccCCCCcccCHhHHhhhhC
Q psy6452         545 KSLKILDVSYNKLTM-LPDGFVMLSNLTTFYAQRKYWMFLTISLLCYLMG  593 (594)
Q Consensus       545 ~~L~~L~Ls~N~l~~-ip~~l~~l~~L~~L~L~~N~l~~l~~~~~~~l~~  593 (594)
                      ++|++|+|++|+++. .|..+..+++| +|++++|+++.+++..|..+.+
T Consensus       500 ~~L~~L~Ls~N~l~~~~~~~l~~l~~L-~L~L~~N~l~~~~~~~~~~l~~  548 (606)
T 3t6q_A          500 KMMNHVDLSHNRLTSSSIEALSHLKGI-YLNLASNHISIILPSLLPILSQ  548 (606)
T ss_dssp             TTCCEEECCSSCCCGGGGGGGTTCCSC-EEECCSSCCCCCCGGGHHHHHT
T ss_pred             cCCCEEECCCCccCcCChhHhCccccc-EEECcCCcccccCHhhcccCCC
Confidence            777777777777764 34556677777 7777777777777666665544



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 594
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-17
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 8e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 86.6 bits (213), Expect = 6e-19
 Identities = 59/363 (16%), Positives = 118/363 (32%), Gaps = 35/363 (9%)

Query: 239 VNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLS 298
           +       N         L  +T L       + I+ V+      L NL  ++ S+N+L+
Sbjct: 25  MKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVE-----YLNNLTQINFSNNQLT 79

Query: 299 ELPDFLNFKVLKELDISHNNFE--------------SMPLCLQVHFYVHIPYKHSQSDIS 344
           ++    N   L ++ +++N                 ++               +      
Sbjct: 80  DITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLEL 139

Query: 345 HNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRCTHTLQTFSMNHNIGMKIPEWFWYQ 404
            +N  S    L            +            T      S N    + +       
Sbjct: 140 SSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNL 199

Query: 405 EFLCLKELNMSSTDP--FFEHLPIWLLNHMELKENGVFSNLISLH-MQNTAAVMSNVSQL 461
           E L      +S   P     +L    LN  +LK+ G  ++L +L  +      +SN++ L
Sbjct: 200 ESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPL 259

Query: 462 KYLKNIKYLNCSND----------IDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQL 511
             L  +  L    +          +    + +      E    I  L ++  L L    +
Sbjct: 260 SGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNI 319

Query: 512 NCIPEDIGNLICLEKLNISHNKVYKLPESFANLKSLKILDVSYNKLTMLPDGFVMLSNLT 571
           + I   + +L  L++L  ++NKV  +  S ANL ++  L   +N+++ L      L+ +T
Sbjct: 320 SDISP-VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP-LANLTRIT 376

Query: 572 TFY 574
              
Sbjct: 377 QLG 379


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query594
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.88
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.6
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.49
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.04
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.07
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.97  E-value=8.9e-29  Score=256.59  Aligned_cols=341  Identities=20%  Similarity=0.256  Sum_probs=261.8

Q ss_pred             ecCCCCCcc-cChhhhccCcEEEccCccccccccccccCCCCCccccCCCCcccccccccccccccccccccccCccCCC
Q psy6452         156 TFCDHELQS-IEDDILVQLECLHIDNNKAQEYIVSMNVDRTPGFKLQNNDNDQNTKVTNAMDIAMELIDTELNCCNKQYH  234 (594)
Q Consensus       156 ~l~~n~l~~-ip~~~l~~L~~L~Ls~N~i~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~l~~n~~~~~~~~~~~~l~  234 (594)
                      .+..+.++. +....+.+|++|++++|.|+.+.         ++                                ..++
T Consensus        28 ~l~~~~~~~~~~~~~l~~l~~L~l~~~~I~~l~---------gl--------------------------------~~L~   66 (384)
T d2omza2          28 VLGKTNVTDTVSQTDLDQVTTLQADRLGIKSID---------GV--------------------------------EYLN   66 (384)
T ss_dssp             HTTCSSTTSEECHHHHTTCCEEECCSSCCCCCT---------TG--------------------------------GGCT
T ss_pred             HhCCCCCCCccCHHHhCCCCEEECCCCCCCCcc---------cc--------------------------------ccCC
Confidence            344445544 44444888999999999888653         21                                2367


Q ss_pred             cccEEEccCCCCcccchHhhhcCCCCCEEECCCCCCCCccccchhhhhcCCCCCEEEcCCCCCCCCCCcCCCcCccEEec
Q psy6452         235 DIFTVNLSHQDINFVQESMSQKLTNLTVLDLSHNNHQDINFVQESMSQKLTNLIVLDLSHNKLSELPDFLNFKVLKELDI  314 (594)
Q Consensus       235 ~L~~L~Ls~n~l~~l~~~~f~~l~~L~~L~Ls~N~l~~i~~l~~~~~~~l~~L~~L~Ls~N~l~~lp~~~~l~~L~~L~L  314 (594)
                      +|++|+|++|+|+.+++  ++++++|++|++++|+++++   ++  ++.+++|+.|++++|.++.++.......+..+..
T Consensus        67 nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n~i~~i---~~--l~~l~~L~~L~~~~~~~~~~~~~~~~~~~~~~~~  139 (384)
T d2omza2          67 NLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQIADI---TP--LANLTNLTGLTLFNNQITDIDPLKNLTNLNRLEL  139 (384)
T ss_dssp             TCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCC---GG--GTTCTTCCEEECCSSCCCCCGGGTTCTTCSEEEE
T ss_pred             CCCEEeCcCCcCCCCcc--ccCCcccccccccccccccc---cc--cccccccccccccccccccccccccccccccccc
Confidence            89999999999999886  78999999999999997664   22  5688999999999999988877777777788887


Q ss_pred             cCCccccCchhhhhc--------------cccccCCCcceEEcCCCCCCCCChhhhccCCCCcEEECCCCCCCCCCCccc
Q psy6452         315 SHNNFESMPLCLQVH--------------FYVHIPYKHSQSDISHNNFESMPLCLQVHFCKLVKLDISHNQIKILHKPRC  380 (594)
Q Consensus       315 s~N~l~~lp~~~~~~--------------~~~~~~~~L~~L~Ls~N~l~~i~~~~~~~l~~L~~L~Ls~N~l~~l~~~~~  380 (594)
                      ..|.+..+.......              ................|.....  ..+..+++++.+++++|.++++.+...
T Consensus       140 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~l~~~~~l~l~~n~i~~~~~~~~  217 (384)
T d2omza2         140 SSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI--SVLAKLTNLESLIATNNQISDITPLGI  217 (384)
T ss_dssp             EEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCSSCCCCCGGGGG
T ss_pred             ccccccccccccccccccccccccccchhhhhccccccccccccccccccc--cccccccccceeeccCCccCCCCcccc
Confidence            777766543211100              0011112333444444444432  234588999999999999999887777


Q ss_pred             cCCccEEeCCCCCCCCCCchhhhcccCcccEEECcCCCCccCCccHHHhhhcccccccccCCCcEEEcCCccccccCccc
Q psy6452         381 THTLQTFSMNHNIGMKIPEWFWYQEFLCLKELNMSSTDPFFEHLPIWLLNHMELKENGVFSNLISLHMQNTAAVMSNVSQ  460 (594)
Q Consensus       381 ~~~L~~L~L~~N~~~~ip~~~~~~~~~~L~~L~Ls~n~~~~~~lp~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~  460 (594)
                      .++|+.|++++|.+..++.   +..+++|+.+++++|. +.+ +          ..+..+++|+.|+++++.+++..  .
T Consensus       218 ~~~L~~L~l~~n~l~~~~~---l~~l~~L~~L~l~~n~-l~~-~----------~~~~~~~~L~~L~l~~~~l~~~~--~  280 (384)
T d2omza2         218 LTNLDELSLNGNQLKDIGT---LASLTNLTDLDLANNQ-ISN-L----------APLSGLTKLTELKLGANQISNIS--P  280 (384)
T ss_dssp             CTTCCEEECCSSCCCCCGG---GGGCTTCSEEECCSSC-CCC-C----------GGGTTCTTCSEEECCSSCCCCCG--G
T ss_pred             cCCCCEEECCCCCCCCcch---hhcccccchhccccCc-cCC-C----------CcccccccCCEeeccCcccCCCC--c
Confidence            8899999999999888864   4688999999999974 222 2          23456789999999999998654  4


Q ss_pred             cccCCCcceEeCCCCcCcccccccccccccCcccccCCCCCcEEeCccccCccccccccCCCCCcEEEccCCCCcccCcc
Q psy6452         461 LKYLKNIKYLNCSNDIDHRKSQDFVNVLWELPLSILYLSSIQELHLSNVQLNCIPEDIGNLICLEKLNISHNKVYKLPES  540 (594)
Q Consensus       461 ~~~l~~L~~L~Ls~n~~~~~~~~~~n~~~~ip~~~~~l~~L~~L~Ls~N~l~~ip~~~~~l~~L~~L~Ls~N~l~~lp~~  540 (594)
                      +..+..++.++++.|           .+..++ .+..+++++.|++++|+|+.++. +..+++|++|++++|+|+.++ .
T Consensus       281 ~~~~~~l~~l~~~~n-----------~l~~~~-~~~~~~~l~~L~ls~n~l~~l~~-l~~l~~L~~L~L~~n~l~~l~-~  346 (384)
T d2omza2         281 LAGLTALTNLELNEN-----------QLEDIS-PISNLKNLTYLTLYFNNISDISP-VSSLTKLQRLFFANNKVSDVS-S  346 (384)
T ss_dssp             GTTCTTCSEEECCSS-----------CCSCCG-GGGGCTTCSEEECCSSCCSCCGG-GGGCTTCCEEECCSSCCCCCG-G
T ss_pred             ccccccccccccccc-----------cccccc-ccchhcccCeEECCCCCCCCCcc-cccCCCCCEEECCCCCCCCCh-h
Confidence            778899999999986           233333 46778999999999999998864 889999999999999999987 5


Q ss_pred             ccCCCCCCEEECcCCCCCccCcccccCCCCcEEEccCC
Q psy6452         541 FANLKSLKILDVSYNKLTMLPDGFVMLSNLTTFYAQRK  578 (594)
Q Consensus       541 ~~~l~~L~~L~Ls~N~l~~ip~~l~~l~~L~~L~L~~N  578 (594)
                      +..+++|++|++++|+|+.++. +.++++|++|+|++|
T Consensus       347 l~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         347 LANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             GGGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEECCCE
T ss_pred             HcCCCCCCEEECCCCcCCCChh-hccCCCCCEeeCCCC
Confidence            8999999999999999998865 889999999999998



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure