Psyllid ID: psy6714


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MRPQRIWPARRARATETSQHTYASAKREGTNASATREGPEAPYPTAQARSARKNASATTREAPEAPQHVLQREARGNKWQRDAREGSRTRPKQRNIPAQKREGNECASRTPTRADATEAPTTPSSREARWNRSDKQIAGTTERGPGALIASLNIVSKATGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDGITGLSGSGPAYRYEVTSNEVINL
ccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccHHHcccccccccccccccccccccccccccHHHHccccccccccccccccccccccEEEEcccHHHHHHHHHHHHcccccEEEEcccHHHHHHHcccEEEccHHHHHHcccEEEEEEccccHHHHHHHHccccccccEEEEEcccccHHHHHHHccccccEEEEccccHHHHHcccEEEEccccccHHHHHHHHHHHHccccEEEEccccccEEEEccccHHHHHHHHHHHHHccc
ccccccccHHHHcccccccccHHHHcccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHccccHHHHcHcccccccccccccHccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHEEccHHHHHHHHHHcccEEcccHHHHHHHccEEEEEEcHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcccccEEEEccccHHHHHccHEEEcccccccHHHHHHHHHHHHHcccEEEEcHHHccEEEEEcccHHHHHHHHHHHHHHcc
mrpqriwparraratetsQHTYASAkregtnasatregpeapyptaqarsarknasattreapeapqhVLQREARGnkwqrdaregsrtrpkqrnipaqkregnecasrtptradateapttpssrearwnrsdkqiagttergpgaLIASLNIVSKATgtmgakitfdnkevtlNSEVIILAVkphivpvalndikpvfnesnLLISVaggvpiknmeqalpknsriirampntpalvrQGASvfvrgssasdqdAQTVINLFKsvgtceevpeYLLDgitglsgsgpayryevtsnevinl
mrpqriwparraratetsqhtyasakregtnasatregpeapyptaqarsARKNASAttreapeapqhvlqreargnkwqrdaregsrtrpkqrnipaqkregnecasrtptradateapttpssrearwnrsdkqiagttergpgaliASLNIVSKATGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDGITglsgsgpayryevtsnevinl
MRPQRIWPARRARATETSQHTYASAKREGTNASATREGPEAPYPTAQARSARKNASATTREAPEAPQHVLQREARGNKWQRDAREGSRTRPKQRNIPAQKREGNECASRTPTRADATEAPTTPSSREARWNRSDKQIAGTTERGPGALIASLNIVSKATGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDGITGLSGSGPAYRYEVTSNEVINL
*************************************************************************************************************************************************GALIASLNIVSKATGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNM****************************************TVINLFKSVGTCEEVPEYLLDGITGLSGSGPAYRYEV********
**************T*******************************************************************************************************APTTPSSREARWNRSDKQIAGTTERGPGALIASLNIVSKATGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDGITGLSGSGPAYRYEVTSNEVINL
*******************************************************************HVLQRE*********************************************************NRSDKQIAGTTERGPGALIASLNIVSKATGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDGITGLSGSGPAYRYEVTSNEVINL
********************************************************************************************************************************RWNRSDKQIAGTTERGPGALIASLNIVSKATGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDGITGLSGSGPAYRYEVTSNEVINL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooo
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPQRIWPARRARATETSQHTYASAKREGTNASATREGPEAPYPTAQARSARKNASATTREAPEAPQHVLQREARGNKWQRDAREGSRTRPKQRNIPAQKREGNECASRTPTRADATEAPTTPSSREARWNRSDKQIAGTTERGPGALIASLNIVSKATGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDGITGLSGSGPAYRYEVTSNEVINL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query303 2.2.26 [Sep-21-2011]
Q5R9X6 319 Pyrroline-5-carboxylate r yes N/A 0.435 0.413 0.451 6e-28
P32322 319 Pyrroline-5-carboxylate r yes N/A 0.435 0.413 0.451 6e-28
Q17QJ7 320 Pyrroline-5-carboxylate r yes N/A 0.435 0.412 0.451 2e-27
Q58DT4 320 Pyrroline-5-carboxylate r no N/A 0.435 0.412 0.437 3e-27
Q4R6W7 320 Pyrroline-5-carboxylate r N/A N/A 0.435 0.412 0.444 5e-27
Q6AY23 320 Pyrroline-5-carboxylate r yes N/A 0.435 0.412 0.444 5e-27
Q922Q4 320 Pyrroline-5-carboxylate r yes N/A 0.435 0.412 0.444 5e-27
Q9DCC4274 Pyrroline-5-carboxylate r no N/A 0.429 0.474 0.407 1e-26
Q5PQJ6274 Pyrroline-5-carboxylate r no N/A 0.429 0.474 0.407 1e-26
Q53H96274 Pyrroline-5-carboxylate r no N/A 0.429 0.474 0.4 1e-26
>sp|Q5R9X6|P5CR1_PONAB Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Pongo abelii GN=PYCR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  125 bits (313), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 88/135 (65%), Gaps = 3/135 (2%)

Query: 162 MGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQA 221
           MG K+T  NKE   +S+V+ LAVKPHI+P  L++I     + ++++S A GV I ++E+ 
Sbjct: 48  MGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKK 107

Query: 222 LPKNS---RIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLL 278
           L       R+IR M NTP +VR+GA+V+  G+ A  +D + +  L  SVG C EV E L+
Sbjct: 108 LSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLI 167

Query: 279 DGITGLSGSGPAYRY 293
           D +TGLSGSGPAY +
Sbjct: 168 DAVTGLSGSGPAYAF 182




Housekeeping enzyme that catalyzes the last step in proline biosynthesis. Can utilize both NAD and NADP, but has higher affinity for NAD. Involved in the cellular response to oxidative stress.
Pongo abelii (taxid: 9601)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 2
>sp|P32322|P5CR1_HUMAN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens GN=PYCR1 PE=1 SV=2 Back     alignment and function description
>sp|Q17QJ7|P5CR2_BOVIN Pyrroline-5-carboxylate reductase 2 OS=Bos taurus GN=PYCR2 PE=2 SV=1 Back     alignment and function description
>sp|Q58DT4|P5CR1_BOVIN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Bos taurus GN=PYCR1 PE=2 SV=1 Back     alignment and function description
>sp|Q4R6W7|P5CR2_MACFA Pyrroline-5-carboxylate reductase 2 OS=Macaca fascicularis GN=PYCR2 PE=2 SV=1 Back     alignment and function description
>sp|Q6AY23|P5CR2_RAT Pyrroline-5-carboxylate reductase 2 OS=Rattus norvegicus GN=Pycr2 PE=2 SV=1 Back     alignment and function description
>sp|Q922Q4|P5CR2_MOUSE Pyrroline-5-carboxylate reductase 2 OS=Mus musculus GN=Pycr2 PE=2 SV=1 Back     alignment and function description
>sp|Q9DCC4|P5CR3_MOUSE Pyrroline-5-carboxylate reductase 3 OS=Mus musculus GN=Pycrl PE=2 SV=2 Back     alignment and function description
>sp|Q5PQJ6|P5CR3_RAT Pyrroline-5-carboxylate reductase 3 OS=Rattus norvegicus GN=Pycrl PE=2 SV=1 Back     alignment and function description
>sp|Q53H96|P5CR3_HUMAN Pyrroline-5-carboxylate reductase 3 OS=Homo sapiens GN=PYCRL PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
91079134279 PREDICTED: similar to pyrroline-5-carbox 0.455 0.494 0.557 7e-36
321454186275 hypothetical protein DAPPUDRAFT_65532 [D 0.435 0.48 0.537 1e-34
332373662276 unknown [Dendroctonus ponderosae] 0.452 0.496 0.528 8e-34
241647500281 pyrroline-5-carboxylate reductase, putat 0.435 0.469 0.515 3e-33
242018398271 Pyrroline-5-carboxylate reductase, putat 0.435 0.487 0.522 6e-33
242247397271 pyrroline-5-carboxylate reductase 3-like 0.442 0.494 0.525 6e-32
260815383268 hypothetical protein BRAFLDRAFT_63455 [B 0.435 0.492 0.477 8e-32
291232897288 PREDICTED: pyrroline-5-carboxylate reduc 0.442 0.465 0.477 2e-31
110611286247 pyrroline-5-carboxylate reductase 1 [Glo 0.481 0.591 0.476 2e-31
357528295237 pyrroline-5-carboxylate reductase [Lepti 0.455 0.582 0.503 3e-31
>gi|91079134|ref|XP_975446.1| PREDICTED: similar to pyrroline-5-carboxylate reductase [Tribolium castaneum] gi|270004224|gb|EFA00672.1| hypothetical protein TcasGA2_TC003549 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  157 bits (396), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 78/140 (55%), Positives = 99/140 (70%), Gaps = 2/140 (1%)

Query: 156 SKATGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPV--FNESNLLISVAGGV 213
           +KA   +GA+  F+N  V   S+VII++VKP +VP+AL DIK         L +S+A GV
Sbjct: 47  AKAFKELGAESLFENVPVVKKSDVIIVSVKPSVVPIALGDIKKAADVKADKLFLSIAMGV 106

Query: 214 PIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEV 273
            IK +EQ LP  SR++R MPNTPALVR G SVFV GS A+++DA+T   L ++VGTCE+V
Sbjct: 107 TIKQLEQFLPSESRVVRVMPNTPALVRSGTSVFVTGSRATEKDAETTKKLLQAVGTCEQV 166

Query: 274 PEYLLDGITGLSGSGPAYRY 293
           PE LLD IT LSGSGPAY Y
Sbjct: 167 PEGLLDAITALSGSGPAYIY 186




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321454186|gb|EFX65367.1| hypothetical protein DAPPUDRAFT_65532 [Daphnia pulex] Back     alignment and taxonomy information
>gi|332373662|gb|AEE61972.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|241647500|ref|XP_002411149.1| pyrroline-5-carboxylate reductase, putative [Ixodes scapularis] gi|215503779|gb|EEC13273.1| pyrroline-5-carboxylate reductase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|242018398|ref|XP_002429664.1| Pyrroline-5-carboxylate reductase, putative [Pediculus humanus corporis] gi|212514649|gb|EEB16926.1| Pyrroline-5-carboxylate reductase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|242247397|ref|NP_001156103.1| pyrroline-5-carboxylate reductase 3-like [Acyrthosiphon pisum] gi|239787990|dbj|BAH70693.1| ACYPI002263 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|260815383|ref|XP_002602453.1| hypothetical protein BRAFLDRAFT_63455 [Branchiostoma floridae] gi|229287762|gb|EEN58465.1| hypothetical protein BRAFLDRAFT_63455 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|291232897|ref|XP_002736390.1| PREDICTED: pyrroline-5-carboxylate reductase family, member 2-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|110611286|gb|ABG77992.1| pyrroline-5-carboxylate reductase 1 [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|357528295|gb|AET80386.1| pyrroline-5-carboxylate reductase [Leptinotarsa decemlineata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
WB|WBGene00010924279 M153.1 [Caenorhabditis elegans 0.438 0.476 0.488 4.9e-30
FB|FBgn0038516273 CG5840 [Drosophila melanogaste 0.481 0.534 0.443 3.9e-28
ZFIN|ZDB-GENE-050522-26 362 zgc:110655 "zgc:110655" [Danio 0.435 0.364 0.451 1.7e-27
ZFIN|ZDB-GENE-040426-1675 320 pycr1 "pyrroline-5-carboxylate 0.435 0.412 0.459 4.5e-27
UNIPROTKB|B4DMU0 346 PYCR1 "Pyrroline-5-carboxylate 0.435 0.381 0.451 1.2e-26
UNIPROTKB|J3KQ22253 PYCR1 "Pyrroline-5-carboxylate 0.435 0.521 0.451 1.2e-26
UNIPROTKB|J3QKT4242 PYCR1 "Pyrroline-5-carboxylate 0.435 0.545 0.451 1.2e-26
UNIPROTKB|J3QL24225 PYCR1 "Pyrroline-5-carboxylate 0.435 0.586 0.451 1.2e-26
UNIPROTKB|J3QL32217 PYCR1 "Pyrroline-5-carboxylate 0.435 0.608 0.451 1.2e-26
UNIPROTKB|P32322 319 PYCR1 "Pyrroline-5-carboxylate 0.435 0.413 0.451 1.2e-26
WB|WBGene00010924 M153.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 4.9e-30, P = 4.9e-30
 Identities = 66/135 (48%), Positives = 92/135 (68%)

Query:   162 MGAKITFDNKEVTLNSEVIILAVKP-HIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQ 220
             +G   T DN EV   S+V+ LAVKP H+  VA ++I P  ++ +L++S+A G+ I+N+E 
Sbjct:    48 LGLNTTHDNAEVVQKSDVVFLAVKPVHVSKVA-SEIAPALSKEHLVVSIALGITIRNIES 106

Query:   221 ALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDG 280
              LP  SR++R MPNTP++VR GAS F  GS+  D DA+TV  L  +VG   EVPE  +D 
Sbjct:   107 LLPTKSRVVRVMPNTPSVVRAGASAFAMGSACRDGDAETVEKLLSTVGFAVEVPEIHIDP 166

Query:   281 ITGLSGSGPAYRYEV 295
             +TGLSGSGP+Y + V
Sbjct:   167 VTGLSGSGPSYMFAV 181




GO:0004735 "pyrroline-5-carboxylate reductase activity" evidence=IEA
GO:0006561 "proline biosynthetic process" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0004616 "phosphogluconate dehydrogenase (decarboxylating) activity" evidence=IEA
GO:0006098 "pentose-phosphate shunt" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0046168 "glycerol-3-phosphate catabolic process" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0004455 "ketol-acid reductoisomerase activity" evidence=IEA
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA
FB|FBgn0038516 CG5840 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-26 zgc:110655 "zgc:110655" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1675 pycr1 "pyrroline-5-carboxylate reductase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4DMU0 PYCR1 "Pyrroline-5-carboxylate reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQ22 PYCR1 "Pyrroline-5-carboxylate reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QKT4 PYCR1 "Pyrroline-5-carboxylate reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QL24 PYCR1 "Pyrroline-5-carboxylate reductase 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QL32 PYCR1 "Pyrroline-5-carboxylate reductase 1, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P32322 PYCR1 "Pyrroline-5-carboxylate reductase 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.5.1.2LOW CONFIDENCE prediction!
3rd Layer1.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
PLN02688266 PLN02688, PLN02688, pyrroline-5-carboxylate reduct 1e-42
PRK11880267 PRK11880, PRK11880, pyrroline-5-carboxylate reduct 5e-41
TIGR00112245 TIGR00112, proC, pyrroline-5-carboxylate reductase 5e-41
COG0345266 COG0345, ProC, Pyrroline-5-carboxylate reductase [ 3e-38
PTZ00431260 PTZ00431, PTZ00431, pyrroline carboxylate reductas 4e-27
PRK07679279 PRK07679, PRK07679, pyrroline-5-carboxylate reduct 5e-27
PRK12491272 PRK12491, PRK12491, pyrroline-5-carboxylate reduct 9e-25
PRK07634245 PRK07634, PRK07634, pyrroline-5-carboxylate reduct 4e-15
PRK07680273 PRK07680, PRK07680, late competence protein ComER; 8e-10
pfam0380793 pfam03807, F420_oxidored, NADP oxidoreductase coen 1e-04
PRK06928277 PRK06928, PRK06928, pyrroline-5-carboxylate reduct 5e-04
>gnl|CDD|178291 PLN02688, PLN02688, pyrroline-5-carboxylate reductase Back     alignment and domain information
 Score =  147 bits (372), Expect = 1e-42
 Identities = 58/133 (43%), Positives = 84/133 (63%), Gaps = 1/133 (0%)

Query: 161 TMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQ 220
           ++G K    N EV  +S+VIILAVKP +V   L +++P+ ++  LL+SVA G+ + ++++
Sbjct: 46  SLGVKTAASNTEVVKSSDVIILAVKPQVVKDVLTELRPLLSKDKLLVSVAAGITLADLQE 105

Query: 221 ALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDG 280
                 R++R MPNTP LV + ASV   G +A+  D   V  LF +VG    V E LLD 
Sbjct: 106 WAGGR-RVVRVMPNTPCLVGEAASVMSLGPAATADDRDLVATLFGAVGKIWVVDEKLLDA 164

Query: 281 ITGLSGSGPAYRY 293
           +TGLSGSGPAY +
Sbjct: 165 VTGLSGSGPAYIF 177


Length = 266

>gnl|CDD|237008 PRK11880, PRK11880, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|232829 TIGR00112, proC, pyrroline-5-carboxylate reductase Back     alignment and domain information
>gnl|CDD|223422 COG0345, ProC, Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|173621 PTZ00431, PTZ00431, pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>gnl|CDD|181079 PRK07679, PRK07679, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|105695 PRK12491, PRK12491, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181063 PRK07634, PRK07634, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181080 PRK07680, PRK07680, late competence protein ComER; Validated Back     alignment and domain information
>gnl|CDD|202773 pfam03807, F420_oxidored, NADP oxidoreductase coenzyme F420-dependent Back     alignment and domain information
>gnl|CDD|235888 PRK06928, PRK06928, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 303
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 100.0
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 100.0
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.97
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.97
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.96
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.96
PLN02688266 pyrroline-5-carboxylate reductase 99.96
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.95
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 99.95
KOG3124|consensus267 99.94
PRK07680273 late competence protein ComER; Validated 99.94
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 99.94
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.9
PRK07417279 arogenate dehydrogenase; Reviewed 99.77
PLN02256304 arogenate dehydrogenase 99.77
PRK06545 359 prephenate dehydrogenase; Validated 99.76
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.76
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.75
PRK08507275 prephenate dehydrogenase; Validated 99.7
PRK05479 330 ketol-acid reductoisomerase; Provisional 99.69
PRK08655 437 prephenate dehydrogenase; Provisional 99.69
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.68
PRK08818 370 prephenate dehydrogenase; Provisional 99.65
PLN02712 667 arogenate dehydrogenase 99.63
PLN02712 667 arogenate dehydrogenase 99.63
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 99.53
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.53
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.53
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.5
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.48
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.47
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.47
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.46
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.44
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.41
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.4
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.36
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.35
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.35
PRK06444197 prephenate dehydrogenase; Provisional 99.33
PRK12557 342 H(2)-dependent methylenetetrahydromethanopterin de 99.33
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.29
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 99.27
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.27
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.26
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.26
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.25
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.23
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.23
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 99.22
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.22
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 99.2
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 99.2
PRK15059 292 tartronate semialdehyde reductase; Provisional 99.19
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.18
KOG0409|consensus 327 99.18
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.17
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 99.16
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 99.15
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.14
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.13
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 99.12
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.11
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 99.1
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 99.09
KOG2380|consensus 480 99.09
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 99.07
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.04
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.02
PLN02858 1378 fructose-bisphosphate aldolase 98.91
PLN02858 1378 fructose-bisphosphate aldolase 98.89
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 98.88
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 98.85
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 98.84
PRK05708305 2-dehydropantoate 2-reductase; Provisional 98.83
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 98.82
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.81
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.79
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 98.78
TIGR01724 341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 98.74
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 98.69
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 98.65
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 98.62
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 98.58
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 98.55
KOG2711|consensus 372 98.54
PRK13403 335 ketol-acid reductoisomerase; Provisional 98.54
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.46
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 98.35
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.22
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 98.22
PRK11730 715 fadB multifunctional fatty acid oxidation complex 98.22
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.22
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 98.18
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 98.16
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 98.13
PLN02353 473 probable UDP-glucose 6-dehydrogenase 98.09
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 98.05
PRK08605332 D-lactate dehydrogenase; Validated 98.03
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.02
PRK05225 487 ketol-acid reductoisomerase; Validated 97.99
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.94
PRK12480330 D-lactate dehydrogenase; Provisional 97.93
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 97.88
PRK07574385 formate dehydrogenase; Provisional 97.83
PRK13243333 glyoxylate reductase; Reviewed 97.83
PLN03139386 formate dehydrogenase; Provisional 97.76
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 97.75
COG4007 340 Predicted dehydrogenase related to H2-forming N5,N 97.68
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 97.59
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 97.59
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 97.57
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 97.54
PRK08269 314 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.53
PRK06436303 glycerate dehydrogenase; Provisional 97.52
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.5
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.49
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.46
PLN02928347 oxidoreductase family protein 97.46
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 97.45
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.45
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.44
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.42
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.42
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.41
PRK06932314 glycerate dehydrogenase; Provisional 97.39
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 97.33
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.3
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 97.27
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 97.24
PRK00048257 dihydrodipicolinate reductase; Provisional 97.21
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 97.2
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 97.2
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.17
PRK06487317 glycerate dehydrogenase; Provisional 97.15
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.14
PRK13303265 L-aspartate dehydrogenase; Provisional 97.12
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 97.11
TIGR00036266 dapB dihydrodipicolinate reductase. 97.08
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.04
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 97.02
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 97.01
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 96.95
PLN02306386 hydroxypyruvate reductase 96.9
PRK06141314 ornithine cyclodeaminase; Validated 96.88
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.87
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.83
KOG0069|consensus336 96.73
PRK06223307 malate dehydrogenase; Reviewed 96.72
PRK11579 346 putative oxidoreductase; Provisional 96.66
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.66
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.63
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 96.62
TIGR01851 310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 96.55
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.54
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.49
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 96.4
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 96.4
PRK08300 302 acetaldehyde dehydrogenase; Validated 96.37
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 96.35
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 96.3
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.29
COG5495289 Uncharacterized conserved protein [Function unknow 96.25
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 96.2
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.18
PRK07340304 ornithine cyclodeaminase; Validated 96.05
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 95.98
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.97
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 95.96
KOG2653|consensus 487 95.95
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.93
PTZ00117 319 malate dehydrogenase; Provisional 95.8
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 95.64
KOG2304|consensus298 95.64
PRK13301267 putative L-aspartate dehydrogenase; Provisional 95.63
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.57
PRK15076 431 alpha-galactosidase; Provisional 95.52
PRK10206 344 putative oxidoreductase; Provisional 95.48
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 95.47
COG0673 342 MviM Predicted dehydrogenases and related proteins 95.38
PLN02383 344 aspartate semialdehyde dehydrogenase 95.36
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 95.3
PRK08618325 ornithine cyclodeaminase; Validated 95.22
PLN02602 350 lactate dehydrogenase 95.19
PRK07589346 ornithine cyclodeaminase; Validated 94.97
PRK06270 341 homoserine dehydrogenase; Provisional 94.9
COG4074343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 94.89
PRK02318 381 mannitol-1-phosphate 5-dehydrogenase; Provisional 94.88
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.86
PTZ00082321 L-lactate dehydrogenase; Provisional 94.86
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 94.73
PRK06046326 alanine dehydrogenase; Validated 94.73
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 94.7
KOG2305|consensus313 94.67
PRK06823315 ornithine cyclodeaminase; Validated 94.61
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 94.6
KOG2666|consensus 481 94.53
PRK08374 336 homoserine dehydrogenase; Provisional 94.5
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 94.49
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 94.41
KOG0068|consensus406 94.38
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 94.34
PTZ00075476 Adenosylhomocysteinase; Provisional 94.22
PRK05442 326 malate dehydrogenase; Provisional 94.1
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 93.98
PRK06407301 ornithine cyclodeaminase; Provisional 93.92
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 93.88
PLN00203519 glutamyl-tRNA reductase 93.7
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 93.59
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 93.55
PRK05086 312 malate dehydrogenase; Provisional 93.42
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 93.41
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 93.39
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 93.39
PTZ00325 321 malate dehydrogenase; Provisional 93.31
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.2
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 93.17
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 93.13
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 93.11
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 93.1
PRK08291330 ectoine utilization protein EutC; Validated 93.07
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 92.86
PF10100 429 DUF2338: Uncharacterized protein conserved in bact 92.85
PLN02494477 adenosylhomocysteinase 92.81
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 92.79
PRK06349 426 homoserine dehydrogenase; Provisional 92.76
COG2344211 AT-rich DNA-binding protein [General function pred 92.69
PLN00112 444 malate dehydrogenase (NADP); Provisional 92.67
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 92.62
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 92.61
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 92.38
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 92.36
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 92.35
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.22
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 92.12
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 92.06
TIGR01757 387 Malate-DH_plant malate dehydrogenase, NADP-depende 92.05
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 92.04
COG0569225 TrkA K+ transport systems, NAD-binding component [ 91.91
COG0136 334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 91.87
PRK13940414 glutamyl-tRNA reductase; Provisional 91.65
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 91.64
PRK09496 453 trkA potassium transporter peripheral membrane com 91.3
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 91.23
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 90.89
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 90.65
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.48
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 90.4
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 90.35
PLN00106323 malate dehydrogenase 90.21
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 90.07
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 90.03
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 89.97
COG4408 431 Uncharacterized protein conserved in bacteria [Fun 89.91
PRK05678 291 succinyl-CoA synthetase subunit alpha; Validated 89.89
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 89.79
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.67
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 89.58
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.13
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 89.12
PRK06392 326 homoserine dehydrogenase; Provisional 88.78
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 88.65
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 88.63
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 88.51
PRK06199379 ornithine cyclodeaminase; Validated 88.34
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 88.17
TIGR01745 366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 88.11
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 88.02
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 87.71
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 87.45
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 87.33
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 87.32
KOG2741|consensus 351 87.17
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 86.93
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.82
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 86.77
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 86.41
COG2910211 Putative NADH-flavin reductase [General function p 86.33
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 86.0
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.93
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 85.85
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 85.73
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.6
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 85.47
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.41
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 85.39
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 85.21
PRK06153393 hypothetical protein; Provisional 85.2
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 85.11
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.11
COG1486 442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 84.87
PRK06813 346 homoserine dehydrogenase; Validated 84.8
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.74
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.67
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.6
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 84.5
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.2
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.09
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.05
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 83.86
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 83.45
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.16
PRK06718202 precorrin-2 dehydrogenase; Reviewed 83.05
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.99
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 82.72
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.42
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 82.23
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.18
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.16
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 81.97
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 81.95
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 81.92
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 81.89
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.82
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.62
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 81.6
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 81.43
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 81.43
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 81.11
PRK12549284 shikimate 5-dehydrogenase; Reviewed 80.86
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 80.55
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.49
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 80.41
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 80.13
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 80.03
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 80.03
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=6.3e-35  Score=271.89  Aligned_cols=168  Identities=35%  Similarity=0.524  Sum_probs=150.1

Q ss_pred             CCcEEEEcCChhhHHHHHHHHh-------------hcHHH----HhhCCCeEecChHHhhcCCCEEEEeeCCccHHHHHH
Q psy6714         132 RSDKQIAGTTERGPGALIASLN-------------IVSKA----TGTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALN  194 (303)
Q Consensus       132 ~mkIgIIGlG~MG~~~La~al~-------------r~~e~----l~e~Gv~v~~d~~eav~~ADIVILAVpP~~v~~VL~  194 (303)
                      +|||||||.|+||.+++...++             +..++    ..++|+..+.++.++++++|+|||||||+++++||.
T Consensus         1 ~~~IgfIG~G~Mg~Ai~~gl~~~g~~~~~~I~v~~~~~e~~~~l~~~~g~~~~~~~~~~~~~advv~LavKPq~~~~vl~   80 (266)
T COG0345           1 MMKIGFIGAGNMGEAILSGLLKSGALPPEEIIVTNRSEEKRAALAAEYGVVTTTDNQEAVEEADVVFLAVKPQDLEEVLS   80 (266)
T ss_pred             CceEEEEccCHHHHHHHHHHHhcCCCCcceEEEeCCCHHHHHHHHHHcCCcccCcHHHHHhhCCEEEEEeChHhHHHHHH
Confidence            5899999999999954332221             22222    336788766777899999999999999999999999


Q ss_pred             hhccccCCCCEEEEecCCCcHHHHHhhCCCCCceEEEecCcHHhhhCCcEEEEeCCCCCHHHHHHHHHHHHhcCCcEEcC
Q psy6714         195 DIKPVFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVP  274 (303)
Q Consensus       195 eI~~~L~~g~IVVSiaaGV~ie~L~~~l~~~~~VVr~mPn~p~~v~~G~til~~g~~~~~e~~e~V~~Lfs~iG~~v~vd  274 (303)
                      ++++ +.++++|||+++|++++.|+.+++ +.+++|+|||+|+.++.|++.++++.++++++.+.+.+||+.+|.+++|+
T Consensus        81 ~l~~-~~~~~lvISiaAGv~~~~l~~~l~-~~~vvR~MPNt~a~vg~g~t~i~~~~~~~~~~~~~v~~l~~~~G~v~~v~  158 (266)
T COG0345          81 KLKP-LTKDKLVISIAAGVSIETLERLLG-GLRVVRVMPNTPALVGAGVTAISANANVSEEDKAFVEALLSAVGKVVEVE  158 (266)
T ss_pred             Hhhc-ccCCCEEEEEeCCCCHHHHHHHcC-CCceEEeCCChHHHHcCcceeeecCccCCHHHHHHHHHHHHhcCCeEEec
Confidence            9998 778999999999999999999999 68999999999999999999999999999999999999999999999999


Q ss_pred             CCCchhhhhhccchHHHHHHHHHhhhh
Q psy6714         275 EYLLDGITGLSGSGPAYRYEVTSNEVI  301 (303)
Q Consensus       275 E~~~Da~tAlsGsgPAf~~~~ie~~~~  301 (303)
                      |++||++||++||||||+|+|+|+|+.
T Consensus       159 E~~~da~TaisGSgPAyv~~~iEal~~  185 (266)
T COG0345         159 ESLMDAVTALSGSGPAYVFLFIEALAD  185 (266)
T ss_pred             hHHhhHHHHHhcCCHHHHHHHHHHHHH
Confidence            999999999999999999999999974



>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>KOG3124|consensus Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>KOG2711|consensus Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>KOG2653|consensus Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>KOG2305|consensus Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG2666|consensus Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>KOG2741|consensus Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
2ger_A 321 Crystal Structure And Oxidative Mechanism Of Human 4e-29
2gr9_A277 Crystal Structure Of P5cr Complexed With Nadh Lengt 4e-29
2izz_A 322 Crystal Structure Of Human Pyrroline-5-Carboxylate 5e-29
2rcy_A262 Crystal Structure Of Plasmodium Falciparum Pyrrolin 3e-19
3tri_A280 Structure Of A Pyrroline-5-Carboxylate Reductase (P 2e-16
3gt0_A247 Crystal Structure Of Pyrroline 5-Carboxylate Reduct 7e-16
1yqg_A263 Crystal Structure Of A Pyrroline-5-Carboxylate Redu 4e-11
2amf_A259 Crystal Structure Of 1-Pyrroline-5-Carboxylate Redu 5e-07
2ahr_A259 Crystal Structures Of 1-Pyrroline-5-Carboxylate Red 7e-06
>pdb|2GER|A Chain A, Crystal Structure And Oxidative Mechanism Of Human Pyrroline-5- Carboxylate Reductase Length = 321 Back     alignment and structure

Iteration: 1

Score = 125 bits (313), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 61/135 (45%), Positives = 88/135 (65%), Gaps = 3/135 (2%) Query: 162 MGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQA 221 MG K+T NKE +S+V+ LAVKPHI+P L++I + ++++S A GV I ++E+ Sbjct: 50 MGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKK 109 Query: 222 LPKNS---RIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLL 278 L R+IR M NTP +VR+GA+V+ G+ A +D + + L SVG C EV E L+ Sbjct: 110 LSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLI 169 Query: 279 DGITGLSGSGPAYRY 293 D +TGLSGSGPAY + Sbjct: 170 DAVTGLSGSGPAYAF 184
>pdb|2GR9|A Chain A, Crystal Structure Of P5cr Complexed With Nadh Length = 277 Back     alignment and structure
>pdb|2IZZ|A Chain A, Crystal Structure Of Human Pyrroline-5-Carboxylate Reductase Length = 322 Back     alignment and structure
>pdb|2RCY|A Chain A, Crystal Structure Of Plasmodium Falciparum Pyrroline Carboxylate Reductase (Mal13p1.284) With Nadp Bound Length = 262 Back     alignment and structure
>pdb|3TRI|A Chain A, Structure Of A Pyrroline-5-Carboxylate Reductase (Proc) From Coxiella Burnetii Length = 280 Back     alignment and structure
>pdb|3GT0|A Chain A, Crystal Structure Of Pyrroline 5-Carboxylate Reductase From Bacillus Cereus. Northeast Structural Genomics Consortium Target Bcr38b Length = 247 Back     alignment and structure
>pdb|1YQG|A Chain A, Crystal Structure Of A Pyrroline-5-Carboxylate Reductase From Neisseria Meningitides Mc58 Length = 263 Back     alignment and structure
>pdb|2AMF|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Reductase From Human Pathogen Streptococcus Pyogenes Length = 259 Back     alignment and structure
>pdb|2AHR|A Chain A, Crystal Structures Of 1-Pyrroline-5-Carboxylate Reductase From Human Pathogen Streptococcus Pyogenes Length = 259 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 1e-57
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 5e-55
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 1e-53
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 3e-53
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 7e-52
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 1e-46
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Length = 247 Back     alignment and structure
 Score =  185 bits (471), Expect = 1e-57
 Identities = 50/133 (37%), Positives = 80/133 (60%)

Query: 161 TMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQ 220
             G   T DN EV  N++++IL++KP +    +N+IK +     +++++A G  I++ E 
Sbjct: 48  KYGLTTTTDNNEVAKNADILILSIKPDLYASIINEIKEIIKNDAIIVTIAAGKSIESTEN 107

Query: 221 ALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPEYLLDG 280
           A  K  +++R MPNTPALV +G S        +++D + V+N+F S G  E V E L+D 
Sbjct: 108 AFNKKVKVVRVMPNTPALVGEGMSALCPNEMVTEKDLEDVLNIFNSFGQTEIVSEKLMDV 167

Query: 281 ITGLSGSGPAYRY 293
           +T +SGS PAY Y
Sbjct: 168 VTSVSGSSPAYVY 180


>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Length = 262 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Length = 322 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Length = 259 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Length = 280 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Length = 263 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.97
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.96
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.93
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.91
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.88
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.87
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 99.83
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.82
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.81
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 99.76
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 99.76
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.76
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.76
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.74
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.74
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.72
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.66
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.66
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.65
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.64
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.61
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.61
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.6
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.59
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.57
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.55
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 99.52
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.24
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 99.49
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.48
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.48
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.48
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.46
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.46
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.46
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 99.46
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.45
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.44
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.43
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.43
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 99.41
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.41
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.41
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.4
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.4
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 99.38
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.37
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.37
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.37
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.36
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.35
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.34
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.33
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 99.32
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 99.31
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.3
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.3
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.3
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.3
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.29
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.28
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.27
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.27
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.24
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 99.21
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.21
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 99.19
4ezb_A 317 Uncharacterized conserved protein; structural geno 99.19
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.17
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.16
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 99.09
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 99.09
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.07
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.05
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 98.98
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.91
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 98.82
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 98.79
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 98.71
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.69
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 98.67
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 98.66
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 98.65
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 98.62
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 98.61
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 98.61
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 98.43
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 98.43
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 98.37
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 98.35
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 98.32
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 98.31
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.24
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 98.24
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 98.23
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 98.19
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 98.17
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.16
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 98.12
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 98.11
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 98.11
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 98.09
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 98.08
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 98.08
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.07
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.05
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 98.03
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 98.02
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 98.01
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.0
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 98.0
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 98.0
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 97.99
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 97.97
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.96
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.96
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.93
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.93
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.92
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.9
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.9
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.9
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 97.88
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.88
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.87
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 97.84
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.84
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.83
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 97.83
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 97.8
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 97.79
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.79
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.77
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.75
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.75
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.75
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.74
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.73
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 97.72
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.72
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.7
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.7
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.69
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.67
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 97.65
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 97.64
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 97.63
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.61
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.59
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 97.58
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.57
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 97.56
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 97.54
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 97.52
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 97.52
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.5
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.49
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.48
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 97.45
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.45
2duw_A145 Putative COA-binding protein; ligand binding prote 97.44
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 97.44
1ydw_A 362 AX110P-like protein; structural genomics, protein 97.43
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 97.42
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.41
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 97.4
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 97.39
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 97.37
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.37
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 97.31
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.26
4had_A 350 Probable oxidoreductase protein; structural genomi 97.26
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.26
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 97.25
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 97.25
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.23
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.22
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 97.13
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.12
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.11
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.09
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.08
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 97.08
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.08
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.07
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.05
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 96.97
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.94
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 96.93
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 96.93
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.9
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.89
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.88
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 96.87
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 96.86
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 96.85
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 96.83
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.81
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.79
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 96.77
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.75
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 96.73
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 96.72
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 96.71
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 96.69
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 96.67
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 96.66
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 96.63
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 96.58
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.57
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.56
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.55
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 96.54
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 96.54
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 96.52
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.52
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 96.51
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 96.5
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 96.48
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 96.37
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 96.36
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 96.36
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 96.31
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.3
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.29
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 96.25
2d59_A144 Hypothetical protein PH1109; COA binding, structur 96.24
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.24
1vkn_A 351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 96.24
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 96.22
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 96.21
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.17
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 96.17
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 96.16
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 96.15
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.1
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.1
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 96.09
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 96.08
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.03
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.02
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.99
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 95.97
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 95.93
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.89
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.89
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 95.86
4h3v_A 390 Oxidoreductase domain protein; structural genomics 95.85
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 95.81
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 95.8
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 95.79
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 95.73
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 95.72
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.72
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.69
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 95.68
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.66
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.63
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 95.62
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 95.61
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 95.55
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.5
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 95.44
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 95.4
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 95.38
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 95.29
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 95.16
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 94.99
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 94.91
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.88
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 94.84
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 94.83
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 94.77
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 94.76
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 94.67
2fp4_A 305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 94.6
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 94.58
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 94.35
3tl2_A315 Malate dehydrogenase; center for structural genomi 94.34
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 94.17
2yv2_A 297 Succinyl-COA synthetase alpha chain; COA-binding d 93.88
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 93.87
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 93.8
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.79
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.78
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 93.78
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 93.75
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 93.72
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 93.66
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 93.41
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 93.4
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 93.4
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 93.14
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 93.07
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 93.01
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 92.95
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 92.92
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 92.83
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 92.7
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 92.62
1up7_A 417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 92.44
7mdh_A 375 Protein (malate dehydrogenase); chloroplastic mala 92.13
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 91.88
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 91.2
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 90.56
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 90.36
2yv3_A 331 Aspartate-semialdehyde dehydrogenase; aspartate pa 90.3
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 90.26
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 90.09
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 90.07
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 89.97
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 89.94
3l07_A285 Bifunctional protein fold; structural genomics, ID 89.9
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 89.79
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 89.28
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 89.0
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 88.95
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 88.79
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 88.74
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 88.65
3p2o_A285 Bifunctional protein fold; structural genomics, ce 88.61
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 88.52
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 88.16
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 87.94
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 87.75
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 87.54
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 86.74
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 85.2
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 85.06
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 84.74
4g65_A 461 TRK system potassium uptake protein TRKA; structur 84.69
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 84.12
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 83.6
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 83.29
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 83.28
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 82.96
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 82.86
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 82.73
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 80.85
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 80.14
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
Probab=99.97  E-value=3.3e-30  Score=238.87  Aligned_cols=169  Identities=31%  Similarity=0.444  Sum_probs=149.5

Q ss_pred             CCcEEEEcCChhhHHHHHHHHh-------------hcHH---HHhh-CCCeEecChHHhhcCCCEEEEeeCCccHHHHHH
Q psy6714         132 RSDKQIAGTTERGPGALIASLN-------------IVSK---ATGT-MGAKITFDNKEVTLNSEVIILAVKPHIVPVALN  194 (303)
Q Consensus       132 ~mkIgIIGlG~MG~~~La~al~-------------r~~e---~l~e-~Gv~v~~d~~eav~~ADIVILAVpP~~v~~VL~  194 (303)
                      +|||+|||+|+||.+ ++..+.             ++.+   .+.+ +|+.+..++.++++++|+||+||||+.+.++++
T Consensus         3 ~~~I~iIG~G~mG~a-ia~~l~~~g~~~~~V~v~dr~~~~~~~l~~~~gi~~~~~~~~~~~~aDvVilav~p~~~~~vl~   81 (280)
T 3tri_A            3 TSNITFIGGGNMARN-IVVGLIANGYDPNRICVTNRSLDKLDFFKEKCGVHTTQDNRQGALNADVVVLAVKPHQIKMVCE   81 (280)
T ss_dssp             CSCEEEESCSHHHHH-HHHHHHHTTCCGGGEEEECSSSHHHHHHHHTTCCEEESCHHHHHSSCSEEEECSCGGGHHHHHH
T ss_pred             CCEEEEEcccHHHHH-HHHHHHHCCCCCCeEEEEeCCHHHHHHHHHHcCCEEeCChHHHHhcCCeEEEEeCHHHHHHHHH
Confidence            589999999999994 554421             1112   2333 599888899999999999999999999999999


Q ss_pred             hhccc-cCCCCEEEEecCCCcHHHHHhhCCCCCceEEEecCcHHhhhCCcEEEEeCCCCCHHHHHHHHHHHHhcCCcEEc
Q psy6714         195 DIKPV-FNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEV  273 (303)
Q Consensus       195 eI~~~-L~~g~IVVSiaaGV~ie~L~~~l~~~~~VVr~mPn~p~~v~~G~til~~g~~~~~e~~e~V~~Lfs~iG~~v~v  273 (303)
                      ++.++ ++++++|||+++|++++.|++.++.+.+++++|||+|..+++|++.++++...++++++.+++||+.+|.++++
T Consensus        82 ~l~~~~l~~~~iiiS~~agi~~~~l~~~l~~~~~vvr~mPn~p~~v~~g~~~l~~~~~~~~~~~~~v~~l~~~iG~~~~v  161 (280)
T 3tri_A           82 ELKDILSETKILVISLAVGVTTPLIEKWLGKASRIVRAMPNTPSSVRAGATGLFANETVDKDQKNLAESIMRAVGLVIWV  161 (280)
T ss_dssp             HHHHHHHTTTCEEEECCTTCCHHHHHHHHTCCSSEEEEECCGGGGGTCEEEEEECCTTSCHHHHHHHHHHHGGGEEEEEC
T ss_pred             HHHhhccCCCeEEEEecCCCCHHHHHHHcCCCCeEEEEecCChHHhcCccEEEEeCCCCCHHHHHHHHHHHHHCCCeEEE
Confidence            99988 87888999999999999999999866789999999999999999999988888999999999999999999888


Q ss_pred             -CCCCchhhhhhccchHHHHHHHHHhhhh
Q psy6714         274 -PEYLLDGITGLSGSGPAYRYEVTSNEVI  301 (303)
Q Consensus       274 -dE~~~Da~tAlsGsgPAf~~~~ie~~~~  301 (303)
                       +|++||++++++||||||+|+|+++|..
T Consensus       162 ~~E~~~d~~talsgsgpa~~~~~~eal~~  190 (280)
T 3tri_A          162 SSEDQIEKIAALSGSGPAYIFLIMEALQE  190 (280)
T ss_dssp             SSHHHHHHHHHHTTSHHHHHHHHHHHHHH
T ss_pred             CCHHHhhHHHHHhccHHHHHHHHHHHHHH
Confidence             6899999999999999999999999863



>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 303
d1yqga2152 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductas 1e-12
d2ahra2152 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductas 4e-08
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 1e-07
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Length = 152 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Pyrroline-5-carboxylate reductase ProC
species: Neisseria meningitidis, serogroup B [TaxId: 487]
 Score = 62.3 bits (150), Expect = 1e-12
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 178 EVIILAVKPHIVPVALNDIKPVFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPA 237
           +V+ILAVKP  +  A  +I+       L++SVA G+ +  + + L    RI+R MPNTP 
Sbjct: 59  DVLILAVKPQDMEAACKNIR---TNGALVLSVAAGLSVGTLSRYLGGTRRIVRVMPNTPG 115

Query: 238 LVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEV 273
            +  G S     +  S+ D +    + KSVG    +
Sbjct: 116 KIGLGVSGMYAEAEVSETDRRIADRIMKSVGLTVWL 151


>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Length = 152 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.93
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.91
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.71
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.64
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.61
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.48
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.4
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.35
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.32
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.29
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.23
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.15
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.12
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.91
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 98.88
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 98.87
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.86
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 98.84
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 98.69
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.14
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 98.06
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.86
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.83
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.71
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.67
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 97.52
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.48
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.48
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.42
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 97.38
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.37
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.37
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.35
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 97.31
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.28
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.26
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 97.26
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.2
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.19
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.18
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 97.09
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 97.02
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.97
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.96
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 96.95
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 96.93
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.89
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 96.88
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 96.87
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 96.8
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.76
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 96.71
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.71
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.7
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.64
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.62
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.6
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.52
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.52
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.46
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.42
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 96.3
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.2
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 96.12
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.08
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 96.06
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.97
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 95.89
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 95.85
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.85
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.84
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.7
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.6
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.51
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.4
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.37
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.08
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.01
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 94.99
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 94.8
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 94.68
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.51
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 93.57
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 93.24
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 93.17
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 93.03
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.95
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 92.14
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.01
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 91.88
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 91.47
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.47
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 89.42
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.24
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 89.02
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 88.56
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 88.18
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.6
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 87.05
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.93
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 86.67
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 85.8
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 84.18
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 82.51
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 82.29
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 82.27
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 82.21
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 81.28
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 80.22
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Pyrroline-5-carboxylate reductase ProC
species: Streptococcus pyogenes [TaxId: 1314]
Probab=99.93  E-value=5.3e-26  Score=191.26  Aligned_cols=138  Identities=18%  Similarity=0.333  Sum_probs=120.8

Q ss_pred             CcEEEEcCChhhHHHHHHHHh----------hcHH---HH-hhCCCeEecChHHhhcCCCEEEEeeCCccHHHHHHhhcc
Q psy6714         133 SDKQIAGTTERGPGALIASLN----------IVSK---AT-GTMGAKITFDNKEVTLNSEVIILAVKPHIVPVALNDIKP  198 (303)
Q Consensus       133 mkIgIIGlG~MG~~~La~al~----------r~~e---~l-~e~Gv~v~~d~~eav~~ADIVILAVpP~~v~~VL~eI~~  198 (303)
                      |||||||+|+||.+ |+..+.          +..+   .+ +++|+.+..++.+++++||+|||||||+++.++++++  
T Consensus         1 MkIg~IG~G~mG~a-l~~~l~~~~~~i~v~~r~~~~~~~l~~~~g~~~~~~~~~~~~~~dvIilavkp~~~~~vl~~l--   77 (152)
T d2ahra2           1 MKIGIIGVGKMASA-IIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKPQLFETVLKPL--   77 (152)
T ss_dssp             CEEEEECCSHHHHH-HHHHHTTSSCEEEEECSSHHHHHHHHHHHTCCBCSSHHHHHHTCSEEEECSCGGGHHHHHTTS--
T ss_pred             CEEEEEeccHHHHH-HHHHHHhCCCeEEEEcChHHhHHhhccccceeeechhhhhhhccceeeeecchHhHHHHhhhc--
Confidence            89999999999994 665431          2222   22 4568888899999999999999999999999998765  


Q ss_pred             ccCCCCEEEEecCCCcHHHHHhhCCCCCceEEEecCcHHhhhCCcEEEEeCCCCCHHHHHHHHHHHHhcCCcEEcCC
Q psy6714         199 VFNESNLLISVAGGVPIKNMEQALPKNSRIIRAMPNTPALVRQGASVFVRGSSASDQDAQTVINLFKSVGTCEEVPE  275 (303)
Q Consensus       199 ~L~~g~IVVSiaaGV~ie~L~~~l~~~~~VVr~mPn~p~~v~~G~til~~g~~~~~e~~e~V~~Lfs~iG~~v~vdE  275 (303)
                        +++++|||+++|++++.|++.++.+.+++|+|||+|..+++|.+.++.+...++++++.+++||+.+|.+++++|
T Consensus        78 --~~~~~iis~~agi~~~~l~~~l~~~~~ivr~mPN~~~~v~~g~~~~~~~~~~~~~~~~~v~~l~~~~G~~~~v~E  152 (152)
T d2ahra2          78 --HFKQPIISMAAGISLQRLATFVGQDLPLLRIMPNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISE  152 (152)
T ss_dssp             --CCCSCEEECCTTCCHHHHHHHHCTTSCEEEEECCGGGGGTCEEEEEEECTTCCHHHHHHHHHHHHTTEEEEECCG
T ss_pred             --ccceeEecccccccHHHHHhhhcccccchhhccchhhhcCccceEEEeCCCCCHHHHHHHHHHHHhCCCEEEecC
Confidence              467899999999999999999987778999999999999999999999988899999999999999999999986



>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure