Psyllid ID: psy6601

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
GCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSVFMLGSKVEISLHKAEVGSWSKLDIPSLTIANHGDEKDKEDTSTNEVQHALDTAEKGQVKCRLDWFQTGSTVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKAGPAAIKNGCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLHYTHYLLFLYFGQSRSFLVAKI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccEEccccccccccccccccccccccccEEcccccccccHHHHHccccccccccccEEccccccccccEEEcccEEEEEcccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccEEEEEEEEEcccccccEEEEcccEEEEEEEccccccccccEEccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccEEEcccccccccHHHHccccccccEEEcccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccEEcccccccEEcccccccccccccccccEEccccccccccccccccHHHHHcccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccHcccccccHHHHHHHcccccccccccccccccccEEEEEEEEccccccccEEEEcccEEEEEEEEcccccEEccccEEEEEEccccccEccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEc
gctvsshnpvkppeperyvpdkqsVQEVIEvrapepkamerpskdtpmvelkptISQNLLEQvknlkplshldrgdlsssiplgtkcknnackqsyegpeslsTICVhhagvpvfheglkfwscctkKTTEFSAFLEqegcthgqhvwFKKTIVNVDKSSVFMLGSKVEISLhkaevgswskldipsltianhgdekdkedtstnEVQHALDTAEKgqvkcrldwfqtgSTVVVSIFgkkydplrskvllspvrlkvdlyfpeedgnyqqDIELRGMLAHTIQEILCSMmhtkagpaaikngctvsshnpvkppeperyvpdkqsVQEVIEvrapepkamerpskdtpmvelkptISQNLLEQvknlkplshldrgdlsssiplgtkcknnackqsyegpeslsTICVhhagvpvfheglkfwscctkkttefSAFLHYTHYLLFLYFGQSRSFLVAKI
gctvsshnpvkppeperyvpdkqsvQEVIEvrapepkamerpskdtpmveLKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSVFMLGSKVEISLHkaevgswskldipSLTIanhgdekdkedtSTNEVQHALDTAEKGQVKCRLDWFQTGSTVVvsifgkkydplrskvllspvrLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKAGPAAIKNGCTVSSHNPvkppeperyvpdkQSVQEVIEvrapepkamerpskdtpmveLKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLHYTHYLLFLYFGQSRSFLVAKI
GCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSVFMLGSKVEISLHKAEVGSWSKLDIPSLTIANHGDEKDKEDTSTNEVQHALDTAEKGQVKCRLDWFQTGSTVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKAGPAAIKNGCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAflhythyllflyfGQSRSFLVAKI
***************************************************************************************************ESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSVFMLGSKVEISLHKAEVGSWSKLDIPSLTI**************************GQVKCRLDWFQTGSTVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKAGPAAIKNGC*************************************************************************************************ESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLHYTHYLLFLYFGQSRSFLV***
GCTVSSHNP***************************************************************************TKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSVFMLGSKVEISLHKAEVGSWSKLDIPSLTIANHGDEKDKEDTST***************KCRLDWFQTGSTVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKAGPAAIKNGCT*********************************************************************************TKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLHYTHYLLFLYFGQSRSFLVAKI
***************ERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSVFMLGSKVEISLHKAEVGSWSKLDIPSLTIANHG*************QHALDTAEKGQVKCRLDWFQTGSTVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKAGPAAIKNGCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLHYTHYLLFLYFGQSRSFLVAKI
*************************************************E*****************************SIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQ********************SKVEISLHKA******************************E*Q*******KGQVKCRLDWFQTGSTVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKAGPAAIKNGCTV***************************************************************************SIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLHYTHYLLFLYFGQSRSFLVAKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSVFMLGSKVEISLHKAEVGSWSKLDIPSLTIANHGDEKDKEDTSTNEVQHALDTAEKGQVKCRLDWFQTGSTVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKAGPAAIKNGCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLHYTHYLLFLYFGQSRSFLVAKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query459 2.2.26 [Sep-21-2011]
Q9VCC0354 Cysteine and histidine-ri yes N/A 0.466 0.604 0.354 3e-40
A9YUB1332 Cysteine and histidine-ri yes N/A 0.498 0.689 0.323 2e-36
Q29RL2332 Cysteine and histidine-ri yes N/A 0.470 0.650 0.329 3e-36
D4A4T9331 Cysteine and histidine-ri yes N/A 0.468 0.649 0.335 2e-35
Q9D1P4331 Cysteine and histidine-ri yes N/A 0.470 0.652 0.329 2e-35
Q4R7U2332 Cysteine and histidine-ri N/A N/A 0.496 0.686 0.325 5e-35
Q9UHD1332 Cysteine and histidine-ri no N/A 0.470 0.650 0.323 6e-35
Q5RD91332 Cysteine and histidine-ri yes N/A 0.470 0.650 0.323 4e-34
Q5ZML4331 Cysteine and histidine-ri yes N/A 0.466 0.646 0.320 2e-32
Q6NUA0334 Cysteine and histidine-ri N/A N/A 0.403 0.553 0.329 1e-31
>sp|Q9VCC0|CHRD1_DROME Cysteine and histidine-rich domain-containing protein OS=Drosophila melanogaster GN=CHORD PE=1 SV=1 Back     alignment and function desciption
 Score =  166 bits (420), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 141/279 (50%), Gaps = 65/279 (23%)

Query: 1   GCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLL 60
           GCT++ H+ VKPPEPE+ V D+    EVIEVRAP  +A+ RP  D+P+  ++PT++  L 
Sbjct: 57  GCTLAKHSNVKPPEPEKPVKDESDKDEVIEVRAPIREALPRPPIDSPLTVIQPTVAPALK 116

Query: 61  EQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLK 120
           + V  +K  +     D   +I +GT CKNN C  S+ G  S    C +H GVP+FHEG+K
Sbjct: 117 DMVFAVKTPAAQKSSD---AIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMK 173

Query: 121 FWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSVFMLGSKVEISLHKAEVGSW 180
           FWSCC K+T++F                           S FM         HK     W
Sbjct: 174 FWSCCQKRTSDF---------------------------SQFMAQKGCTYGEHK-----W 201

Query: 181 SKLDIPSLTIANHGDEKDKEDTSTNEVQHALDTAEKGQVKCRLDWFQTGSTVVVSIFGKK 240
            K                             +  +K  V+CR DW QT + VV++I+ KK
Sbjct: 202 VK-----------------------------ENDDKKVVQCRYDWHQTATNVVMAIYAKK 232

Query: 241 YDPLRSKVLLSPVRLKVDLYFPEED-GNYQQDIELRGML 278
           YD  +S + L+P+RL V+L FPE+D   +  D+ELRG++
Sbjct: 233 YDYSQSVIELNPIRLHVNLVFPEQDNARFDLDLELRGIV 271
Regulates centrosome duplication.
Drosophila melanogaster (taxid: 7227)
>sp|A9YUB1|CHRD1_PIG Cysteine and histidine-rich domain-containing protein 1 OS=Sus scrofa GN=CHORDC1 PE=2 SV=1 Back     alignment and function description
>sp|Q29RL2|CHRD1_BOVIN Cysteine and histidine-rich domain-containing protein 1 OS=Bos taurus GN=CHORDC1 PE=2 SV=1 Back     alignment and function description
>sp|D4A4T9|CHRD1_RAT Cysteine and histidine-rich domain-containing protein 1 OS=Rattus norvegicus GN=Chordc1 PE=3 SV=1 Back     alignment and function description
>sp|Q9D1P4|CHRD1_MOUSE Cysteine and histidine-rich domain-containing protein 1 OS=Mus musculus GN=Chordc1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R7U2|CHRD1_MACFA Cysteine and histidine-rich domain-containing protein 1 OS=Macaca fascicularis GN=CHORDC1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UHD1|CHRD1_HUMAN Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens GN=CHORDC1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RD91|CHRD1_PONAB Cysteine and histidine-rich domain-containing protein 1 OS=Pongo abelii GN=CHORDC1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZML4|CHRD1_CHICK Cysteine and histidine-rich domain-containing protein 1 OS=Gallus gallus GN=CHORDC1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NUA0|CHRD1_XENLA Cysteine and histidine-rich domain-containing protein 1 OS=Xenopus laevis GN=chordc1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
66507739341 PREDICTED: cysteine and histidine-rich d 0.494 0.665 0.392 7e-48
307199859339 Cysteine and histidine-rich domain-conta 0.494 0.669 0.390 7e-48
380020848341 PREDICTED: cysteine and histidine-rich d 0.494 0.665 0.392 2e-47
332375727340 unknown [Dendroctonus ponderosae] 0.501 0.676 0.352 1e-43
332024062340 Cysteine and histidine-rich domain-conta 0.496 0.670 0.367 6e-42
110774352233 PREDICTED: cysteine and histidine-rich d 0.422 0.832 0.391 1e-40
383865839340 PREDICTED: cysteine and histidine-rich d 0.496 0.670 0.363 2e-40
328714834349 PREDICTED: cysteine and histidine-rich d 0.333 0.438 0.512 2e-40
91077034336 PREDICTED: similar to CHORD CG6198-PA [T 0.337 0.461 0.509 3e-39
195444282366 GK11385 [Drosophila willistoni] gi|19416 0.472 0.592 0.354 1e-38
>gi|66507739|ref|XP_395533.2| PREDICTED: cysteine and histidine-rich domain-containing protein [Apis mellifera] Back     alignment and taxonomy information
 Score =  197 bits (502), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 157/298 (52%), Gaps = 71/298 (23%)

Query: 1   GCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAP----EPKAMERPSKDTPMVELKPTIS 56
           GC  S H+ +KP EPE+ + DK    E+IEV A     EP  +ERP  DTP + L P +S
Sbjct: 63  GCAKSCHSNIKPIEPEKPIIDKSKSNEIIEVIAQPLINEP-ILERPPFDTPQMTLTPNVS 121

Query: 57  QNLLEQVKNLKPLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFH 116
            NLLEQ+K L  +S++ +    + I +G  CKNN+CK +Y GP S + IC HH G P+FH
Sbjct: 122 PNLLEQIKGL--ISNVSKSTFDTKIQIGQSCKNNSCKATYNGPASENEICNHHPGTPIFH 179

Query: 117 EGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSVFMLGSKVEISLHKAE 176
           EG+K+WSCC KKTT+FS FLEQ GCT G+H+W  K   N DK        KV+  +   +
Sbjct: 180 EGMKYWSCCQKKTTDFSTFLEQPGCTQGKHIWISK---NTDK--------KVKCRMDWHQ 228

Query: 177 VGSWSKLDIPSLTIANHGDEKDKEDTSTNEVQHALDTAEKGQVKCRLDWFQTGSTVVVSI 236
            GS+                                                   VVVSI
Sbjct: 229 TGSF---------------------------------------------------VVVSI 237

Query: 237 FGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKA 294
           + KKY P +S + L+P+RL VDL+F EE+  Y  DIELRG++  T   +  +M+ TK 
Sbjct: 238 YAKKYQPDQSFIKLNPIRLSVDLFFIEENSRYNLDIELRGIVDVTQSSV--NMLPTKV 293

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307199859|gb|EFN80256.1| Cysteine and histidine-rich domain-containing protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380020848|ref|XP_003694289.1| PREDICTED: cysteine and histidine-rich domain-containing protein-like [Apis florea] Back     alignment and taxonomy information
>gi|332375727|gb|AEE63004.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|332024062|gb|EGI64279.1| Cysteine and histidine-rich domain-containing protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|110774352|ref|XP_001123035.1| PREDICTED: cysteine and histidine-rich domain-containing protein-like, partial [Apis mellifera] Back     alignment and taxonomy information
>gi|383865839|ref|XP_003708380.1| PREDICTED: cysteine and histidine-rich domain-containing protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328714834|ref|XP_001946683.2| PREDICTED: cysteine and histidine-rich domain-containing protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91077034|ref|XP_967567.1| PREDICTED: similar to CHORD CG6198-PA [Tribolium castaneum] gi|270001750|gb|EEZ98197.1| hypothetical protein TcasGA2_TC000627 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195444282|ref|XP_002069796.1| GK11385 [Drosophila willistoni] gi|194165881|gb|EDW80782.1| GK11385 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
FB|FBgn0029503354 CHORD "CHORD" [Drosophila mela 0.335 0.435 0.469 1.1e-52
UNIPROTKB|Q29RL2332 CHORDC1 "Cysteine and histidin 0.328 0.454 0.445 6.7e-45
UNIPROTKB|A9YUB1332 CHORDC1 "Cysteine and histidin 0.328 0.454 0.445 1.4e-44
UNIPROTKB|F1STP1266 CHORDC1 "Cysteine and histidin 0.328 0.567 0.445 5.9e-42
UNIPROTKB|Q4R7U2332 CHORDC1 "Cysteine and histidin 0.413 0.572 0.4 1.7e-34
RGD|1304679331 Chordc1 "cysteine and histidin 0.413 0.574 0.404 5.1e-35
MGI|MGI:1914167331 Chordc1 "cysteine and histidin 0.416 0.577 0.397 5.1e-35
UNIPROTKB|E2RQW2330 CHORDC1 "Uncharacterized prote 0.328 0.457 0.439 9.6e-44
UNIPROTKB|Q6NUA0334 chordc1 "Cysteine and histidin 0.326 0.449 0.426 1.2e-41
UNIPROTKB|Q9UHD1332 CHORDC1 "Cysteine and histidin 0.413 0.572 0.4 2.2e-34
FB|FBgn0029503 CHORD "CHORD" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 398 (145.2 bits), Expect = 1.1e-52, Sum P(2) = 1.1e-52
 Identities = 76/162 (46%), Positives = 106/162 (65%)

Query:     1 GCTVSSHNPVKPPEPERYVPDKQSVQEVIEVRAPEPKAMERPSKDTPMVELKPTISQNLL 60
             GCT++ H+ VKPPEPE+ V D+    EVIEVRAP  +A+ RP  D+P+  ++PT++  L 
Sbjct:    57 GCTLAKHSNVKPPEPEKPVKDESDKDEVIEVRAPIREALPRPPIDSPLTVIQPTVAPALK 116

Query:    61 EQVKNLK-PLSHLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGL 119
             + V  +K P +       S +I +GT CKNN C  S+ G  S    C +H GVP+FHEG+
Sbjct:   117 DMVFAVKTPAAQKS----SDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGM 172

Query:   120 KFWSCCTKKTTEFSAFLEQEGCTHGQHVWFKKTIVNVDKSSV 161
             KFWSCC K+T++FS F+ Q+GCT+G+H W K+   N DK  V
Sbjct:   173 KFWSCCQKRTSDFSQFMAQKGCTYGEHKWVKE---NDDKKVV 211
GO:0008270 "zinc ion binding" evidence=ISS
GO:0051298 "centrosome duplication" evidence=IMP
UNIPROTKB|Q29RL2 CHORDC1 "Cysteine and histidine-rich domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A9YUB1 CHORDC1 "Cysteine and histidine-rich domain-containing protein 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1STP1 CHORDC1 "Cysteine and histidine-rich domain-containing protein 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7U2 CHORDC1 "Cysteine and histidine-rich domain-containing protein 1" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
RGD|1304679 Chordc1 "cysteine and histidine-rich domain (CHORD)-containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1914167 Chordc1 "cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQW2 CHORDC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NUA0 chordc1 "Cysteine and histidine-rich domain-containing protein 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UHD1 CHORDC1 "Cysteine and histidine-rich domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
pfam0496865 pfam04968, CHORD, CHORD 1e-29
pfam0496865 pfam04968, CHORD, CHORD 6e-24
cd0648887 cd06488, p23_melusin_like, p23_like domain similar 1e-17
cd0648887 cd06488, p23_melusin_like, p23_like domain similar 3e-10
cd0646684 cd06466, p23_CS_SGT1_like, p23_like domain similar 1e-09
cd0646684 cd06466, p23_CS_SGT1_like, p23_like domain similar 1e-06
cd0648984 cd06489, p23_CS_hSgt1_like, p23_like domain simila 0.001
pfam0496978 pfam04969, CS, CS domain 0.003
cd0646384 cd06463, p23_like, Proteins containing this p23_li 0.003
>gnl|CDD|203134 pfam04968, CHORD, CHORD Back     alignment and domain information 
 Score =  109 bits (275), Expect = 1e-29
 Identities = 36/63 (57%), Positives = 46/63 (73%)

Query: 84  GTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTH 143
           GTKCKN  C ++Y+GPE+    CV+H GVPVFHEG+K WSCC K+  +F  FL+  GCT 
Sbjct: 2   GTKCKNKGCGKTYKGPENDEEACVYHPGVPVFHEGMKGWSCCKKRVLDFDEFLKIPGCTT 61

Query: 144 GQH 146
           G+H
Sbjct: 62  GKH 64

CHORD represents a Zn binding domain. Silencing of the C. elegans CHORD-containing gene results in semisterility and embryo lethality, suggesting an essential function of the wild-type gene in nematode development. Length = 65
>gnl|CDD|203134 pfam04968, CHORD, CHORD Back     alignment and domain information
>gnl|CDD|107238 cd06488, p23_melusin_like, p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>gnl|CDD|107238 cd06488, p23_melusin_like, p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>gnl|CDD|107223 cd06466, p23_CS_SGT1_like, p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>gnl|CDD|107223 cd06466, p23_CS_SGT1_like, p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>gnl|CDD|107239 cd06489, p23_CS_hSgt1_like, p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>gnl|CDD|218355 pfam04969, CS, CS domain Back     alignment and domain information
>gnl|CDD|107220 cd06463, p23_like, Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 459
KOG1667|consensus320 100.0
KOG1667|consensus 320 100.0
PF0496864 CHORD: CHORD ; InterPro: IPR007051 Cysteine- and h 99.98
PF0496864 CHORD: CHORD ; InterPro: IPR007051 Cysteine- and h 99.96
cd0648887 p23_melusin_like p23_like domain similar to the C- 99.84
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 99.7
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.66
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 99.64
KOG1309|consensus196 99.53
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 99.48
cd0646892 p23_CacyBP p23_like domain found in proteins simil 99.47
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 99.45
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 99.41
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.21
cd0646384 p23_like Proteins containing this p23_like domain 99.16
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 99.07
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 98.94
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 98.81
cd0029880 ACD_sHsps_p23-like This domain family includes the 98.55
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 98.3
COG5091368 SGT1 Suppressor of G2 allele of skp1 and related p 97.06
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 96.67
KOG3158|consensus180 95.64
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 94.89
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 94.66
smart0010736 BTK Bruton's tyrosine kinase Cys-rich motif. Zinc- 93.03
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 92.29
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 92.14
COG0071146 IbpA Molecular chaperone (small heat shock protein 91.77
KOG3260|consensus224 90.7
PF0077932 BTK: BTK motif; InterPro: IPR001562 The Btk-type z 89.81
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 89.75
>KOG1667|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.3e-75  Score=561.11  Aligned_cols=237  Identities=37%  Similarity=0.659  Sum_probs=216.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCc----CccceeecCCCCccccCCCCCCC-Ccc-----ccCcccChhHHHHHHhcCCCC
Q psy6601           1 GCTVSSHNPVKPPEPERYVPDKQ----SVQEVIEVRAPEPKAMERPSKDT-PMV-----ELKPTISQNLLEQVKNLKPLS   70 (459)
Q Consensus         1 GCT~~~H~~~KP~ep~k~~p~~~----~~~e~i~~~~~~~~~~~rPs~d~-p~~-----~l~~~vs~~l~~~~~~l~ls~   70 (459)
                      |||+|+|||||||||++  |+++    +.+|+++++++..++..|+++|. |+.     .+.|+||++|+++|++.+.  
T Consensus        57 GCT~gkHsneKppe~~k--p~~~et~~ekkel~~v~~~~~e~~~~~pkd~~~ik~~~~~~~tp~isaale~~l~~kke--  132 (320)
T KOG1667|consen   57 GCTRGKHSNEKPPEPKK--PEVKETRPEKKELVEVWKGLNESGKLDPKDATPIKQNLNVEVTPGISAALEKALKEKKE--  132 (320)
T ss_pred             cccccccccCCCCCCCC--CcccccccccccceeechhhHhhCcCCCCcccccccccCcccCcchhHHHHHHHHhcch--
Confidence            89999999999999987  7776    44678888888777776666664 776     6889999999999985321  


Q ss_pred             CCCCCCCCCCCCCCCcccccCcCceeeCCCCccccceecCCCcccccCCcccccCCCcccchhhhccCCCCcccccCCcc
Q psy6601          71 HLDRGDLSSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVWFK  150 (459)
Q Consensus        71 ~~~~~~~s~~I~~gt~CkN~GCgq~F~~~eN~~~~C~yHPG~PvFHDg~K~WSCCkkkttDF~eFL~i~GCt~GkH~~~k  150 (459)
                          .+.++.|++|++|+|+||...|+|.+|..+.|+||||+|||||||||||||++||+||++||+|+|||.|.|.|++
T Consensus       133 ----a~q~~~I~iGtsCkN~GCs~~fqG~esd~~~CtyHpGapiFHEGMKyWSCC~kkTsdF~aFlaQ~GCt~GeH~w~k  208 (320)
T KOG1667|consen  133 ----AAQSADIQIGTSCKNNGCSTEFQGSESDKENCTYHPGAPIFHEGMKYWSCCNKKTSDFGAFLAQVGCTSGEHKWRK  208 (320)
T ss_pred             ----hhcCcCceeCCcccCCCcceeeeccccccccceeCCCChhhhccchhhhhcccccccHHHHhhhcCccccchhhhc
Confidence                2344559999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             ccccccCccchhcccchhhhhccccccCCCcccCCCccccccCCCCCcccCCcchhhhhccccccccceeecccccccCc
Q psy6601         151 KTIVNVDKSSVFMLGSKVEISLHKAEVGSWSKLDIPSLTIANHGDEKDKEDTSTNEVQHALDTAEKGQVKCRLDWFQTGS  230 (459)
Q Consensus       151 ~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~ld~P~~t~~~~~~e~~ke~~~t~e~~h~l~~~~~~~v~CR~DwyQT~~  230 (459)
                      ...                                                                +++||+|||||++
T Consensus       209 ~~~----------------------------------------------------------------V~~cR~Dwhqt~~  224 (320)
T KOG1667|consen  209 NEI----------------------------------------------------------------VVKCRHDWHQTNG  224 (320)
T ss_pred             cCc----------------------------------------------------------------cccchhhhhhcCC
Confidence            862                                                                5899999999999


Q ss_pred             eEEEEEEeeecCCCCcEEEecCeEEEEEEecCCCCceeeeeeeeeeeeccccceeEEEecceeeeeEEeecCCccCCCCC
Q psy6601         231 TVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRGMLAHTIQEILCSMMHTKAGPAAIKNGCTVSSHNP  310 (459)
Q Consensus       231 ~V~VSVyaKk~dp~~S~V~~~~~~l~v~l~fp~~~k~y~~~i~L~G~ID~~~~kS~~~~~~TK~Ei~l~Ka~~~~~~h~~  310 (459)
                      .|+|+||||+++|+.|.|++|+++|+|+|+||++|++|+++++|||+|+  |++|+|.||+|||||+|+|+++++|+.-+
T Consensus       225 ~Vti~VY~k~~lpe~s~iean~~~l~V~ivf~~gna~fd~d~kLwgvvn--ve~s~v~m~~tkVEIsl~k~ep~sWa~Le  302 (320)
T KOG1667|consen  225 FVTINVYAKGALPETSNIEANGTTLHVSIVFGFGNASFDLDYKLWGVVN--VEESSVVMGETKVEISLKKAEPGSWARLE  302 (320)
T ss_pred             eEEEEEEeccCCcccceeeeCCeEEEEEEEecCCCceeeccceeeeeec--hhhceEEeecceEEEEEeccCCCCccccc
Confidence            9999999999999999999999999999999999999999999999999  99999999999999999999999998654


Q ss_pred             C
Q psy6601         311 V  311 (459)
Q Consensus       311 ~  311 (459)
                      -
T Consensus       303 ~  303 (320)
T KOG1667|consen  303 F  303 (320)
T ss_pred             C
Confidence            3

>KOG1667|consensus Back     alignment and domain information
>PF04968 CHORD: CHORD ; InterPro: IPR007051 Cysteine- and histidine-rich domains (CHORDs) are 60-amino acid modules that bind two zinc ions Back     alignment and domain information
>PF04968 CHORD: CHORD ; InterPro: IPR007051 Cysteine- and histidine-rich domains (CHORDs) are 60-amino acid modules that bind two zinc ions Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>KOG1309|consensus Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>COG5091 SGT1 Suppressor of G2 allele of skp1 and related proteins [General function prediction only] Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>KOG3158|consensus Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>smart00107 BTK Bruton's tyrosine kinase Cys-rich motif Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3260|consensus Back     alignment and domain information
>PF00779 BTK: BTK motif; InterPro: IPR001562 The Btk-type zinc finger or Btk motif (BM) is a conserved zinc-binding motif containing conserved cysteines and a histidine that is present in certain eukaryotic signalling proteins Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
2yrt_A75 Solution Structure Of The Chord Domain Of Human Cho 4e-13
2yrt_A75 Solution Structure Of The Chord Domain Of Human Cho 6e-09
2xcm_E74 Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord 3e-08
2xcm_E74 Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord 4e-05
>pdb|2YRT|A Chain A, Solution Structure Of The Chord Domain Of Human Chord- Containing Protein 1 Length = 75 Back     alignment and structure 
Iteration: 1

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 41/69 (59%)
Query: 78  SSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLE 137
           S S  +   C N  C Q ++   +    C +H GVPVFH+ LK WSCC ++TT+FS FL 
Sbjct: 3   SGSSGMALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLS 62
Query: 138 QEGCTHGQH 146
             GCT G+H
Sbjct: 63  IVGCTKGRH 71
>pdb|2YRT|A Chain A, Solution Structure Of The Chord Domain Of Human Chord- Containing Protein 1 Length = 75 Back     alignment and structure
>pdb|2XCM|E Chain E, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 Domain Length = 74 Back     alignment and structure
>pdb|2XCM|E Chain E, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 Domain Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
2xcm_E74 RAR1, cytosolic heat shock protein 90; chaperone-p 5e-25
2xcm_E74 RAR1, cytosolic heat shock protein 90; chaperone-p 2e-19
2yrt_A75 Chord containing protein-1; CHP1, structural genom 8e-25
2yrt_A75 Chord containing protein-1; CHP1, structural genom 6e-19
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 3e-11
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 2e-05
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 2e-09
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 1e-04
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 8e-05
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 7e-04
>2xcm_E RAR1, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
 Score = 97.0 bits (241), Expect = 5e-25
 Identities = 26/71 (36%), Positives = 34/71 (47%)

Query: 78  SSSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLE 137
              I     CKN  C Q+++  ++  T C HH G  VFH+ L+ W CC     EF  F+E
Sbjct: 3   VIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCDVHVKEFDEFME 62

Query: 138 QEGCTHGQHVW 148
              CT G H  
Sbjct: 63  IPPCTKGWHSS 73
>2xcm_E RAR1, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>2yrt_A Chord containing protein-1; CHP1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yrt_A Chord containing protein-1; CHP1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Length = 92 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Length = 92 Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Length = 114 Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Length = 114 Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Length = 134 Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Length = 134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
2xcm_E74 RAR1, cytosolic heat shock protein 90; chaperone-p 100.0
2yrt_A75 Chord containing protein-1; CHP1, structural genom 99.98
2xcm_E74 RAR1, cytosolic heat shock protein 90; chaperone-p 99.96
2yrt_A75 Chord containing protein-1; CHP1, structural genom 99.95
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.68
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 99.68
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 99.63
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.58
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 99.52
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 99.51
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 99.36
2o30_A131 Nuclear movement protein; MCSG, structural genomic 98.96
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 98.88
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 98.65
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 98.47
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 98.35
4fei_A102 Heat shock protein-related protein; stress respons 95.57
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 95.35
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 93.26
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 93.1
1gme_A151 Heat shock protein 16.9B; small heat shock protein 92.98
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 91.76
2e6i_A64 Tyrosine-protein kinase ITK/TSK; BTK, structural g 89.0
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 88.71
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 86.8
2ys2_A50 Cytoplasmic tyrosine-protein kinase BMX; bone marr 83.86
2e6i_A64 Tyrosine-protein kinase ITK/TSK; BTK, structural g 81.18
>2xcm_E RAR1, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=7.3e-35  Score=236.20  Aligned_cols=70  Identities=37%  Similarity=0.781  Sum_probs=67.7

Q ss_pred             CCCCCCCcccccCcCceeeCCCCccccceecCCCcccccCCcccccCCCcccchhhhccCCCCcccccCC
Q psy6601          79 SSIPLGTKCKNNACKQSYEGPESLSTICVHHAGVPVFHEGLKFWSCCTKKTTEFSAFLEQEGCTHGQHVW  148 (459)
Q Consensus        79 ~~I~~gt~CkN~GCgq~F~~~eN~~~~C~yHPG~PvFHDg~K~WSCCkkkttDF~eFL~i~GCt~GkH~~  148 (459)
                      ..|++|++|+|+||++.|++++|.+++|+||||+||||||||+||||++|++||++||+|+||++|+|+.
T Consensus         4 ~~i~~~~~C~n~GC~~~f~~~~n~~~~C~yHpG~PvFHdg~K~WsCC~k~~~dF~~Fl~i~GCt~G~H~~   73 (74)
T 2xcm_E            4 IDINQPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCDVHVKEFDEFMEIPPCTKGWHSS   73 (74)
T ss_dssp             CCTTSCEECCSBTTCCEECSTTCCTTCEEEBCCCEEEETTEEEETTTTEECSSHHHHTTCCCCEEECCCC
T ss_pred             EccCCCCcEECCCcCCEecCCCCCCCceEecCCCceeCCCCeeeCCCCCcccChhHhccCCCcccccccC
Confidence            4689999999999999999999999999999999999999999999999999999999999999999964
>2yrt_A Chord containing protein-1; CHP1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xcm_E RAR1, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2yrt_A Chord containing protein-1; CHP1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2e6i_A Tyrosine-protein kinase ITK/TSK; BTK, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>2ys2_A Cytoplasmic tyrosine-protein kinase BMX; bone marrow tyrosine kinase gene in chromosome X protein, epithelial and endothelial tyrosine kinase, ETK; NMR {Homo sapiens} Back     alignment and structure
>2e6i_A Tyrosine-protein kinase ITK/TSK; BTK, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 459
d1rl1a_92 b.15.1.3 (A:) Suppressor of G2 allele of skp1 homo 2e-05
d1rl1a_92 b.15.1.3 (A:) Suppressor of G2 allele of skp1 homo 0.002
d1wh0a_134 b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolas 7e-04
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: GS domain
domain: Suppressor of G2 allele of skp1 homolog, gst1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.7 bits (95), Expect = 2e-05
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%)

Query: 220 KCRLDWFQTGSTVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPEEDGNYQQDIELRG 276
           K + DW+QT S VV+++  K        V  S   L   +  P  + +Y   +EL  
Sbjct: 2   KIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGE-DYNLKLELLH 57
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 99.72
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 99.69
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 99.26
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 98.55
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 97.58
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 89.5
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 85.5
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: GS domain
domain: Ubiquitin carboxyl-terminal hydrolase 19, USP19
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.72  E-value=7.1e-18  Score=145.94  Aligned_cols=89  Identities=13%  Similarity=0.180  Sum_probs=81.2

Q ss_pred             eeecccccccC-ceEEEEEEeeecCCCCcEEEecCeEEEEEEecCC-----------CCceeeeeeeeeeeeccccceeE
Q psy6601         219 VKCRLDWFQTG-STVVVSIFGKKYDPLRSKVLLSPVRLKVDLYFPE-----------EDGNYQQDIELRGMLAHTIQEIL  286 (459)
Q Consensus       219 v~CR~DwyQT~-~~V~VSVyaKk~dp~~S~V~~~~~~l~v~l~fp~-----------~~k~y~~~i~L~G~ID~~~~kS~  286 (459)
                      ...|+|||||+ ++|+|+||+|++.++...|+|....|.|.+..+.           .+.+|+.+++|||.||  |++|+
T Consensus        18 ~~ir~dwyq~~~~~V~VtI~~K~v~ke~~~V~f~~~sl~v~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~I~--pe~S~   95 (134)
T d1wh0a_          18 AFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIE--PEQCT   95 (134)
T ss_dssp             SCCCEEEEEETTTEEEEEEECCSBCTTSCEEEECSSEEEEEECBCCHHHHHHSTTCCTTSCEEEEEEBSSCEE--EEEEE
T ss_pred             cccccceeecCCCEEEEEEEeCCCchhheEEEEeCCEEEEEEECCCCcceeeccccCcCeeEEEeeecccccC--hhHcE
Confidence            35799999996 7999999999999999999999999999997643           3468999999999999  99999


Q ss_pred             EEecceeeeeEEeecCCccCCCC
Q psy6601         287 CSMMHTKAGPAAIKNGCTVSSHN  309 (459)
Q Consensus       287 ~~~~~TK~Ei~l~Ka~~~~~~h~  309 (459)
                      ++++++||||+|+|+++..|++=
T Consensus        96 ~~v~~~kiei~L~K~~~~~W~~L  118 (134)
T d1wh0a_          96 FCFTASRIDICLRKRQSQRWGGL  118 (134)
T ss_dssp             EEECSSEEEEEEEESSSCCCSCS
T ss_pred             EEeCCCEEEEEEEeCCCCcCcCc
Confidence            99999999999999999887764
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure