Psyllid ID: psy6708


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MALSLSLVASLIYILSYGSEDTTTNTTSVPHTPQDPDQWPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEWGYDAFKFDNVLKYFKKSEFMTDSSKYNEFHGTQGPFVVKPSPRVDKTFDT
ccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEcccHHHHHHHHHcccccccEEEEEcccccccccccccccccccccccccccEEcEEcccccccccccEEccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHcccccccccccccccccccEEEEccccccccccc
ccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHccccccEEEEcccHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHccccccccEEccccccHHHcccccccccccccEEcccHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccccccccccccEEEEccccccccccc
MALSLSLVASLIYILSygsedtttnttsvphtpqdpdqwpqefDFIIVGAGTAGSILASRLAEVRSWNILLVEaggdpsnisyfpenrgqlygssmdwAFVTEEQSgmflslsnqrttipcgkglggsssihslyytrgdsrdydewgydafkfdnvLKYFKksefmtdsskynefhgtqgpfvvkpsprvdktfdt
MALSLSLVASLIYILSYGSEDTTTNTTSVPHTPQDPDQWPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEaggdpsnisYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRTTIpcgkglggssSIHSLYYTRGDSRDYDEWGYDAFKFDNVLKYFKKSEFMTDSSKYNefhgtqgpfvvkpsprvdktfdt
MALSLSLVASLIYILSYGSEDtttnttSVPHTPQDPDQWPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEWGYDAFKFDNVLKYFKKSEFMTDSSKYNEFHGTQGPFVVKPSPRVDKTFDT
***************************************PQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEWGYDAFKFDNVLKYFKKSEFMT*****************************
*ALSLSLVASLIYILSYGSEDTTTNT***********QWPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEWGYDAFKFDNVLKYFKKSEFMTDSSKYNEFHGTQGPFVVKPSPR*******
MALSLSLVASLIYILSYGSED**************PDQWPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEWGYDAFKFDNVLKYFKKSEFMTDSSKYNEFHGTQGPFVVKPSP********
MALSLSLVASLIYILSYGSEDTTTNTTSVPHTPQDPDQWPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEWGYDAFKFDNVLKYFKKSEFMTDSSKYNEFHGTQGPFVVKPSPRVDK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSLSLVASLIYILSYGSEDTTTNTTSVPHTPQDPDQWPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEWGYDAFKFDNVLKYFKKSEFMTDSSKYNEFHGTQGPFVVKPSPRVDKTFDT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
P18173 625 Glucose dehydrogenase [ac no N/A 0.751 0.236 0.401 2e-24
P18172 625 Glucose dehydrogenase [ac no N/A 0.629 0.198 0.433 2e-23
B2JS89 572 Choline dehydrogenase OS= yes N/A 0.736 0.253 0.372 1e-21
Q66D54 567 Choline dehydrogenase OS= yes N/A 0.715 0.248 0.367 3e-21
B2K8U4 567 Choline dehydrogenase OS= yes N/A 0.715 0.248 0.367 3e-21
Q8P5D7 556 Choline dehydrogenase OS= yes N/A 0.725 0.257 0.369 4e-21
B0RNU9 556 Choline dehydrogenase OS= yes N/A 0.725 0.257 0.369 4e-21
Q4UYN5 556 Choline dehydrogenase OS= yes N/A 0.725 0.257 0.369 4e-21
Q9L4K0 558 Choline dehydrogenase OS= yes N/A 0.670 0.236 0.398 4e-21
B4EX94 555 Choline dehydrogenase OS= yes N/A 0.664 0.236 0.382 9e-21
>sp|P18173|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 Back     alignment and function desciption
 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 88/152 (57%), Gaps = 4/152 (2%)

Query: 42  EFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFV 101
           E+DFI++G G+AGS++ASRL+EV  W +LL+EAGGD    +  P       GS +D+ + 
Sbjct: 64  EYDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSMFLNFIGSDIDYRYN 123

Query: 102 TEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEWGYD---AFKFDNVL 158
           TE +    LS   QR   P GK LGG+S ++ + Y RG+  DYD+W  D    + +++VL
Sbjct: 124 TEPEPMACLSSMEQRCYWPRGKVLGGTSVLNGMMYVRGNREDYDDWAADGNPGWAYNDVL 183

Query: 159 KYFKKSEFMTDSSKY-NEFHGTQGPFVVKPSP 189
            +FKKSE   D  +   E+H   G   V   P
Sbjct: 184 PFFKKSEDNLDLDEVGTEYHAKGGLLPVGKFP 215




Essential for cuticular modification during development.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0
>sp|P18172|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4 Back     alignment and function description
>sp|B2JS89|BETA_BURP8 Choline dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q66D54|BETA_YERPS Choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|B2K8U4|BETA_YERPB Choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q8P5D7|BETA_XANCP Choline dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|B0RNU9|BETA_XANCB Choline dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q4UYN5|BETA_XANC8 Choline dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q9L4K0|BETA2_CHRSD Choline dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betA PE=1 SV=1 Back     alignment and function description
>sp|B4EX94|BETA_PROMH Choline dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=betA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
194767914 651 GF19432 [Drosophila ananassae] gi|190622 0.751 0.227 0.445 2e-29
24642042 703 CG9518 [Drosophila melanogaster] gi|7293 0.741 0.207 0.441 3e-29
33636589 703 RE11240p [Drosophila melanogaster] 0.741 0.207 0.441 4e-29
195432695 658 GK19744 [Drosophila willistoni] gi|19416 0.761 0.227 0.445 5e-29
195354593 601 GM12028 [Drosophila sechellia] gi|194129 0.741 0.242 0.435 1e-28
195130098 681 GI15381 [Drosophila mojavensis] gi|19390 0.761 0.220 0.438 2e-28
195174259 551 GL27090 [Drosophila persimilis] gi|19411 0.741 0.264 0.435 3e-28
242018484 656 Alcohol oxidase, putative [Pediculus hum 0.634 0.190 0.472 3e-28
198471152 691 GA21849 [Drosophila pseudoobscura pseudo 0.741 0.211 0.435 3e-28
195043459 681 GH11960 [Drosophila grimshawi] gi|193901 0.741 0.214 0.421 6e-28
>gi|194767914|ref|XP_001966059.1| GF19432 [Drosophila ananassae] gi|190622944|gb|EDV38468.1| GF19432 [Drosophila ananassae] Back     alignment and taxonomy information
 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/157 (44%), Positives = 98/157 (62%), Gaps = 9/157 (5%)

Query: 39  WPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDW 98
           WP E+DFI+VG+G+AG+++A+RL+EVR W +LL+EAG D + IS  P     L  S +DW
Sbjct: 54  WP-EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDW 112

Query: 99  AFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEW---GYDAFKFD 155
           A+ TE  +   L + N R   P G+ LGGSS ++ + Y RG+  DYD W   G   + +D
Sbjct: 113 AYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRNDYDHWASLGNPGWDYD 172

Query: 156 NVLKYFKKSEFMTDSSKY---NEFHGTQGPFVVKPSP 189
           +VLKYFKKSE   + + Y   N +HG  G   V+ SP
Sbjct: 173 HVLKYFKKSE--DNRNPYLANNAYHGKGGLLTVQESP 207




Source: Drosophila ananassae

Species: Drosophila ananassae

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|24642042|ref|NP_572979.1| CG9518 [Drosophila melanogaster] gi|7293011|gb|AAF48398.1| CG9518 [Drosophila melanogaster] gi|221307618|gb|ACM16685.1| FI02019p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|33636589|gb|AAQ23592.1| RE11240p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195432695|ref|XP_002064352.1| GK19744 [Drosophila willistoni] gi|194160437|gb|EDW75338.1| GK19744 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195354593|ref|XP_002043781.1| GM12028 [Drosophila sechellia] gi|194129007|gb|EDW51050.1| GM12028 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195130098|ref|XP_002009491.1| GI15381 [Drosophila mojavensis] gi|193907941|gb|EDW06808.1| GI15381 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195174259|ref|XP_002027896.1| GL27090 [Drosophila persimilis] gi|194115585|gb|EDW37628.1| GL27090 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|242018484|ref|XP_002429705.1| Alcohol oxidase, putative [Pediculus humanus corporis] gi|212514708|gb|EEB16967.1| Alcohol oxidase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|198471152|ref|XP_001355514.2| GA21849 [Drosophila pseudoobscura pseudoobscura] gi|198145790|gb|EAL32573.2| GA21849 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195043459|ref|XP_001991622.1| GH11960 [Drosophila grimshawi] gi|193901380|gb|EDW00247.1| GH11960 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
FB|FBgn0030590 703 CG9518 [Drosophila melanogaste 0.741 0.207 0.441 2.9e-29
FB|FBgn0030596 633 CG12398 [Drosophila melanogast 0.771 0.240 0.393 3e-26
FB|FBgn0030598 626 CG9503 [Drosophila melanogaste 0.746 0.234 0.410 6.1e-26
FB|FBgn0030592 726 CG9514 [Drosophila melanogaste 0.918 0.249 0.352 1.9e-25
FB|FBgn0030591 865 CG9517 [Drosophila melanogaste 0.791 0.180 0.370 3.2e-24
FB|FBgn0001112 625 Gld "Glucose dehydrogenase" [D 0.771 0.243 0.396 5.5e-24
FB|FBgn0030588 621 CG9521 [Drosophila melanogaste 0.730 0.231 0.408 5.1e-23
FB|FBgn0030589 622 CG9519 [Drosophila melanogaste 0.741 0.234 0.403 2.3e-22
UNIPROTKB|Q47YL1 539 CPS_3434 "Oxidoreductase, GMC 0.710 0.259 0.389 5.4e-22
TIGR_CMR|CPS_3434 539 CPS_3434 "oxidoreductase, GMC 0.710 0.259 0.389 5.4e-22
FB|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 333 (122.3 bits), Expect = 2.9e-29, P = 2.9e-29
 Identities = 68/154 (44%), Positives = 97/154 (62%)

Query:    42 EFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFV 101
             E+DFI+VG+G+AG+++A+RL+EVR W +LL+EAG D + IS  P     L  S +DWA+ 
Sbjct:    56 EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK 115

Query:   102 TEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEW---GYDAFKFDNVL 158
             TE  +   L + N R   P G+ LGGSS ++ + Y RG+  DYD W   G   + +DNVL
Sbjct:   116 TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL 175

Query:   159 KYFKKSEFMTDSSKY---NEFHGTQGPFVVKPSP 189
             +YFKKSE   + + Y   N++HG  G   V+ SP
Sbjct:   176 RYFKKSE--DNRNPYLANNKYHGRGGLLTVQESP 207




GO:0008812 "choline dehydrogenase activity" evidence=ISS
GO:0006066 "alcohol metabolic process" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0046331 "lateral inhibition" evidence=IMP
FB|FBgn0030596 CG12398 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q47YL1 CPS_3434 "Oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3434 CPS_3434 "oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
PRK02106 560 PRK02106, PRK02106, choline dehydrogenase; Validat 7e-35
COG2303 542 COG2303, BetA, Choline dehydrogenase and related f 7e-29
TIGR01810 532 TIGR01810, betA, choline dehydrogenase 1e-26
TIGR03970 487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 6e-23
pfam00732 218 pfam00732, GMC_oxred_N, GMC oxidoreductase 7e-12
PLN02785 587 PLN02785, PLN02785, Protein HOTHEAD 3e-09
COG0644 396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 2e-05
PRK06370 463 PRK06370, PRK06370, mercuric reductase; Validated 1e-04
pfam05834 374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 0.001
TIGR01988 387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 0.002
COG0579 429 COG0579, COG0579, Predicted dehydrogenase [General 0.003
PRK07364 415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl h 0.003
COG1249 454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 0.003
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
 Score =  128 bits (324), Expect = 7e-35
 Identities = 60/159 (37%), Positives = 89/159 (55%), Gaps = 24/159 (15%)

Query: 41  QEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYF---------PENRGQL 91
            E+D+II+GAG+AG +LA+RL+E    ++LL+EAGG      +F         P   G+ 
Sbjct: 4   MEYDYIIIGAGSAGCVLANRLSEDPDVSVLLLEAGGPDYRWDFFIQMPAALAFPLQ-GKR 62

Query: 92  YGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEW---- 147
           Y    +WA+ TE +  M    +N+R   P GK LGGSSSI+ + Y RG++ DYD W    
Sbjct: 63  Y----NWAYETEPEPHM----NNRRMECPRGKVLGGSSSINGMVYIRGNAMDYDNWAELP 114

Query: 148 GYDAFKFDNVLKYFKKSEFMTDSSKYNEFHGTQGPFVVK 186
           G + + + + L YFKK+E  T     +++ G  GP  V 
Sbjct: 115 GLEGWSYADCLPYFKKAE--TRDGGEDDYRGGDGPLSVT 151


Length = 560

>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236001 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
KOG1238|consensus 623 100.0
PRK02106 560 choline dehydrogenase; Validated 99.97
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 99.97
PF00732 296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 99.97
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 99.96
PLN02785 587 Protein HOTHEAD 99.9
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 99.57
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.57
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 98.47
PRK10157 428 putative oxidoreductase FixC; Provisional 98.44
PRK10015 429 oxidoreductase; Provisional 98.44
PRK07121 492 hypothetical protein; Validated 98.43
KOG1298|consensus 509 98.34
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.32
TIGR02032 295 GG-red-SF geranylgeranyl reductase family. This mo 98.3
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.28
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 98.27
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.27
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.26
COG2081 408 Predicted flavoproteins [General function predicti 98.25
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.24
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 98.23
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 98.22
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.22
PRK08274 466 tricarballylate dehydrogenase; Validated 98.21
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 98.21
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.19
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.18
PTZ00058 561 glutathione reductase; Provisional 98.17
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.16
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.16
PLN02985 514 squalene monooxygenase 98.16
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 98.15
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.15
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 98.15
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.15
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.14
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.13
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 98.13
PRK06185 407 hypothetical protein; Provisional 98.13
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 98.13
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.11
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.11
PRK09126 392 hypothetical protein; Provisional 98.11
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.11
PRK06116 450 glutathione reductase; Validated 98.1
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.09
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.09
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 98.09
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.09
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.08
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 98.08
PRK07804 541 L-aspartate oxidase; Provisional 98.07
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.07
PRK06370 463 mercuric reductase; Validated 98.06
PRK08013 400 oxidoreductase; Provisional 98.06
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.05
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.05
PLN02463 447 lycopene beta cyclase 98.05
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 98.05
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 98.04
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 98.04
PLN02697 529 lycopene epsilon cyclase 98.04
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 98.04
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.03
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 98.03
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.02
PRK07045 388 putative monooxygenase; Reviewed 98.02
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.02
PRK11728 393 hydroxyglutarate oxidase; Provisional 98.02
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 98.01
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.01
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 98.01
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 98.01
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.01
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.0
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 97.99
TIGR02053 463 MerA mercuric reductase. This model represents the 97.98
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 97.98
PTZ00367 567 squalene epoxidase; Provisional 97.97
PLN02464 627 glycerol-3-phosphate dehydrogenase 97.96
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.95
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.95
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.94
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 97.94
KOG0029|consensus 501 97.94
PRK08244 493 hypothetical protein; Provisional 97.94
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 97.93
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.93
PRK13748 561 putative mercuric reductase; Provisional 97.93
PRK07190 487 hypothetical protein; Provisional 97.92
PLN02661 357 Putative thiazole synthesis 97.92
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 97.92
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.92
PLN02576 496 protoporphyrinogen oxidase 97.92
PRK11445 351 putative oxidoreductase; Provisional 97.91
PRK08294 634 phenol 2-monooxygenase; Provisional 97.91
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 97.9
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.89
PRK12842 574 putative succinate dehydrogenase; Reviewed 97.89
PRK14694 468 putative mercuric reductase; Provisional 97.89
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 97.89
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.87
PRK06184 502 hypothetical protein; Provisional 97.87
PRK05257 494 malate:quinone oxidoreductase; Validated 97.87
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 97.87
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.87
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 97.87
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 97.86
COG0492 305 TrxB Thioredoxin reductase [Posttranslational modi 97.86
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.86
PLN02268 435 probable polyamine oxidase 97.85
PRK14727 479 putative mercuric reductase; Provisional 97.85
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.85
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 97.85
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.85
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.85
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.85
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.84
PRK07208 479 hypothetical protein; Provisional 97.84
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.84
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 97.84
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.84
PTZ00052 499 thioredoxin reductase; Provisional 97.84
PRK13339 497 malate:quinone oxidoreductase; Reviewed 97.84
PLN02676 487 polyamine oxidase 97.83
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.82
PRK07395 553 L-aspartate oxidase; Provisional 97.82
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 97.82
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 97.82
PRK06996 398 hypothetical protein; Provisional 97.82
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 97.82
PRK06834 488 hypothetical protein; Provisional 97.81
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.81
PLN02507 499 glutathione reductase 97.81
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.81
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.8
PRK06847 375 hypothetical protein; Provisional 97.8
PRK07588 391 hypothetical protein; Provisional 97.79
PRK06126 545 hypothetical protein; Provisional 97.79
PRK08275 554 putative oxidoreductase; Provisional 97.79
PRK10262 321 thioredoxin reductase; Provisional 97.79
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 97.79
PRK11883 451 protoporphyrinogen oxidase; Reviewed 97.79
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 97.79
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.78
PLN02815 594 L-aspartate oxidase 97.78
PTZ00383 497 malate:quinone oxidoreductase; Provisional 97.77
PRK06175 433 L-aspartate oxidase; Provisional 97.77
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.77
PRK06753 373 hypothetical protein; Provisional 97.77
PLN02546 558 glutathione reductase 97.77
PRK07233 434 hypothetical protein; Provisional 97.76
PRK08401 466 L-aspartate oxidase; Provisional 97.76
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 97.75
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 97.75
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 97.74
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.73
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.73
COG3573 552 Predicted oxidoreductase [General function predict 97.72
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.72
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.72
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.72
PTZ00153 659 lipoamide dehydrogenase; Provisional 97.72
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 97.72
PRK07236 386 hypothetical protein; Provisional 97.72
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.71
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 97.71
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 97.7
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 97.68
PRK08163 396 salicylate hydroxylase; Provisional 97.68
KOG2415|consensus 621 97.68
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.67
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 97.65
PRK07538 413 hypothetical protein; Provisional 97.65
PRK12839 572 hypothetical protein; Provisional 97.64
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 97.63
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.62
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.62
PRK09077 536 L-aspartate oxidase; Provisional 97.61
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 97.6
COG0579 429 Predicted dehydrogenase [General function predicti 97.57
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 97.56
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.53
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 97.53
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.53
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 97.53
PRK08071 510 L-aspartate oxidase; Provisional 97.52
PRK05868 372 hypothetical protein; Validated 97.52
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.51
PRK12416 463 protoporphyrinogen oxidase; Provisional 97.51
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.5
PLN02568 539 polyamine oxidase 97.5
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.5
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.49
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 97.48
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 97.47
TIGR03378 419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.43
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.42
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 97.42
PRK06475 400 salicylate hydroxylase; Provisional 97.4
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 97.39
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.39
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.38
PRK07846 451 mycothione reductase; Reviewed 97.36
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.34
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.33
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 97.32
PRK07512 513 L-aspartate oxidase; Provisional 97.3
TIGR00275 400 flavoprotein, HI0933 family. The model when search 97.3
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.3
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.28
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.27
PRK12831 464 putative oxidoreductase; Provisional 97.27
PF00996 438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 97.24
KOG2820|consensus 399 97.21
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.19
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 97.17
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 97.17
COG3349 485 Uncharacterized conserved protein [Function unknow 97.15
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.12
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 97.12
PLN02612 567 phytoene desaturase 97.12
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.1
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.1
PLN02529 738 lysine-specific histone demethylase 1 97.08
PRK07845 466 flavoprotein disulfide reductase; Reviewed 97.07
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.05
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 97.01
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.99
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 96.97
PLN02852 491 ferredoxin-NADP+ reductase 96.95
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 96.94
KOG3855|consensus 481 96.94
KOG1399|consensus 448 96.94
PRK12779 944 putative bifunctional glutamate synthase subunit b 96.93
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 96.93
KOG0685|consensus 498 96.92
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 96.89
PRK13977 576 myosin-cross-reactive antigen; Provisional 96.87
KOG2665|consensus 453 96.86
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 96.84
KOG2614|consensus 420 96.84
PLN02487 569 zeta-carotene desaturase 96.78
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 96.78
PLN03000 881 amine oxidase 96.73
KOG0405|consensus 478 96.71
PRK12770 352 putative glutamate synthase subunit beta; Provisio 96.69
PRK12814 652 putative NADPH-dependent glutamate synthase small 96.67
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.64
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 96.63
KOG4716|consensus 503 96.63
PLN02976 1713 amine oxidase 96.6
KOG2853|consensus 509 96.59
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 96.49
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 96.49
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.47
KOG2960|consensus328 96.45
PTZ00188 506 adrenodoxin reductase; Provisional 96.37
PRK09564 444 coenzyme A disulfide reductase; Reviewed 96.34
KOG1335|consensus 506 96.32
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.32
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 96.28
PRK13512 438 coenzyme A disulfide reductase; Provisional 96.25
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.22
PRK13984 604 putative oxidoreductase; Provisional 96.22
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 96.21
KOG4254|consensus 561 96.12
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 96.09
PF13434 341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.05
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 96.03
PRK09897 534 hypothetical protein; Provisional 95.92
KOG4405|consensus 547 95.91
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 95.89
KOG2311|consensus 679 95.87
KOG0042|consensus 680 95.82
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 95.78
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 95.7
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 95.62
KOG3851|consensus 446 95.52
KOG1276|consensus 491 95.36
COG5044 434 MRS6 RAB proteins geranylgeranyltransferase compon 95.31
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 95.28
COG2907 447 Predicted NAD/FAD-binding protein [General functio 95.21
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 95.17
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 95.14
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 95.01
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.98
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 94.82
KOG2844|consensus 856 94.74
KOG2755|consensus 334 94.53
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.39
KOG1439|consensus 440 94.05
KOG1800|consensus 468 94.03
KOG2404|consensus 477 93.69
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 93.63
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 93.59
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 93.52
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 93.44
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 93.28
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 93.2
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.14
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 92.97
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 92.79
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 92.74
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 92.69
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.66
PRK07846 451 mycothione reductase; Reviewed 92.53
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 92.45
TIGR02053 463 MerA mercuric reductase. This model represents the 92.39
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 92.34
PRK14989 847 nitrite reductase subunit NirD; Provisional 92.33
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 92.27
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 92.19
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 92.15
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 92.15
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 92.11
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 92.1
PRK06370 463 mercuric reductase; Validated 91.88
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 91.86
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 91.86
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 91.83
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 91.8
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 91.78
PRK13512 438 coenzyme A disulfide reductase; Provisional 91.73
KOG0399|consensus 2142 91.57
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 91.37
KOG0404|consensus 322 91.2
PF01593 450 Amino_oxidase: Flavin containing amine oxidoreduct 91.01
PRK09564 444 coenzyme A disulfide reductase; Reviewed 90.86
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 90.84
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 90.8
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 90.68
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 90.67
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.65
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 90.37
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 90.37
COG3486 436 IucD Lysine/ornithine N-monooxygenase [Secondary m 90.29
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 90.15
PRK06116 450 glutathione reductase; Validated 90.13
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.12
PRK07845 466 flavoprotein disulfide reductase; Reviewed 89.99
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 89.79
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.73
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 89.67
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 89.66
PTZ00318424 NADH dehydrogenase-like protein; Provisional 89.64
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 89.61
PTZ00153 659 lipoamide dehydrogenase; Provisional 89.49
PRK10262321 thioredoxin reductase; Provisional 89.48
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.4
PLN02507 499 glutathione reductase 89.32
PRK13748 561 putative mercuric reductase; Provisional 89.27
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 89.25
PRK14694 468 putative mercuric reductase; Provisional 89.24
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 89.18
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 89.16
PRK06719157 precorrin-2 dehydrogenase; Validated 88.81
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.59
PLN02546 558 glutathione reductase 88.53
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.41
PRK14727 479 putative mercuric reductase; Provisional 88.4
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 88.36
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.29
PF06100 500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 88.24
PRK04148134 hypothetical protein; Provisional 88.2
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.0
PTZ00058 561 glutathione reductase; Provisional 87.93
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 87.83
PRK06718202 precorrin-2 dehydrogenase; Reviewed 87.79
PRK14989 847 nitrite reductase subunit NirD; Provisional 87.66
PRK12770352 putative glutamate synthase subunit beta; Provisio 87.63
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 87.58
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.53
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 87.37
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.2
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.14
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 86.92
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 86.54
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 86.39
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 86.3
PTZ00052 499 thioredoxin reductase; Provisional 86.21
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 86.21
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 86.15
KOG2495|consensus 491 86.12
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 86.04
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 85.85
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 85.74
cd01483143 E1_enzyme_family Superfamily of activating enzymes 85.74
PRK10669558 putative cation:proton antiport protein; Provision 85.61
PRK15116268 sulfur acceptor protein CsdL; Provisional 85.61
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 85.4
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 84.55
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 84.42
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 84.34
PRK09496 453 trkA potassium transporter peripheral membrane com 84.28
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 84.15
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 84.1
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 84.04
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 83.56
PRK07417 279 arogenate dehydrogenase; Reviewed 83.35
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 83.08
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 83.07
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 83.06
PRK09496453 trkA potassium transporter peripheral membrane com 83.01
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 83.01
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 82.92
PRK12831464 putative oxidoreductase; Provisional 82.58
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 82.43
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 82.42
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 82.38
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 82.2
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 82.06
KOG2852|consensus 380 81.85
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 81.83
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.04
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 80.87
PRK11730 715 fadB multifunctional fatty acid oxidation complex 80.85
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 80.74
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 80.73
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 80.67
PLN02353 473 probable UDP-glucose 6-dehydrogenase 80.66
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 80.64
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 80.61
PRK06223 307 malate dehydrogenase; Reviewed 80.59
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 80.18
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 80.07
>KOG1238|consensus Back     alignment and domain information
Probab=100.00  E-value=1.8e-37  Score=284.38  Aligned_cols=158  Identities=41%  Similarity=0.743  Sum_probs=143.8

Q ss_pred             CCCCcccEEEECCChHHHHHHHHHHhhCCCeEEEEecCCCCCCcccCCccccCccCCCCcccccccccccccccCCCCcc
Q psy6708          38 QWPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRT  117 (197)
Q Consensus        38 ~~~~~~D~IIVGsG~aG~~~A~~Lae~~g~~VLvLEaG~~~~~~~~~p~~~~~~~~~~~~w~~~~~p~~~~~~~~~~~~~  117 (197)
                      +...+|||||||+|+|||++|.||+|++..+|||||+|+..+...++|.+...++.+.++|.|.++|++.+|..+.++.+
T Consensus        53 ~~~~~yDyIVVGgGtAGcvlAarLSEn~~~~VLLLEaGg~~~~~~~~p~~~~~~q~s~~dw~y~t~Ps~~ac~~m~~~~c  132 (623)
T KOG1238|consen   53 ELDSSYDYIVVGGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSLYDWSYHTEPSQHACLAMSEDRC  132 (623)
T ss_pred             ccccCCCEEEECCCchhHHHHHhhccCCCceEEEEecCCCCcccccchHHHHHhccccccccCcCccChhhhhhhcCCce
Confidence            34569999999999999999999999999999999999998777788866666778899999999999999999999999


Q ss_pred             ccccccccCCCccccccccccCChhhHhhh---CCCCCCHhhHHHHHHHHhhhcCCCCC-CCCCCCCCCEEeecCCCCCC
Q psy6708         118 TIPCGKGLGGSSSIHSLYYTRGDSRDYDEW---GYDAFKFDNVLKYFKKSEFMTDSSKY-NEFHGTQGPFVVKPSPRVDK  193 (197)
Q Consensus       118 ~~~~g~~vGG~S~in~~~~~R~~~~df~~w---g~~~W~~d~l~pyy~~~E~~~~~~~~-~~~hG~~Gpl~vs~~~~~~~  193 (197)
                      .|+|||++||||++|+|+|.|+++.|||.|   |+++|+|++++|||+|+|....+... .++|+..||+.|+...+..+
T Consensus       133 ~wpRGrVLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~~~~~y~~~~g~~~ve~~~~~~~  212 (623)
T KOG1238|consen  133 YWPRGRVLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDPELTPYHGAGGPLLVEAGVYPNN  212 (623)
T ss_pred             ecCccceecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCcccCcccccCCcceeccccccCc
Confidence            999999999999999999999999999999   88999999999999999998766543 55999999999999988877


Q ss_pred             Cc
Q psy6708         194 TF  195 (197)
Q Consensus       194 ~~  195 (197)
                      ++
T Consensus       213 ~~  214 (623)
T KOG1238|consen  213 LF  214 (623)
T ss_pred             hh
Confidence            54



>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>KOG4405|consensus Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1439|consensus Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
3fim_B 566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 1e-15
3t37_A 526 Crystal Structure Of Pyridoxine 4-Oxidase From Meso 1e-13
1gpe_A 587 Glucose Oxidase From Penicillium Amagasakiense Leng 3e-13
3q9t_A 577 Crystal Structure Analysis Of Formate Oxidase Lengt 3e-13
1cf3_A 583 Glucose Oxidase From Apergillus Niger Length = 583 9e-11
3ljp_A 546 Crystal Structure Of Choline Oxidase V464a Mutant L 1e-04
2jbv_A 546 Crystal Structure Of Choline Oxidase Reveals Insigh 1e-04
1ju2_A 536 Crystal Structure Of The Hydroxynitrile Lyase From 2e-04
3gdn_A 521 Almond Hydroxynitrile Lyase In Complex With Benzald 2e-04
3nne_A 546 Crystal Structure Of Choline Oxidase S101a Mutant L 2e-04
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 53/175 (30%), Positives = 92/175 (52%), Gaps = 23/175 (13%) Query: 42 EFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNI--SYFP-ENRGQLYGSSMDW 98 +FD+++VGAG AG+++A+RL E ++L++EAG N+ + P G + S DW Sbjct: 2 DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDW 61 Query: 99 AFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEW----GYDAFKF 154 + T Q+G + + P G+ LGGSSS+H + RG + D+D + G + + + Sbjct: 62 NYTTTAQAGY----NGRSIAYPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNW 117 Query: 155 DNVLKYFKKSEFMT----DSSKYNEF----HGTQGPFVVK----PSPRVDKTFDT 197 DN+ ++ +K+E + + + EF HGT G + P+P D+ T Sbjct: 118 DNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSISLPGFPTPLDDRVLAT 172
>pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 Back     alignment and structure
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 1e-47
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 3e-46
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 6e-44
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 1e-43
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 2e-42
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 5e-42
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 5e-41
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 5e-36
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 9e-14
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 5e-12
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 5e-09
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 7e-06
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 8e-06
3atr_A 453 Conserved archaeal protein; saturating double bond 2e-05
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 3e-05
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 4e-05
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 5e-05
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 6e-05
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 1e-04
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 2e-04
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 4e-04
2gjc_A 326 Thiazole biosynthetic enzyme, mitochondrial; gluta 5e-04
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
 Score =  162 bits (413), Expect = 1e-47
 Identities = 51/192 (26%), Positives = 81/192 (42%), Gaps = 27/192 (14%)

Query: 15  LSYGSEDTTTNTTSVPHTPQDPDQWPQEFDFIIVGAGTAGSILASRLAEVRSWNILLVEA 74
           L     D  ++  S P          + +D+II G G  G  +A++L E     +L++E 
Sbjct: 2   LPAQQIDVQSSLLSDPSKVAG-----KTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEK 56

Query: 75  GGDPSNISYF---PENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSI 131
           G   SN       P   GQ++G+++D  ++T         ++N+   I  GKGLGGS+ I
Sbjct: 57  GFYESNDGAIIEDPNAYGQIFGTTVDQNYLTVPL------INNRTNNIKAGKGLGGSTLI 110

Query: 132 HSLYYTRGDSRDYDEW----GYDAFKFDNVLKYFKKSE---------FMTDSSKYNEFHG 178
           +   +TR D    D W    G + + +DN+ +Y KK+E              S     HG
Sbjct: 111 NGDSWTRPDKVQIDSWEKVFGMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCHG 170

Query: 179 TQGPFVVKPSPR 190
           T G         
Sbjct: 171 TNGTVQSGARDN 182


>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 100.0
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 100.0
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 99.97
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 99.97
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 99.96
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 99.9
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 99.89
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 99.88
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 99.79
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 98.76
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 98.68
4fk1_A 304 Putative thioredoxin reductase; structural genomic 98.48
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.48
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.41
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 98.41
3fpz_A 326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.41
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.39
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 98.39
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.38
3dme_A 369 Conserved exported protein; structural genomics, P 98.36
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 98.34
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 98.31
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.31
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.3
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 98.27
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.25
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 98.23
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.21
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 98.21
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 98.2
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.2
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 98.2
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.2
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.18
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 98.18
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 98.17
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.15
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.14
2cul_A232 Glucose-inhibited division protein A-related PROT 98.14
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.14
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.12
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.12
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 98.12
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 98.11
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.11
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.11
3jsk_A 344 Cypbp37 protein; octameric thiazole synthase, bios 98.11
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.1
3atr_A 453 Conserved archaeal protein; saturating double bond 98.09
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.08
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 98.08
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 98.08
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 98.08
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 98.07
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.07
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 98.07
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 98.07
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.07
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.06
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 98.06
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.05
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.05
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.05
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.05
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.05
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 98.05
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.04
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.04
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 98.04
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.03
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.02
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.02
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.02
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.02
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.01
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.01
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.01
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.01
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.01
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.01
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.01
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.0
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.0
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 98.0
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.0
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.0
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.0
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 97.99
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.98
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.97
4dna_A 463 Probable glutathione reductase; structural genomic 97.97
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 97.97
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.97
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.97
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.95
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.95
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.95
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.95
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 97.95
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.95
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.95
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.94
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.94
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.94
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.94
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 97.93
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.93
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.93
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 97.93
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 97.92
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.92
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.92
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.91
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.91
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 97.9
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.9
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.89
2gjc_A 326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.89
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 97.88
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 97.88
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 97.87
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.87
2bry_A 497 NEDD9 interacting protein with calponin homology a 97.87
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.86
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.86
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.86
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.86
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.86
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 97.84
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.84
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 97.84
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.84
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.84
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 97.84
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.84
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.84
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.83
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.83
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 97.82
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.82
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.81
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 97.81
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.8
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.8
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.8
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 97.8
4hb9_A 412 Similarities with probable monooxygenase; flavin, 97.79
3r9u_A 315 Thioredoxin reductase; structural genomics, center 97.78
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.78
1ojt_A 482 Surface protein; redox-active center, glycolysis, 97.77
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.77
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.77
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 97.76
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.76
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.76
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.75
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.74
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.74
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.73
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.72
1fec_A 490 Trypanothione reductase; redox-active center, oxid 97.72
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 97.7
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.7
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.68
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.66
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.66
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.66
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 97.63
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.63
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 97.62
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.59
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.56
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 97.55
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.54
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 97.52
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.5
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 97.48
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.47
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 97.43
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 97.42
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 97.41
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.41
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.4
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.39
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.39
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.39
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 97.38
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 97.37
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.36
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.36
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 97.33
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 97.32
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.31
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.3
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 97.26
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.22
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.22
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 97.2
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.16
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.05
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 97.04
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.02
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 97.01
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 97.0
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 96.98
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 96.93
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.83
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.67
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.65
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 96.62
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 96.6
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 96.43
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.15
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.99
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.75
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.74
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.49
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.42
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 94.26
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 94.12
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 94.07
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 94.04
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 94.01
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 93.91
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 93.87
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 93.76
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 93.41
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 93.35
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 93.19
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.14
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.06
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 93.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 92.97
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 92.86
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 92.8
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 92.65
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 92.61
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 92.37
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 92.27
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 92.19
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 92.1
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 92.09
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 92.01
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 91.93
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 91.86
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 91.84
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 91.7
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 91.68
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 91.59
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 91.58
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 91.55
1ojt_A 482 Surface protein; redox-active center, glycolysis, 91.51
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 91.41
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 91.38
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 91.23
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 91.23
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 91.21
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 91.15
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 91.06
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 91.06
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 91.04
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 90.97
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.91
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 90.76
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 90.74
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 90.65
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 90.62
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 90.62
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 90.61
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 90.57
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 90.55
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 90.53
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 90.51
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 90.46
4g65_A 461 TRK system potassium uptake protein TRKA; structur 90.3
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 90.28
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 90.25
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 90.22
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 90.16
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 90.05
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 89.99
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 89.98
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 89.88
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 89.87
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 89.87
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 89.83
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 89.69
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 89.67
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 89.4
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 89.27
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 89.11
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 88.93
1fec_A 490 Trypanothione reductase; redox-active center, oxid 88.92
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 88.79
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 88.71
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 88.71
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 88.7
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 88.43
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 88.36
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 88.24
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 88.18
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 88.16
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 88.13
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 88.02
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 87.85
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 87.74
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 87.56
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 87.45
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 87.42
3r9u_A315 Thioredoxin reductase; structural genomics, center 87.4
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 87.36
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 87.2
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 87.04
4gx0_A565 TRKA domain protein; membrane protein, ION channel 86.87
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 86.79
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 86.66
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 86.62
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 86.53
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 86.5
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 86.49
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 86.43
4dna_A 463 Probable glutathione reductase; structural genomic 86.42
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 86.35
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 86.32
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 86.32
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 86.18
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 86.1
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 86.0
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 85.83
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 85.8
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 85.78
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 85.74
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 85.68
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 85.57
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 85.27
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 85.06
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 85.04
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 84.96
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 84.89
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 84.52
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 84.52
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 84.4
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 84.35
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 84.34
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 84.15
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 84.14
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 83.61
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 83.55
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 83.53
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 83.51
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 83.31
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 83.22
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 83.16
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 83.02
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 83.0
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 82.87
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 82.76
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 82.76
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 82.46
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 82.46
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 82.32
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 82.15
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 82.13
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 82.11
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 82.08
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 82.08
3qha_A 296 Putative oxidoreductase; seattle structural genomi 82.06
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 81.97
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 81.94
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 81.77
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 81.77
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 81.74
4ezb_A 317 Uncharacterized conserved protein; structural geno 81.63
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 81.45
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 81.15
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 81.13
3tl2_A 315 Malate dehydrogenase; center for structural genomi 81.06
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 80.91
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 80.89
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 80.66
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 80.6
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 80.45
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 80.43
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 80.36
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 80.35
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
Probab=100.00  E-value=3.8e-35  Score=270.59  Aligned_cols=149  Identities=31%  Similarity=0.575  Sum_probs=132.0

Q ss_pred             cccEEEECCChHHHHHHHHHHhhCCCeEEEEecCCCC--CCcccCCccccCcc-CCCCcccccccccccccccCCCCccc
Q psy6708          42 EFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDP--SNISYFPENRGQLY-GSSMDWAFVTEEQSGMFLSLSNQRTT  118 (197)
Q Consensus        42 ~~D~IIVGsG~aG~~~A~~Lae~~g~~VLvLEaG~~~--~~~~~~p~~~~~~~-~~~~~w~~~~~p~~~~~~~~~~~~~~  118 (197)
                      +|||||||+|+|||++|.||+|+++.+|||||+|+..  .....+|..+.... ++.++|.|.++||+.    ++++.+.
T Consensus         2 ~yD~IIVG~G~aG~v~A~rLse~~~~~VlllEaG~~~~~~~~~~~p~~~~~~~~~~~~~w~~~t~pq~~----~~~r~~~   77 (566)
T 3fim_B            2 DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDWNYTTTAQAG----YNGRSIA   77 (566)
T ss_dssp             CEEEEESCCSTTHHHHHHHHTTSTTCCEEEECSSBCCTTCGGGTSGGGSGGGSSSSTTBCCCBCCCCGG----GTTCCCB
T ss_pred             CcCEEEECCcHHHHHHHHHHHhCcCCcEEEEecCCcccCCCceeCcchHHHhcCCCccccccccccCCC----CCCceEe
Confidence            6999999999999999999999789999999999876  34556776654444 378999999999985    6889999


Q ss_pred             cccccccCCCccccccccccCChhhHhhh----CCCCCCHhhHHHHHHHHhhhcCCCC--------CCCCCCCCCCEEee
Q psy6708         119 IPCGKGLGGSSSIHSLYYTRGDSRDYDEW----GYDAFKFDNVLKYFKKSEFMTDSSK--------YNEFHGTQGPFVVK  186 (197)
Q Consensus       119 ~~~g~~vGG~S~in~~~~~R~~~~df~~w----g~~~W~~d~l~pyy~~~E~~~~~~~--------~~~~hG~~Gpl~vs  186 (197)
                      +++||+|||||+||+|+|.|+++.|||.|    |+++|+|++|+|||+|+|++.++..        ++.+||.+|||+|+
T Consensus        78 ~~rGk~lGGsS~iN~m~~~Rg~~~d~d~W~~~~G~~gWs~~~~~pyf~k~E~~~~~~~~~~~~~~~~~~~hG~~Gp~~v~  157 (566)
T 3fim_B           78 YPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNWDNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSIS  157 (566)
T ss_dssp             CCCBCBTTGGGGTSCCBCCCCCHHHHHHHHHHHTCTTSSHHHHHHHHHHHEEECCCTTCCCCTTTSCGGGSCBSSSEEEB
T ss_pred             ccCCcEEcCcccccceEEecCCHHHHHHHHhcCCCCCcCHHHHHHHHHHHhccCCccccccccccCCccccCCCCCeeee
Confidence            99999999999999999999999999999    8999999999999999999987632        34789999999999


Q ss_pred             cCCCCCCC
Q psy6708         187 PSPRVDKT  194 (197)
Q Consensus       187 ~~~~~~~~  194 (197)
                      ++++..|+
T Consensus       158 ~~~~~~~~  165 (566)
T 3fim_B          158 LPGFPTPL  165 (566)
T ss_dssp             SCSSCCTH
T ss_pred             cCCCCCHH
Confidence            99887664



>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d1gpea1 391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 3e-29
d1cf3a1 385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 4e-26
d2f5va1 379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 7e-24
d1ju2a1 351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 3e-23
d3coxa1 370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 8e-21
d1n4wa1 367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 6e-17
d1kdga1 360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 4e-16
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-05
d1d5ta1 336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 2e-05
d1y0pa2 308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 3e-05
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 3e-05
d2gmha1 380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 3e-05
d2bcgg1 297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 5e-05
d1ryia1 276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 7e-05
d1onfa1 259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 8e-05
d3c96a1 288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 1e-04
d2gf3a1 281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 1e-04
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 1e-04
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 2e-04
d1d4ca2 322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-04
d1i8ta1 298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 3e-04
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 4e-04
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 4e-04
d1qo8a2 317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 4e-04
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 4e-04
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 5e-04
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 5e-04
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 6e-04
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 6e-04
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 7e-04
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 7e-04
d2gjca1 311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 9e-04
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 0.001
d1neka2 330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 0.001
d2voua1 265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.001
d1chua2 305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 0.002
d2bs2a2 336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 0.002
d1pn0a1 360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.003
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 0.003
d1k0ia1 292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 0.003
d1w4xa1 298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 0.003
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 0.003
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Penicillium amagasakiense [TaxId: 63559]
 Score =  109 bits (273), Expect = 3e-29
 Identities = 49/173 (28%), Positives = 78/173 (45%), Gaps = 23/173 (13%)

Query: 35  DPDQWP-QEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPSNISYF---PENRGQ 90
           DP +   + +D+II G G  G  +A++L E     +L++E G   SN       P   GQ
Sbjct: 16  DPSKVAGKTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIEDPNAYGQ 75

Query: 91  LYGSSMDWAFVTEEQSGMFLSLSNQRTTIPCGKGLGGSSSIHSLYYTRGDSRDYDEW--- 147
           ++G+++D  ++T         ++N+   I  GKGLGGS+ I+   +TR D    D W   
Sbjct: 76  IFGTTVDQNYLTVPL------INNRTNNIKAGKGLGGSTLINGDSWTRPDKVQIDSWEKV 129

Query: 148 -GYDAFKFDNVLKYFKKSE---------FMTDSSKYNEFHGTQGPFVVKPSPR 190
            G + + +DN+ +Y KK+E              S     HGT G         
Sbjct: 130 FGMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCHGTNGTVQSGARDN 182


>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 99.94
d1ju2a1 351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.93
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 99.88
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 99.86
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 99.64
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.08
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.08
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 98.77
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.72
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.71
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 98.69
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.69
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.66
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.65
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.65
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.63
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.62
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 98.61
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.59
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.58
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.58
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 98.57
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.57
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.55
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.55
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.55
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.54
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.53
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.51
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 98.49
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 98.44
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.41
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.41
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.41
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.4
d1chua2 305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.4
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.38
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.35
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.34
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.31
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.3
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.3
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.26
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.26
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.25
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.21
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.2
d1kf6a2 311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.17
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.16
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.14
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.09
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.09
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.07
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.05
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.95
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.88
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.81
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.63
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.62
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.51
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.4
d1vg0a1 491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 97.38
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.33
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.27
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.22
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.2
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.1
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.1
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.01
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.94
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.93
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.92
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.91
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.83
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.67
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.59
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.58
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.58
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.49
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 96.38
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.14
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.13
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.09
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.09
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.05
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.02
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.99
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.92
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.88
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.77
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 95.7
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.69
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.45
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 94.08
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.81
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.06
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.04
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 92.77
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.44
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.16
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 91.86
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.85
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.81
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.3
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 90.58
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 90.47
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 90.36
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.32
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 86.88
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 86.77
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 86.21
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 85.92
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 85.84
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 85.8
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 85.26
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 84.5
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 84.27
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 84.05
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 83.79
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 83.69
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 83.69
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 83.32
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 82.51
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 82.12
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 81.98
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 81.23
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 81.1
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 81.07
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 80.79
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 80.71
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 80.56
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Penicillium amagasakiense [TaxId: 63559]
Probab=100.00  E-value=4.6e-34  Score=249.56  Aligned_cols=145  Identities=32%  Similarity=0.555  Sum_probs=125.6

Q ss_pred             CcccEEEECCChHHHHHHHHHHhhCCCeEEEEecCCCCC---CcccCCccccCccCCCCcccccccccccccccCCCCcc
Q psy6708          41 QEFDFIIVGAGTAGSILASRLAEVRSWNILLVEAGGDPS---NISYFPENRGQLYGSSMDWAFVTEEQSGMFLSLSNQRT  117 (197)
Q Consensus        41 ~~~D~IIVGsG~aG~~~A~~Lae~~g~~VLvLEaG~~~~---~~~~~p~~~~~~~~~~~~w~~~~~p~~~~~~~~~~~~~  117 (197)
                      ++|||||||||++||++|.||+|+++.+|||||+|+...   ....+|..+....++.++|+|.++|+.      +++.+
T Consensus        23 ~tyD~IIVGsG~aG~vlA~rLae~~~~~VLlLEaG~~~~~~~~~~~~p~~~~~~~~~~~dw~~~t~p~~------~~r~~   96 (391)
T d1gpea1          23 KTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIEDPNAYGQIFGTTVDQNYLTVPLI------NNRTN   96 (391)
T ss_dssp             CEEEEEEECCSHHHHHHHHHHHTSTTCCEEEEESSCCCTTSCHHHHCGGGTTTTTTSTTBCCEECCCCT------TSCCC
T ss_pred             CeeeEEEECcCHHHHHHHHHHHHCCCCeEEEEcCCCCCCCCCceeeCHHHHHHhhCCCcccCceeeecC------CCcEe
Confidence            589999999999999999999996558999999998653   234567666666778899999998874      67889


Q ss_pred             ccccccccCCCccccccccccCChhhHhhh----CCCCCCHhhHHHHHHHHhhhcCCC---------CCCCCCCCCCCEE
Q psy6708         118 TIPCGKGLGGSSSIHSLYYTRGDSRDYDEW----GYDAFKFDNVLKYFKKSEFMTDSS---------KYNEFHGTQGPFV  184 (197)
Q Consensus       118 ~~~~g~~vGG~S~in~~~~~R~~~~df~~w----g~~~W~~d~l~pyy~~~E~~~~~~---------~~~~~hG~~Gpl~  184 (197)
                      .+++|++|||+|+||+|+|+|+++.||+.|    |+++|+|++++|||+|+|++.++.         .+...||..||++
T Consensus        97 ~~~~G~~lGGsS~in~~~~~rg~~~d~~~w~~~~G~~gW~~~~l~pyf~k~E~~~~~~~~~~~~~~~~~~~~~g~~~~~~  176 (391)
T d1gpea1          97 NIKAGKGLGGSTLINGDSWTRPDKVQIDSWEKVFGMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCHGTNGTVQ  176 (391)
T ss_dssp             EECCBCSTTGGGGTSCCEECCCCHHHHHHHHHTTCCTTCSHHHHHHHHHHTEEECCCCHHHHHHTCCCCGGGCCBSSSEE
T ss_pred             eeceeeccCcccceeeeEEeeccccccccccccCCCCccccchhHHHHHHhhhccCCcchhcccccCccccccCCCCccc
Confidence            999999999999999999999999999999    788999999999999999987653         2467899999999


Q ss_pred             eecCCCC
Q psy6708         185 VKPSPRV  191 (197)
Q Consensus       185 vs~~~~~  191 (197)
                      +++.+..
T Consensus       177 ~~~~~~~  183 (391)
T d1gpea1         177 SGARDNG  183 (391)
T ss_dssp             EBCCCCS
T ss_pred             ccccccc
Confidence            9886543



>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure