Psyllid ID: psy673

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510--
MAFYQRTVTPQVVAMVGLPAREFSKMAFYQRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTEDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAYKVRKKTHFLLSSRNMTLELIFPHHSTGTLRPQPFGHLDFPHTGCSSTKDNLV
cccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEEEccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccEEEEEEcccccHHHHHHHHHHccccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHcHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHcccccccccccccccEEEEEcccccEEEEEcccccEEEEEccccccccccccccccccccc
ccHHHHHcccccccEEEccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHcccccccccccccccccccccHccHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHcccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHHHcHHHccccHHHHHHHHHHHHHHHHccccccccccccEEEEEccccEEEEEccccHHHHHHHHHHcccccccccEEEEEcccEHHHHcccccccccEcHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHccccccEEEcHHHcccccHHHccccHHHHHHHcHHHHHHHHHccccccccccccHHHHHHHcHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHcccHHHcccEEEEcccEEEcEEEEEEEEccccccccccccccccccccccccHHHHccccc
mafyqrtvTPQVVAMVGlparefskmafyqrTVTPQVVAMvglpargksyMATKLCRYLRWLGlnvrlfnlgdyrrrhasissathdffrsdneyaLSIRDQIALQALEDLddwiikgghfpqlgdyrrrhasgsrathdffrsdneyaLSIRDQIALQALEDLDDWIIKGGQvaffdatnstqARRNTIHHKIVEERQYMLFFVEslcddpdildrnikevkltgpdyqgfepdkayEDFMYRIGHYEKQYQTLTEDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLnitprtvyltrpgesinnvqailggdsdltaggqeYSKCLSDFvseknlsdlrIWTSSKEAAKQTvaqcpgshkeykalddihagicegqTYTEIYTNHcaqyidtradkfynrwpqgecykDVLTRLELIILKIEHsksnllivSHPAVLRCLLgyfqeeppdrfayKVRKKTHFLLSSRNMTlelifphhstgtlrpqpfghldfphtgcsstkdnlv
mafyqrtvtpqvvaMVGLPAREFSKMAFYQRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASissathdffRSDNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDILDRNIKevkltgpdyqgfepDKAYEDFMYRIGHYEKQYQTLTEDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAYKVRKKTHFLLSSRNMTLELIFPHHSTGTLRPQPFGHLdfphtgcsstkdnlv
MAFYQRTVTPQVVAMVGLPAREFSKMAFYQRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTEDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAYKVRKKTHFLLSSRNMTLELIFPHHSTGTLRPQPFGHLDFPHTGCSSTKDNLV
***YQRTVTPQVVAMVGLPAREFSKMAFYQRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHA***RATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTEDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTS********VAQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAYKVRKKTHFLLSSRNMTLELIFPHHSTGTLR***FG*****************
***********************************QVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRR***********************************DWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTEDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAYKVRKKTHFLLSSRNMTLELIFPHHSTGTLRPQPFG*****************
MAFYQRTVTPQVVAMVGLPAREFSKMAFYQRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRR********THDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTEDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSK**********PGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAYKVRKKTHFLLSSRNMTLELIFPHHSTGTLRPQPFGHLDFPHT**********
****QRTVTPQVVAMVGLPAREFSKMAFYQRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTEDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAYKVRKKTHFLLSSRNMTLELIFPHHSTGTL***********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFYQRTVTPQVVAMVGLPAREFSKMAFYQRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRDQIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTEDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAYKVRKKTHFLLSSRNMTLELIFPHHSTGTLRPQPFGHLDFPHTGCSSTKDNLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query512 2.2.26 [Sep-21-2011]
Q21122457 Probable 6-phosphofructo- yes N/A 0.740 0.829 0.397 5e-86
O35552555 6-phosphofructo-2-kinase/ yes N/A 0.804 0.742 0.367 7e-84
Q16875520 6-phosphofructo-2-kinase/ yes N/A 0.728 0.717 0.382 2e-82
Q5R9C1514 6-phosphofructo-2-kinase/ yes N/A 0.728 0.725 0.382 2e-82
Q28901463 6-phosphofructo-2-kinase/ no N/A 0.728 0.805 0.379 3e-80
Q4R8B6469 6-phosphofructo-2-kinase/ N/A N/A 0.728 0.795 0.378 6e-79
Q16877469 6-phosphofructo-2-kinase/ no N/A 0.728 0.795 0.378 1e-78
Q91309470 6-phosphofructo-2-kinase/ N/A N/A 0.732 0.797 0.370 3e-78
P70266471 6-phosphofructo-2-kinase/ no N/A 0.730 0.794 0.379 2e-77
Q6DTY7469 6-phosphofructo-2-kinase/ no N/A 0.728 0.795 0.376 2e-77
>sp|Q21122|F26_CAEEL Probable 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=K02B2.1 PE=3 SV=2 Back     alignment and function desciption
 Score =  318 bits (816), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 177/445 (39%), Positives = 255/445 (57%), Gaps = 66/445 (14%)

Query: 27  AFYQRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATH 86
            F  +   P V+ MVGLPARGK+Y++ KLCRYL+W G   ++FN                
Sbjct: 21  GFSDQVRVPNVIVMVGLPARGKTYISKKLCRYLKWTGFTTKVFN---------------- 64

Query: 87  DFFRSDNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATH----DFF 142
                                                +G+YRR  A+ + A H     FF
Sbjct: 65  -------------------------------------VGEYRRSDANAADAIHGANASFF 87

Query: 143 RSDNEYALSIRDQIALQALEDLDDWIIKG-GQVAFFDATNSTQARRNTIHHKIVEERQYM 201
             +N  AL +R + A +A+ED+ D++  G G VA FDATN+T+ RR  I     ++++  
Sbjct: 88  SPNNADALKVRAESARRAMEDMADYLNSGTGGVAIFDATNTTKDRRRIII-DFCKKQRLR 146

Query: 202 LFFVESLCDDPDILDRNIKEVKLTGPDYQGF-EPDKAYEDFMYRIGHYEKQYQTLTE--- 257
            FF+ES+CDDP I+D N+ +VK+  PDY+G    ++A EDFM RI +Y+KQY+ L E   
Sbjct: 147 CFFIESVCDDPAIIDCNVTDVKVNSPDYKGLMTAEQAKEDFMNRIENYKKQYEPLDESED 206

Query: 258 DHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGG 317
           + LS++++ N G+   VH   G VQ R+V FLM++++ PR++YLTR G+S  N    LGG
Sbjct: 207 ESLSFIKVINAGRSFKVHQVRGHVQSRVVYFLMNIHLLPRSIYLTRHGQSEYNAMGRLGG 266

Query: 318 DSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQC-PGSHKEY-KALDDIH 375
           DS LT  GQ+Y+  L+DF  E+ +  LR+W S K  A QT     P  H EY KALD++ 
Sbjct: 267 DSPLTEDGQKYASALADFFEEEEVPGLRVWCSQKVRAAQTAQHLKPDFHTEYWKALDELD 326

Query: 376 AGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLL 435
           AGICEG TY +I   +  Q  D   DK++ R+P GE Y+DV++RLE +I+++E  ++N+L
Sbjct: 327 AGICEGLTYEDILQRYPKQADDRATDKYHYRYPSGESYEDVVSRLEPVIMELER-QANVL 385

Query: 436 IVSHPAVLRCLLGYFQEEPPDRFAY 460
           +VSH AVLRC+L YF + P     Y
Sbjct: 386 VVSHQAVLRCVLAYFYDRPLSELPY 410
Synthesis and degradation of fructose 2,6-bisphosphate.
Caenorhabditis elegans (taxid: 6239)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 6
>sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 Back     alignment and function description
>sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 Back     alignment and function description
>sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 Back     alignment and function description
>sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 Back     alignment and function description
>sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 Back     alignment and function description
>sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 Back     alignment and function description
>sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 Back     alignment and function description
>sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=2 SV=2 Back     alignment and function description
>sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
228008433536 MIP03150p [Drosophila melanogaster] 0.824 0.787 0.394 5e-93
158300659468 AGAP012010-PA [Anopheles gambiae str. PE 0.855 0.935 0.388 5e-93
24643254536 6-phosphofructo-2-kinase, isoform A [Dro 0.824 0.787 0.394 5e-93
17137706 716 6-phosphofructo-2-kinase, isoform G [Dro 0.769 0.550 0.395 5e-93
194892964 679 GG19228 [Drosophila erecta] gi|190649426 0.824 0.621 0.394 8e-93
195446786537 GK25408 [Drosophila willistoni] gi|19416 0.824 0.785 0.392 1e-92
195398767 726 GJ15740 [Drosophila virilis] gi|19415041 0.769 0.542 0.391 4e-92
242011577456 6-phosphofructo-2-kinase/fructose-2,6-bi 0.787 0.883 0.398 4e-92
198471051 709 GA17426 [Drosophila pseudoobscura pseudo 0.769 0.555 0.389 5e-92
195059472533 GH17653 [Drosophila grimshawi] gi|193896 0.824 0.791 0.388 6e-92
>gi|228008433|gb|ACP44286.1| MIP03150p [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  348 bits (892), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 193/489 (39%), Positives = 281/489 (57%), Gaps = 67/489 (13%)

Query: 34  TPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDN 93
           TP V+AMVGLPARGK++++ KL RYL                                  
Sbjct: 73  TPHVIAMVGLPARGKTFISKKLARYL---------------------------------- 98

Query: 94  EYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIR 153
                              +WI        LG+YRR HA+ +  +H+FFR+DNE A++IR
Sbjct: 99  -------------------NWIGISTRVFNLGEYRR-HATTAYKSHEFFRADNEEAMAIR 138

Query: 154 DQIALQALEDLDDWIIKG-GQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDP 212
           ++ A QAL D  DW++ G G +A FDATNST+ RR  IH  +V++  + LFFVES+CDDP
Sbjct: 139 NRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDIVVKQHGFRLFFVESICDDP 198

Query: 213 DILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTL---TEDHLSYMQIYNVG 269
            I+++NI EVK++ PDY     +    DF+ RI HYE++YQ +   TE HLS+M++YN G
Sbjct: 199 QIIEQNILEVKVSSPDYLNMNTELVVRDFLQRIEHYEERYQPIDEVTESHLSFMKVYNAG 258

Query: 270 KRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYS 329
           K++VV+N  G V+ RIV +LM+++ITPRT+YLTR GES  N+  ++GGDS+L+A G +Y+
Sbjct: 259 KKVVVYNNEGHVESRIVYYLMNIHITPRTIYLTRHGESEYNLSGLIGGDSNLSARGHQYA 318

Query: 330 KCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTEIYT 389
             LS F++++ +  LR+WTS  + A QTVA      + +KAL++I AG CE  TY +I  
Sbjct: 319 NALSTFIAQQQIDGLRVWTSWMKRAIQTVADVKAPQERWKALNEIDAGHCEEMTYEQIKE 378

Query: 390 NHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGY 449
               ++     +KF  R+P+GE Y+D++ RLE +I+++E  + N+L+VSH AVLRCL  Y
Sbjct: 379 KFPEEFKARDVNKFAYRYPRGESYEDLVARLEPVIMELER-QGNVLVVSHQAVLRCLFAY 437

Query: 450 FQEEPPDRFAY------KVRKKTHFLLSSRNMTLELIFPHHSTGTLRPQPFGHLDFPHTG 503
           F ++  D   Y       V K T      +   ++L  P  +  T RP+P    D    G
Sbjct: 438 FLDKSADELPYLYVPLHTVIKLTPVAYGCKVEHIKL--PIDAVDTHRPKPKIPGDVSEPG 495

Query: 504 CSSTKDNLV 512
                  LV
Sbjct: 496 LDGLSGELV 504

Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|158300659|ref|XP_320522.4| AGAP012010-PA [Anopheles gambiae str. PEST] gi|157013267|gb|EAA00451.4| AGAP012010-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|24643254|ref|NP_728249.1| 6-phosphofructo-2-kinase, isoform A [Drosophila melanogaster] gi|24643256|ref|NP_728250.1| 6-phosphofructo-2-kinase, isoform D [Drosophila melanogaster] gi|24643258|ref|NP_728251.1| 6-phosphofructo-2-kinase, isoform E [Drosophila melanogaster] gi|24643260|ref|NP_728252.1| 6-phosphofructo-2-kinase, isoform F [Drosophila melanogaster] gi|24643262|ref|NP_728253.1| 6-phosphofructo-2-kinase, isoform H [Drosophila melanogaster] gi|24643264|ref|NP_728254.1| 6-phosphofructo-2-kinase, isoform I [Drosophila melanogaster] gi|386764712|ref|NP_001245750.1| 6-phosphofructo-2-kinase, isoform J [Drosophila melanogaster] gi|386764714|ref|NP_001245751.1| 6-phosphofructo-2-kinase, isoform K [Drosophila melanogaster] gi|386764716|ref|NP_001245752.1| 6-phosphofructo-2-kinase, isoform L [Drosophila melanogaster] gi|22832568|gb|AAN09491.1| 6-phosphofructo-2-kinase, isoform A [Drosophila melanogaster] gi|22832569|gb|AAF48963.2| 6-phosphofructo-2-kinase, isoform D [Drosophila melanogaster] gi|22832570|gb|AAN09492.1| 6-phosphofructo-2-kinase, isoform E [Drosophila melanogaster] gi|22832571|gb|AAN09493.1| 6-phosphofructo-2-kinase, isoform F [Drosophila melanogaster] gi|22832572|gb|AAN09494.1| 6-phosphofructo-2-kinase, isoform H [Drosophila melanogaster] gi|22832573|gb|AAN09495.1| 6-phosphofructo-2-kinase, isoform I [Drosophila melanogaster] gi|383293481|gb|AFH07462.1| 6-phosphofructo-2-kinase, isoform J [Drosophila melanogaster] gi|383293482|gb|AFH07463.1| 6-phosphofructo-2-kinase, isoform K [Drosophila melanogaster] gi|383293483|gb|AFH07464.1| 6-phosphofructo-2-kinase, isoform L [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|17137706|ref|NP_477451.1| 6-phosphofructo-2-kinase, isoform G [Drosophila melanogaster] gi|24643252|ref|NP_477452.3| 6-phosphofructo-2-kinase, isoform B [Drosophila melanogaster] gi|5360735|dbj|BAA82137.1| 6-phosphofructo 2-kinase/fructose 2,6-bisphosphatase long form [Drosophila melanogaster] gi|21483304|gb|AAM52627.1| GH17337p [Drosophila melanogaster] gi|22832566|gb|AAF48962.2| 6-phosphofructo-2-kinase, isoform B [Drosophila melanogaster] gi|22832567|gb|AAF48970.3| 6-phosphofructo-2-kinase, isoform G [Drosophila melanogaster] gi|220946630|gb|ACL85858.1| Pfrx-PA [synthetic construct] Back     alignment and taxonomy information
>gi|194892964|ref|XP_001977777.1| GG19228 [Drosophila erecta] gi|190649426|gb|EDV46704.1| GG19228 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195446786|ref|XP_002070923.1| GK25408 [Drosophila willistoni] gi|194167008|gb|EDW81909.1| GK25408 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195398767|ref|XP_002057992.1| GJ15740 [Drosophila virilis] gi|194150416|gb|EDW66100.1| GJ15740 [Drosophila virilis] Back     alignment and taxonomy information
>gi|242011577|ref|XP_002426525.1| 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase short form, putative [Pediculus humanus corporis] gi|212510651|gb|EEB13787.1| 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase short form, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|198471051|ref|XP_001355482.2| GA17426 [Drosophila pseudoobscura pseudoobscura] gi|198145744|gb|EAL32541.2| GA17426 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195059472|ref|XP_001995644.1| GH17653 [Drosophila grimshawi] gi|193896430|gb|EDV95296.1| GH17653 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
MGI|MGI:107815519 Pfkfb2 "6-phosphofructo-2-kina 0.667 0.658 0.401 1.5e-89
RGD|3309557 Pfkfb2 "6-phosphofructo-2-kina 0.667 0.614 0.401 1.5e-89
FB|FBgn0027621716 Pfrx "6-phosphofructo-2-kinase 0.777 0.555 0.431 5e-89
RGD|619776555 Pfkfb3 "6-phosphofructo-2-kina 0.652 0.601 0.429 3.5e-80
UNIPROTKB|O35552555 Pfkfb3 "6-phosphofructo-2-kina 0.652 0.601 0.429 3.5e-80
UNIPROTKB|A0JN55514 PFKFB3 "6-phosphofructo-2-kina 0.652 0.649 0.426 1.5e-77
UNIPROTKB|F1RUL2554 PFKFB3 "Uncharacterized protei 0.652 0.602 0.429 2e-77
UNIPROTKB|F1PB07504 PFKFB3 "Uncharacterized protei 0.652 0.662 0.426 2e-77
WB|WBGene00019295457 K02B2.1 [Caenorhabditis elegan 0.654 0.733 0.442 4.1e-77
UNIPROTKB|Q5VX15500 PFKFB3 "6-phosphofructo-2-kina 0.652 0.668 0.426 5.2e-77
MGI|MGI:107815 Pfkfb2 "6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 690 (248.0 bits), Expect = 1.5e-89, Sum P(2) = 1.5e-89
 Identities = 141/351 (40%), Positives = 224/351 (63%)

Query:   124 LGDYRRRHASGSRATHDFFRSDNEYALSIRDQIALQALEDLDDWIIK-GGQVAFFDATNS 182
             LG YRR  A  S  ++DFFR DNE A+ IR Q AL ALED+  +  +  GQ+A FDATN+
Sbjct:    77 LGVYRRE-AVKSYQSYDFFRHDNEEAMKIRKQCALVALEDVKAYFTEESGQIAVFDATNT 135

Query:   183 TQARRNTIHHKIVEERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFM 242
             T+ RR+ I +   ++  + +FFVES+CDDPD++  NI EVK++ PDY     +   EDF+
Sbjct:   136 TRERRDMILN-FAKQNAFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFL 194

Query:   243 YRIGHYEKQYQTLTEDH----LSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRT 298
              RI  Y+  YQ L  D+    LS++++ NVG+R +V+     +Q +IV +LM++++ PRT
Sbjct:   195 KRIECYKVTYQPLDPDNYDKDLSFIKVMNVGQRFLVNRVQDYIQSKIVYYLMNIHVHPRT 254

Query:   299 VYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTV 358
             +YL R GES  N+   +GGDS L+  G++++  L  F+ E+ + DL++WTS  +   QT 
Sbjct:   255 IYLCRHGESEFNLLGKIGGDSGLSVRGKQFAHALKKFLEEQEIQDLKVWTSQLKRTIQTA 314

Query:   359 AQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLT 418
                  +++++K L++I AG+CE  TY+EI   +  ++     +K+  R+P GE Y+D++ 
Sbjct:   315 ESLGVTYEQWKILNEIDAGVCEEMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQ 374

Query:   419 RLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAYKVRKKTHFL 469
             RLE +I+++E  + N+L++SH AV+RCLL YF ++  D   Y +R   H +
Sbjct:   375 RLEPVIMELER-QGNILVISHQAVMRCLLAYFLDKGADELPY-LRCPLHII 423
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0003873 "6-phosphofructo-2-kinase activity" evidence=ISO
GO:0004331 "fructose-2,6-bisphosphate 2-phosphatase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISO
GO:0006000 "fructose metabolic process" evidence=IEA
GO:0006003 "fructose 2,6-bisphosphate metabolic process" evidence=IEA
GO:0006007 "glucose catabolic process" evidence=ISO
GO:0006089 "lactate metabolic process" evidence=ISO
GO:0006090 "pyruvate metabolic process" evidence=ISO
GO:0006096 "glycolysis" evidence=ISO
GO:0008152 "metabolic process" evidence=IEA
GO:0009749 "response to glucose stimulus" evidence=ISO
GO:0016301 "kinase activity" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0019900 "kinase binding" evidence=ISO
GO:0019901 "protein kinase binding" evidence=ISO
GO:0032024 "positive regulation of insulin secretion" evidence=ISO
GO:0033133 "positive regulation of glucokinase activity" evidence=ISO
RGD|3309 Pfkfb2 "6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0027621 Pfrx "6-phosphofructo-2-kinase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|619776 Pfkfb3 "6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O35552 Pfkfb3 "6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A0JN55 PFKFB3 "6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUL2 PFKFB3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PB07 PFKFB3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00019295 K02B2.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VX15 PFKFB3 "6-phosphofructo-2-kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P32604F26_YEAST3, ., 1, ., 3, ., 4, 60.32780.70890.8030yesN/A
Q16875F263_HUMAN3, ., 1, ., 3, ., 4, 60.38240.72850.7173yesN/A
Q21122F26_CAEEL3, ., 1, ., 3, ., 4, 60.39770.74020.8293yesN/A
O35552F263_RAT3, ., 1, ., 3, ., 4, 60.36710.80460.7423yesN/A
Q9UTE1YFMD_SCHPO2, ., 7, ., 1, ., 1, 0, 50.30830.71480.6182yesN/A
Q5R9C1F263_PONAB3, ., 1, ., 3, ., 4, 60.38240.72850.7256yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.1.105LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
pfam01591219 pfam01591, 6PF2K, 6-phosphofructo-2-kinase 4e-72
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-38
COG0406208 COG0406, phoE, Broad specificity phosphatase PhoE 3e-22
smart00855158 smart00855, PGAM, Phosphoglycerate mutase family 3e-20
pfam00300154 pfam00300, His_Phos_1, Histidine phosphatase super 6e-17
TIGR03162177 TIGR03162, ribazole_cobC, alpha-ribazole phosphata 3e-12
cd07067153 cd07067, HP_PGM_like, Histidine phosphatase domain 8e-10
cd07040153 cd07040, HP, Histidine phosphatase domain found in 1e-06
PRK13463203 PRK13463, PRK13463, phosphatase PhoE; Provisional 6e-06
pfam13207114 pfam13207, AAA_17, AAA domain 7e-04
>gnl|CDD|216591 pfam01591, 6PF2K, 6-phosphofructo-2-kinase Back     alignment and domain information 
 Score =  228 bits (583), Expect = 4e-72
 Identities = 105/269 (39%), Positives = 149/269 (55%), Gaps = 56/269 (20%)

Query: 30  QRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFF 89
             T +  ++ MVGLPARGK+Y++ KL RYL W+G+  ++FN+G+YRR      S   +FF
Sbjct: 5   NFTNSKTLIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRRSAVKAYSDY-EFF 63

Query: 90  RSDNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYA 149
           R DNE  + IR+Q AL AL D+  ++ +                                
Sbjct: 64  RPDNEEGMKIREQCALAALNDVLAYLNEE------------------------------- 92

Query: 150 LSIRDQIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLC 209
                                 GQVA FDATN+T+ RR  I     EE    +FF+ES+C
Sbjct: 93  ---------------------SGQVAIFDATNTTRERRKMILD-FAEENGLKVFFLESIC 130

Query: 210 DDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTED--HLSYMQIYN 267
           DDP+I+ RNIK VK + PDY+G  P++A +DFM RI  YEKQY+ L E    LSY+++ +
Sbjct: 131 DDPEIIARNIKLVKFSSPDYKGKPPEEAIDDFMKRIECYEKQYEPLDEHDEDLSYIKVID 190

Query: 268 VGKRIVVHNETGPVQKRIVRFLMHLNITP 296
           VG+ IVV+N  G +Q RIV +LM++++TP
Sbjct: 191 VGQSIVVNNVQGYLQSRIVYYLMNIHVTP 219

This enzyme occurs as a bifunctional enzyme with fructose-2,6-bisphosphatase. The bifunctional enzyme catalyzes both the synthesis and degradation of fructose-2,6-bisphosphate, a potent regulator of glycolysis. This enzyme contains a P-loop motif. Length = 219
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family Back     alignment and domain information
>gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) Back     alignment and domain information
>gnl|CDD|234131 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase Back     alignment and domain information
>gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|172065 PRK13463, PRK13463, phosphatase PhoE; Provisional Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 512
KOG0234|consensus438 100.0
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 100.0
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 100.0
PRK14116228 gpmA phosphoglyceromutase; Provisional 100.0
PRK13463203 phosphatase PhoE; Provisional 100.0
PRK15004199 alpha-ribazole phosphatase; Provisional 100.0
PRK14119228 gpmA phosphoglyceromutase; Provisional 100.0
PRK01112228 phosphoglyceromutase; Provisional 100.0
PRK14117230 gpmA phosphoglyceromutase; Provisional 100.0
PRK14118227 gpmA phosphoglyceromutase; Provisional 100.0
PRK01295206 phosphoglyceromutase; Provisional 100.0
PRK14120249 gpmA phosphoglyceromutase; Provisional 100.0
PRK13462203 acid phosphatase; Provisional 100.0
COG0406208 phoE Broad specificity phosphatase PhoE and relate 100.0
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members 100.0
TIGR03848204 MSMEG_4193 probable phosphomutase, MSMEG_4193 fami 100.0
TIGR01258245 pgm_1 phosphoglycerate mutase, BPG-dependent, fami 100.0
PRK03482215 phosphoglycerate mutase; Provisional 100.0
PRK14115247 gpmA phosphoglyceromutase; Provisional 100.0
PRK07238372 bifunctional RNase H/acid phosphatase; Provisional 99.97
PF00300158 His_Phos_1: Histidine phosphatase superfamily (bra 99.96
smart00855155 PGAM Phosphoglycerate mutase family. Phosphoglycer 99.95
KOG0235|consensus214 99.95
PTZ00123236 phosphoglycerate mutase like-protein; Provisional 99.95
COG0588230 GpmA Phosphoglycerate mutase 1 [Carbohydrate trans 99.94
cd07067153 HP_PGM_like Histidine phosphatase domain found in 99.88
PTZ00122299 phosphoglycerate mutase; Provisional 99.87
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 99.87
cd07040153 HP Histidine phosphatase domain found in a functio 99.79
PRK06193206 hypothetical protein; Provisional 99.76
TIGR00249152 sixA phosphohistidine phosphatase SixA. 99.72
COG2062163 SixA Phosphohistidine phosphatase SixA [Signal tra 99.67
KOG4754|consensus248 99.66
PRK10848159 phosphohistidine phosphatase; Provisional 99.65
PRK15416201 lipopolysaccharide core heptose(II)-phosphate phos 99.57
KOG3734|consensus272 99.57
COG0645170 Predicted kinase [General function prediction only 99.56
KOG0234|consensus438 99.52
KOG4609|consensus284 99.49
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 99.46
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.38
PHA02530300 pseT polynucleotide kinase; Provisional 99.28
PRK06762166 hypothetical protein; Provisional 99.2
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 99.19
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 99.19
COG4639168 Predicted kinase [General function prediction only 99.14
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 99.09
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 99.09
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 99.06
PRK11545163 gntK gluconate kinase 1; Provisional 99.03
PRK14532188 adenylate kinase; Provisional 98.99
PRK14531183 adenylate kinase; Provisional 98.98
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 98.91
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 98.88
PRK14527191 adenylate kinase; Provisional 98.87
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 98.87
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 98.85
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.84
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 98.8
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 98.77
PRK09825176 idnK D-gluconate kinase; Provisional 98.76
PRK03846198 adenylylsulfate kinase; Provisional 98.72
PRK00889175 adenylylsulfate kinase; Provisional 98.7
COG4088261 Predicted nucleotide kinase [Nucleotide transport 98.69
PLN02200234 adenylate kinase family protein 98.68
PRK12339197 2-phosphoglycerate kinase; Provisional 98.62
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 98.62
PRK00279215 adk adenylate kinase; Reviewed 98.6
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.54
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.54
PRK12337475 2-phosphoglycerate kinase; Provisional 98.53
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.47
PRK13808333 adenylate kinase; Provisional 98.43
PRK05541176 adenylylsulfate kinase; Provisional 98.42
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.42
PLN02674244 adenylate kinase 98.37
PRK01184184 hypothetical protein; Provisional 98.35
PRK14529223 adenylate kinase; Provisional 98.34
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.33
PTZ00088229 adenylate kinase 1; Provisional 98.29
PRK14528186 adenylate kinase; Provisional 98.28
PRK14530215 adenylate kinase; Provisional 98.28
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 98.26
PRK02496184 adk adenylate kinase; Provisional 98.2
PRK13946184 shikimate kinase; Provisional 98.2
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 98.19
PRK13948182 shikimate kinase; Provisional 98.17
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 98.17
PRK14526211 adenylate kinase; Provisional 98.15
COG0703172 AroK Shikimate kinase [Amino acid transport and me 98.11
PRK12338319 hypothetical protein; Provisional 98.1
KOG3062|consensus281 98.08
KOG3354|consensus191 98.01
PRK06696223 uridine kinase; Validated 98.0
PRK13947171 shikimate kinase; Provisional 98.0
PRK00625173 shikimate kinase; Provisional 97.98
PRK00131175 aroK shikimate kinase; Reviewed 97.94
PLN02459261 probable adenylate kinase 97.91
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.89
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 97.86
PRK05057172 aroK shikimate kinase I; Reviewed 97.77
PRK13949169 shikimate kinase; Provisional 97.74
PRK06217183 hypothetical protein; Validated 97.74
PRK07667193 uridine kinase; Provisional 97.72
PRK03731171 aroL shikimate kinase II; Reviewed 97.7
KOG3079|consensus195 97.68
PRK04040188 adenylate kinase; Provisional 97.63
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 97.61
PRK00698205 tmk thymidylate kinase; Validated 97.59
PRK14730195 coaE dephospho-CoA kinase; Provisional 97.57
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 97.55
PRK07261171 topology modulation protein; Provisional 97.53
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 97.51
PRK08154309 anaerobic benzoate catabolism transcriptional regu 97.47
PRK08233182 hypothetical protein; Provisional 97.47
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 97.45
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 97.44
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.41
PRK04220301 2-phosphoglycerate kinase; Provisional 97.39
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 97.38
PRK00081194 coaE dephospho-CoA kinase; Reviewed 97.35
COG4185187 Uncharacterized protein conserved in bacteria [Fun 97.32
PRK08118167 topology modulation protein; Reviewed 97.3
PRK00300205 gmk guanylate kinase; Provisional 97.26
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.23
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.2
PRK08356195 hypothetical protein; Provisional 97.19
PRK06547172 hypothetical protein; Provisional 97.19
PRK13973213 thymidylate kinase; Provisional 97.18
PRK14731208 coaE dephospho-CoA kinase; Provisional 97.16
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.15
cd07061242 HP_HAP_like Histidine phosphatase domain found in 97.15
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 97.14
PRK06761282 hypothetical protein; Provisional 97.14
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 97.13
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.09
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.09
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.08
PRK04182180 cytidylate kinase; Provisional 97.08
PRK10867433 signal recognition particle protein; Provisional 97.06
PRK05480209 uridine/cytidine kinase; Provisional 97.05
PRK14021542 bifunctional shikimate kinase/3-dehydroquinate syn 97.04
PLN02199303 shikimate kinase 97.02
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.0
PLN02842505 nucleotide kinase 96.99
KOG2134|consensus422 96.97
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 96.97
PRK00771437 signal recognition particle protein Srp54; Provisi 96.94
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 96.94
PRK14738206 gmk guanylate kinase; Provisional 96.91
PRK14734200 coaE dephospho-CoA kinase; Provisional 96.89
PRK14733204 coaE dephospho-CoA kinase; Provisional 96.84
PRK14737186 gmk guanylate kinase; Provisional 96.82
KOG0780|consensus483 96.81
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 96.8
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 96.69
KOG3220|consensus225 96.66
TIGR00064272 ftsY signal recognition particle-docking protein F 96.64
TIGR00959428 ffh signal recognition particle protein. This mode 96.59
PRK03839180 putative kinase; Provisional 96.5
PRK14732196 coaE dephospho-CoA kinase; Provisional 96.43
PLN02422232 dephospho-CoA kinase 96.41
PRK13975196 thymidylate kinase; Provisional 96.41
KOG1533|consensus290 96.35
PRK10416318 signal recognition particle-docking protein FtsY; 96.35
PLN02924220 thymidylate kinase 96.31
COG3896205 Chloramphenicol 3-O-phosphotransferase [Defense me 96.3
PTZ00451244 dephospho-CoA kinase; Provisional 96.25
PRK14974336 cell division protein FtsY; Provisional 96.24
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 96.22
PRK13974212 thymidylate kinase; Provisional 96.22
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 96.15
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.12
KOG0635|consensus207 96.08
cd03115173 SRP The signal recognition particle (SRP) mediates 96.06
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 96.0
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.99
KOG4238|consensus627 95.95
cd02034116 CooC The accessory protein CooC, which contains a 95.95
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 95.94
PRK00023225 cmk cytidylate kinase; Provisional 95.87
PF00328347 His_Phos_2: Histidine phosphatase superfamily (bra 95.86
PTZ00301210 uridine kinase; Provisional 95.77
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.66
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 95.61
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.6
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.59
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 95.51
PRK13768253 GTPase; Provisional 95.48
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 95.36
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.33
KOG0739|consensus439 95.2
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.14
PRK12377248 putative replication protein; Provisional 95.06
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 95.04
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 95.02
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.01
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 94.99
PF00004132 AAA: ATPase family associated with various cellula 94.97
PRK13695174 putative NTPase; Provisional 94.85
PRK08939306 primosomal protein DnaI; Reviewed 94.73
PRK15453290 phosphoribulokinase; Provisional 94.7
PRK08181269 transposase; Validated 94.67
KOG3347|consensus176 94.61
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.56
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 94.43
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.41
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 94.28
PRK05439311 pantothenate kinase; Provisional 94.18
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 94.17
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.17
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.13
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 94.04
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.93
COG0552340 FtsY Signal recognition particle GTPase [Intracell 93.91
KOG0744|consensus423 93.9
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 93.85
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 93.81
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 93.8
PRK06893229 DNA replication initiation factor; Validated 93.72
smart00382148 AAA ATPases associated with a variety of cellular 93.68
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 93.6
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.53
PRK13976209 thymidylate kinase; Provisional 93.48
PRK09435332 membrane ATPase/protein kinase; Provisional 93.48
PRK09270229 nucleoside triphosphate hydrolase domain-containin 93.41
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 93.27
PRK06526254 transposase; Provisional 93.22
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 93.18
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 93.18
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 93.18
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 93.17
cd01394218 radB RadB. The archaeal protein radB shares simila 93.15
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 93.14
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 93.11
KOG0738|consensus491 93.02
KOG4622|consensus291 93.01
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 93.01
COG3842352 PotA ABC-type spermidine/putrescine transport syst 93.01
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 92.97
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 92.94
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 92.94
PLN02165334 adenylate isopentenyltransferase 92.93
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 92.88
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 92.83
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 92.76
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 92.71
PHA00729226 NTP-binding motif containing protein 92.69
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 92.68
PLN02796347 D-glycerate 3-kinase 92.67
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 92.64
PRK09183259 transposase/IS protein; Provisional 92.59
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 92.47
KOG3720|consensus 411 92.42
PF05729166 NACHT: NACHT domain 92.4
PRK07933213 thymidylate kinase; Validated 92.38
cd03116159 MobB Molybdenum is an essential trace element in t 92.35
PRK08084235 DNA replication initiation factor; Provisional 92.34
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 92.33
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 92.24
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 92.23
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 92.17
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.1
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 92.08
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 92.08
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 92.04
PRK10790592 putative multidrug transporter membrane\ATP-bindin 92.0
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 92.0
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 91.99
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 91.97
PLN03025319 replication factor C subunit; Provisional 91.94
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 91.91
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 91.91
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 91.91
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 91.89
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 91.89
PRK14086617 dnaA chromosomal replication initiation protein; P 91.87
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 91.86
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 91.86
PRK08727233 hypothetical protein; Validated 91.86
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 91.81
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 91.8
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 91.74
PRK13886241 conjugal transfer protein TraL; Provisional 91.71
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 91.62
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 91.56
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 91.55
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 91.55
PLN02840421 tRNA dimethylallyltransferase 91.54
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 91.52
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 91.5
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 91.5
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 91.49
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 91.46
PRK09376416 rho transcription termination factor Rho; Provisio 91.42
PLN02748468 tRNA dimethylallyltransferase 91.41
PLN03046460 D-glycerate 3-kinase; Provisional 91.41
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 91.4
PLN02348395 phosphoribulokinase 91.31
COG1936180 Predicted nucleotide kinase (related to CMP and AM 91.25
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 91.24
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 91.21
PRK09361225 radB DNA repair and recombination protein RadB; Pr 91.19
PRK08903227 DnaA regulatory inactivator Hda; Validated 91.19
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 91.17
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 91.14
smart00178184 SAR Sar1p-like members of the Ras-family of small 91.09
PRK08099399 bifunctional DNA-binding transcriptional repressor 91.09
COG5324758 Uncharacterized conserved protein [Function unknow 91.08
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 91.06
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 91.06
PHA02544316 44 clamp loader, small subunit; Provisional 90.99
PRK11519719 tyrosine kinase; Provisional 90.99
PRK14088440 dnaA chromosomal replication initiation protein; P 90.98
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 90.97
PRK10522547 multidrug transporter membrane component/ATP-bindi 90.96
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 90.96
PRK00149450 dnaA chromosomal replication initiation protein; R 90.94
KOG1534|consensus273 90.93
cd03114148 ArgK-like The function of this protein family is u 90.91
PRK09087226 hypothetical protein; Validated 90.91
KOG0058|consensus716 90.9
COG4988559 CydD ABC-type transport system involved in cytochr 90.9
PF13173128 AAA_14: AAA domain 90.89
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 90.88
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 90.8
PRK07004460 replicative DNA helicase; Provisional 90.78
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 90.75
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 90.73
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 90.69
PRK06921266 hypothetical protein; Provisional 90.61
PRK04296190 thymidine kinase; Provisional 90.59
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 90.53
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 90.52
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 90.49
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 90.42
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 90.39
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 90.39
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 90.39
TIGR03709264 PPK2_rel_1 polyphosphate:nucleotide phosphotransfe 90.34
cd03269210 ABC_putative_ATPase This subfamily is involved in 90.25
PRK07952244 DNA replication protein DnaC; Validated 90.25
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 90.21
TIGR00362405 DnaA chromosomal replication initiator protein Dna 90.18
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 90.17
PRK10172 436 phosphoanhydride phosphorylase; Provisional 90.16
COG1855604 ATPase (PilT family) [General function prediction 90.15
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 90.11
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 90.09
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 90.05
KOG3308|consensus225 90.03
PRK13409590 putative ATPase RIL; Provisional 89.99
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 89.97
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 89.96
COG4615546 PvdE ABC-type siderophore export system, fused ATP 89.93
PRK05642234 DNA replication initiation factor; Validated 89.92
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 89.92
KOG0055|consensus1228 89.91
COG1136226 SalX ABC-type antimicrobial peptide transport syst 89.9
PRK05973237 replicative DNA helicase; Provisional 89.83
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 89.83
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 89.82
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 89.78
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 89.77
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 89.75
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 89.75
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 89.72
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 89.7
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 89.7
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 89.63
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 89.63
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 89.62
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 89.62
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 89.61
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 89.59
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 89.57
PRK05636505 replicative DNA helicase; Provisional 89.48
CHL00181287 cbbX CbbX; Provisional 89.48
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 89.46
PRK05707328 DNA polymerase III subunit delta'; Validated 89.45
CHL00195489 ycf46 Ycf46; Provisional 89.44
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 89.44
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 89.42
KOG1532|consensus366 89.42
cd04171164 SelB SelB subfamily. SelB is an elongation factor 89.38
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 89.37
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 89.33
PRK08116268 hypothetical protein; Validated 89.32
KOG3078|consensus235 89.3
PRK06851367 hypothetical protein; Provisional 89.28
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 89.22
PRK06620214 hypothetical protein; Validated 89.2
PLN02772398 guanylate kinase 89.18
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 89.18
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 89.14
PRK08760476 replicative DNA helicase; Provisional 89.13
TIGR00767415 rho transcription termination factor Rho. Members 89.13
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 89.12
cd03246173 ABCC_Protease_Secretion This family represents the 89.1
COG0489265 Mrp ATPases involved in chromosome partitioning [C 89.09
TIGR03707230 PPK2_P_aer polyphosphate kinase 2, PA0141 family. 89.09
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 89.05
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 89.0
KOG0055|consensus 1228 89.0
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 88.99
PRK10173 413 glucose-1-phosphatase/inositol phosphatase; Provis 88.98
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 88.97
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 88.97
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 88.96
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 88.95
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 88.91
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 88.9
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 88.86
TIGR03029274 EpsG chain length determinant protein tyrosine kin 88.85
KOG0781|consensus587 88.74
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 88.71
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 88.64
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 88.56
KOG1384|consensus348 88.55
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 88.53
COG1100219 GTPase SAR1 and related small G proteins [General 88.5
PRK10908222 cell division protein FtsE; Provisional 88.49
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 88.48
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 88.47
cd03216163 ABC_Carb_Monos_I This family represents the domain 88.46
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 88.44
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 88.42
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 88.41
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 88.41
TIGR03708493 poly_P_AMP_trns polyphosphate:AMP phosphotransfera 88.39
PRK05595444 replicative DNA helicase; Provisional 88.38
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 88.37
KOG0737|consensus386 88.3
PRK10646153 ADP-binding protein; Provisional 88.27
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 88.27
COG4136213 ABC-type uncharacterized transport system, ATPase 88.25
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 88.21
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 88.18
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 88.18
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 88.17
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 88.16
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 88.13
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 88.12
COG2256436 MGS1 ATPase related to the helicase subunit of the 88.12
PF07726131 AAA_3: ATPase family associated with various cellu 88.1
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 88.1
cd03234226 ABCG_White The White subfamily represents ABC tran 88.1
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 88.08
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 88.08
PRK12608380 transcription termination factor Rho; Provisional 87.94
PRK13536340 nodulation factor exporter subunit NodI; Provision 87.93
PRK11153343 metN DL-methionine transporter ATP-binding subunit 87.92
PRK07471365 DNA polymerase III subunit delta'; Validated 87.88
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 87.86
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 87.86
PRK00089292 era GTPase Era; Reviewed 87.86
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 87.82
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 87.76
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 87.76
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 87.74
PTZ002651466 multidrug resistance protein (mdr1); Provisional 87.72
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 87.7
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 87.68
COG0470325 HolB ATPase involved in DNA replication [DNA repli 87.67
PRK03003472 GTP-binding protein Der; Reviewed 87.66
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 87.65
PRK10789569 putative multidrug transporter membrane\ATP-bindin 87.64
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 87.6
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 87.6
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 87.54
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 87.53
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 87.5
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 87.48
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 87.46
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 87.46
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 87.43
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 87.41
PRK06851367 hypothetical protein; Provisional 87.4
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 87.39
PF1324576 AAA_19: Part of AAA domain 87.39
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 87.37
COG2326270 Uncharacterized conserved protein [Function unknow 87.35
KOG0733|consensus 802 87.34
PRK15455644 PrkA family serine protein kinase; Provisional 87.29
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 87.29
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 87.27
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 87.26
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 87.19
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 87.19
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 87.16
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 87.13
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 87.12
KOG2170|consensus344 87.03
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 87.01
cd03110179 Fer4_NifH_child This protein family's function is 87.0
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 86.93
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 86.89
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 86.86
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 86.81
PRK04328249 hypothetical protein; Provisional 86.77
>KOG0234|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.2e-84  Score=665.22  Aligned_cols=410  Identities=44%  Similarity=0.764  Sum_probs=381.6

Q ss_pred             CCCCccccccccccCCCeEEEEecCCCCCCchhhhhHHHHhhhcCCcceeeccchhhhhhcccCCCCCCCCCCChHHHHH
Q psy673           19 PAREFSKMAFYQRTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNEYALS   98 (512)
Q Consensus        19 par~~~~~~~~~~~~~~~~i~~vGlp~rGKS~~a~~l~~~l~~~~~~~~~~~~~~~rr~~~~~~~~~~~~f~~~~~~~~~   98 (512)
                      |+..+++-+ -...+.|++|+||||||||||+++.+|.|||+|+|++|+.||+|++||......                
T Consensus        13 ~~~~~~~~~-~~~~~~~~~ivmvglpA~gKt~is~kl~ryl~w~~~~tk~fn~g~yrr~~~~~~----------------   75 (438)
T KOG0234|consen   13 PGLKYSTRS-NLFMGSKLVIVMVGLPARGKTYISSKLTRYLNWLGVNTKVFNVGEYRREAVKKV----------------   75 (438)
T ss_pred             CCcceeccc-ccccCCceEEEEecCCccCcchhhhhHHHHHHhhccccccccHHHHHHHHhccc----------------
Confidence            555555544 125789999999999999999999999999999999999999999999877621                


Q ss_pred             HHHHHHHHHHHHHHHHHhcCCCCCCCcccccccCCCCCCCCCcccCCCHHHHHHHHHHHHHHHHHHHHHH-HcCCcEEEE
Q psy673           99 IRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRDQIALQALEDLDDWI-IKGGQVAFF  177 (512)
Q Consensus        99 ~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fd~~n~~~~~~r~~~a~~~l~~~~~~l-~~~g~~~i~  177 (512)
                                                            ..+.||.|.|..+.+.|.+++..++.|+..|| +.+|+++|+
T Consensus        76 --------------------------------------~s~~ff~p~n~~~~~lr~~~a~~~l~D~~~~l~~~~g~vai~  117 (438)
T KOG0234|consen   76 --------------------------------------DSEPFFLPDNAEASKLRKQLALLALNDLLHFLIKENGQVAIF  117 (438)
T ss_pred             --------------------------------------ccccccccCChhhhhhhHHHHHHHhhhHHHHhhccCCceEEe
Confidence                                                  12447788888888888888888899999888 788999999


Q ss_pred             cCCChhHHHHHHHHHHHHh-hcCceEEEEEEEeCCHHHHHHHHHHHHhcCCCCCCCChhHHHHHHHHHHHHhhHhceecc
Q psy673          178 DATNSTQARRNTIHHKIVE-ERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLT  256 (512)
Q Consensus       178 Datn~~~~~R~~~~~~~~~-~~~~~~~~~e~~~~d~~~~~~n~~~~~~~~~dy~~~~~~~a~~df~~R~~~~~~~yepl~  256 (512)
                      ||||+|+++|++|++ +++ +.+++|+|||+.|+|++++.+||+.++..+|||.+.+.+.|.+||++||+.|++.||||+
T Consensus       118 Datnttr~rrk~i~~-~~~~~~~~kv~FiEs~c~D~~ii~~NI~~~~~~spdy~~~~~e~a~~dfl~ri~~ye~~YePld  196 (438)
T KOG0234|consen  118 DATNTTRERRKRIID-FAEREAGFKVFFIESVCNDPNLINNNIREVKHVSPDYKGKDQEEALKDFLKRIRNYEKYYEPLD  196 (438)
T ss_pred             cCCCCCHHHHHHHHH-HHhhcCCceEEEEEeecCCchhHHhhhhhhhhcCCCcCCCCHHHHHHHHHHHHHhhhhccCcCC
Confidence            999999999999999 896 789999999999999999999999999999999999999999999999999999999999


Q ss_pred             ---cCCcceEEEEecCceeEeccCCCccccchhhhccccCcCCcEEEEecccccccccccccCCCCCCCHHHHHHHHHhh
Q psy673          257 ---EDHLSYMQIYNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLS  333 (512)
Q Consensus       257 ---~~e~~yik~~n~g~~~~~~~~~g~l~s~i~~fLmn~~~~~~~I~LVRHGes~~n~~~~~~gD~pLTe~G~~qA~~l~  333 (512)
                         +++++|||++|+|++++++++.||++|+|||||||+|..+++|||+|||||++|..++.+||++|++.|.++|+.++
T Consensus       197 ~~~d~~lsyik~in~g~~~~~~~i~~~l~srivy~lmN~~~~pR~i~l~r~geS~~n~~griggds~ls~~g~~ya~~l~  276 (438)
T KOG0234|consen  197 RARDKDLSYIKIINVGEEIVVHNIEGYLQSRIVYYLMNIHTTPRTIYLTRHGESEFNVEGRIGGDSPLSERGSQYAKSLI  276 (438)
T ss_pred             hhhccccceEEEecccceEEEecccceehhhhhhhhhccccCCceEEEEecCCCccccccccCCcccccHHHHHHHHHHH
Confidence               67899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhcCCCCcEEEeCcHHHHHHHHhHcccCc--ccccccccccCCcCCCCCHHHHHHhchHHHHHHhcCCCCCCCCCCC
Q psy673          334 DFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSH--KEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGE  411 (512)
Q Consensus       334 ~~L~~~~~~~~~V~tSpl~RaiqTA~~i~~~~--~~~~~L~E~~~G~~eg~t~~ei~~~~p~~~~~~~~d~~~~~~p~gE  411 (512)
                      +++.++......||||++.||+|||+.+..+.  ..|..|+|++.|.|+|+|++++...||+++..+..|+++||||+||
T Consensus       277 ~f~~~~~~~dl~vwts~~~rti~ta~~l~~~~~~~~~~~Ldei~ag~~~g~t~eeI~~~~p~e~~~r~~dky~yry~~gE  356 (438)
T KOG0234|consen  277 KFVEEQSSSDLDVWTSQRKRTIQTAEGLKLDYSVEQWKALDEIDAGVCEGLTYEEIETNYPEEFALRDKDKYRYRYPGGE  356 (438)
T ss_pred             HHHhhhcccCceeccchHHHHhhhHhhcCcchhhhhHhhcCcccccccccccHHHHHHhCchhhhhccCCcceeecCCCC
Confidence            99998887778999999999999999776655  7899999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHhHhCCCeEEEEeChHHHHHHHHHhhCCCchhhcc-cCCCceEEEEEEe--CCEEEEEe-ccCC
Q psy673          412 CYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAY-KVRKKTHFLLSSR--NMTLELIF-PHHS  485 (512)
Q Consensus       412 S~~d~~~Rv~~~i~el~~~~~~vlIVsH~~vir~ll~~l~g~~~~~~~~-~ip~~sv~~l~~~--~~~~~~i~-~~~~  485 (512)
                      ||.|+.+|++|+|.+|+++.+ |+|+||..+|+||++||++.+++..+. .+|.++|++|+|.  ++.|+.+. +..+
T Consensus       357 Sy~D~v~RlePvImElEr~~~-Vlvi~Hqavircll~Yf~~~~~~e~p~l~~plhtv~~l~~~~y~~~~e~~~~~~~a  433 (438)
T KOG0234|consen  357 SYSDLVQRLEPVIMELERQEN-VLVITHQAVIRCLLAYFLNCSPVELPYLTVPLHTVIKLTPDAYGTTVESIRLNDTA  433 (438)
T ss_pred             CHHHHHHhhhhHhHhhhhccc-EEEEecHHHHHHHHHHHhcCCHhhcccccccceeEEEEeeccccceeEEeeccccc
Confidence            999999999999999999865 999999999999999999999999999 9999999999998  89999988 4444

>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>PRK14116 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>PRK15004 alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>PRK14119 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14117 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14118 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14120 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PRK14115 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>smart00855 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>KOG0235|consensus Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PRK06193 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA Back     alignment and domain information
>COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information
>KOG4754|consensus Back     alignment and domain information
>PRK10848 phosphohistidine phosphatase; Provisional Back     alignment and domain information
>PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional Back     alignment and domain information
>KOG3734|consensus Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG0234|consensus Back     alignment and domain information
>KOG4609|consensus Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>KOG3062|consensus Back     alignment and domain information
>KOG3354|consensus Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>KOG3079|consensus Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd07061 HP_HAP_like Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>KOG2134|consensus Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0780|consensus Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>KOG3220|consensus Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>KOG0635|consensus Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>KOG4238|consensus Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PF00328 His_Phos_2: Histidine phosphatase superfamily (branch 2); InterPro: IPR000560 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG4622|consensus Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>KOG3720|consensus Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>COG5324 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG1534|consensus Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK10172 phosphoanhydride phosphorylase; Provisional Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>KOG3308|consensus Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG3078|consensus Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10173 glucose-1-phosphatase/inositol phosphatase; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>KOG0781|consensus Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>KOG1384|consensus Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>COG2326 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
2axn_A520 Crystal Structure Of The Human Inducible Form 6- Ph 1e-83
1k6m_A432 Crystal Structure Of Human Liver 6-Phosphofructo-2- 2e-78
2bif_A469 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase 2e-78
1bif_A469 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase 4e-78
3bif_A468 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase 4e-78
1tip_A191 The Bisphosphatase Domain Of The Bifunctional Rat L 1e-31
1c7z_A191 Regulatory Complex Of Fructose-2,6-Bisphosphatase L 2e-31
1fbt_A190 The Bisphosphatase Domain Of The Bifunctional Rat L 2e-30
1ebb_A202 Bacillus Stearothermophilus Yhfr Length = 202 2e-06
1h2e_A207 Bacillus Stearothermophilus Phoe (Previously Known 2e-06
>pdb|2AXN|A Chain A, Crystal Structure Of The Human Inducible Form 6- Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Length = 520 Back     alignment and structure 
Iteration: 1

 Score =  306 bits (785), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 166/434 (38%), Positives = 251/434 (57%), Gaps = 61/434 (14%)
Query: 32  TVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRS 91
           T +P V+ MVGLPARGK+Y++ KL RYL                                
Sbjct: 32  TNSPTVIVMVGLPARGKTYISKKLTRYL-------------------------------- 59
Query: 92  DNEYALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALS 151
                                +WI        +G+YRR  A    ++++FFR DNE A+ 
Sbjct: 60  ---------------------NWIGVPTKVFNVGEYRR-EAVKQYSSYNFFRPDNEEAMK 97
Query: 152 IRDQIALQALEDLDDWIIK-GGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCD 210
           +R Q AL AL D+  ++ K GGQ+A FDATN+T+ RR+ I H   +E  +  FF+ES+CD
Sbjct: 98  VRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILH-FAKENDFKAFFIESVCD 156
Query: 211 DPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTEDH----LSYMQIY 266
           DP ++  NI EVK++ PDY+     +A +DFM RI  YE  YQ L  D     LS +++ 
Sbjct: 157 DPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVI 216
Query: 267 NVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQ 326
           +VG+R +V+     +Q RIV +LM++++ PRT+YL R GE+ +N+Q  +GGDS L++ G+
Sbjct: 217 DVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGK 276
Query: 327 EYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTE 386
           +++  LS FV E+NL DLR+WTS  ++  QT       ++++KAL++I AG+CE  TY E
Sbjct: 277 KFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEE 336
Query: 387 IYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCL 446
           I   +  +Y     DK+Y R+P GE Y+D++ RLE +I+++E  + N+L++ H AVLRCL
Sbjct: 337 IRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELER-QENVLVICHQAVLRCL 395
Query: 447 LGYFQEEPPDRFAY 460
           L YF ++  +   Y
Sbjct: 396 LAYFLDKSAEEMPY 409
>pdb|1K6M|A Chain A, Crystal Structure Of Human Liver 6-Phosphofructo-2-KinaseFRUCTOSE-2, 6-Bisphosphatase Length = 432 Back     alignment and structure
>pdb|2BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase H256a Mutant With F6p In Phosphatase Active Site Length = 469 Back     alignment and structure
>pdb|1BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Bifunctional Enzyme Complexed With Atp-G-S And Phosphate Length = 469 Back     alignment and structure
>pdb|3BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Empty 6-Pf-2k Active Site Length = 468 Back     alignment and structure
>pdb|1TIP|A Chain A, The Bisphosphatase Domain Of The Bifunctional Rat Liver 6- Phosphofructo-2-kinase/fructose-2,6-bisphosphatase Length = 191 Back     alignment and structure
>pdb|1C7Z|A Chain A, Regulatory Complex Of Fructose-2,6-Bisphosphatase Length = 191 Back     alignment and structure
>pdb|1FBT|A Chain A, The Bisphosphatase Domain Of The Bifunctional Rat Liver 6- Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Length = 190 Back     alignment and structure
>pdb|1EBB|A Chain A, Bacillus Stearothermophilus Yhfr Length = 202 Back     alignment and structure
>pdb|1H2E|A Chain A, Bacillus Stearothermophilus Phoe (Previously Known As Yhfr) In Complex With Phosphate Length = 207 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 1e-121
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 1e-120
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 6e-17
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 1e-16
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 1e-12
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 2e-10
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 6e-10
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 9e-10
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 2e-09
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 5e-09
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 4e-08
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 1e-07
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 2e-05
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 1e-04
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 2e-04
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 3e-04
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 5e-04
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 8e-04
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 Back     alignment and structure
 Score =  363 bits (933), Expect = e-121
 Identities = 165/462 (35%), Positives = 253/462 (54%), Gaps = 76/462 (16%)

Query: 37  VVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNEYA 96
           ++ MVGLPARGK+Y++ KL RYL ++G+  R FN+G YRR        + +FF  DNE  
Sbjct: 41  LIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYK-SFEFFLPDNEEG 99

Query: 97  LSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRDQI 156
           L IR Q AL AL D+  ++ + G                                     
Sbjct: 100 LKIRKQCALAALNDVRKFLSEEG------------------------------------- 122

Query: 157 ALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDILD 216
                          G VA FDATN+T+ RR  I +   E+  Y  FFVES+C DP+++ 
Sbjct: 123 ---------------GHVAVFDATNTTRERRAMIFNFG-EQNGYKTFFVESICVDPEVIA 166

Query: 217 RNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTED---HLSYMQIYNVGKRIV 273
            NI +VKL  PDY   + D+A EDFM RI  YE  Y++L E+    LSY++I +VG+  V
Sbjct: 167 ANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEEQDRDLSYIKIMDVGQSYV 226

Query: 274 VHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLS 333
           V+     +Q RIV +LM++++TPR++YL R GES  N++  +GGD  L+  G+E+SK L+
Sbjct: 227 VNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFSKHLA 286

Query: 334 DFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCA 393
            F+S++N+ DL+++TS  +   QT       ++++K L++I AG+CE  TY EI  ++  
Sbjct: 287 QFISDQNIKDLKVFTSQMKRTIQTAEALSVPYEQFKVLNEIDAGVCEEMTYEEIQDHYPL 346

Query: 394 QYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEE 453
           ++     DK+  R+P+GE Y+D++ RLE +I+++E  + N+L++ H AV+RCLL YF ++
Sbjct: 347 EFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQE-NVLVICHQAVMRCLLAYFLDK 405

Query: 454 PPDRFAYKVRKKTHFLLSSRNMTLELIFPHHSTGTLRPQPFG 495
             +   Y                  L  P H+   L P  +G
Sbjct: 406 AAEELPY------------------LKCPLHTVLKLTPVAYG 429
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Length = 202 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Length = 214 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Length = 192 Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 100.0
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 100.0
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 100.0
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 100.0
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 100.0
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 100.0
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 100.0
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 100.0
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 100.0
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 100.0
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 100.0
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 100.0
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 100.0
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 99.98
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.98
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.98
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 99.98
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 99.98
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 99.97
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 99.97
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 99.96
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 99.96
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 99.96
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 99.96
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 99.96
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 99.94
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 99.93
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 99.89
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 99.87
3fjy_A364 Probable MUTT1 protein; dimer, protein structure i 99.79
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 99.77
4hbz_A186 Putative phosphohistidine phosphatase, SIXA; struc 99.65
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 99.27
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 99.23
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 99.08
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 99.01
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 98.95
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 98.87
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.83
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 98.81
2vli_A183 Antibiotic resistance protein; transferase, tunica 98.77
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 98.73
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 98.73
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 98.72
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 98.68
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 98.65
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 98.64
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.59
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 98.59
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.57
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 98.54
3tlx_A243 Adenylate kinase 2; structural genomics, structura 98.5
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 98.49
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 98.49
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 98.48
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 98.48
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 98.46
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.39
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.39
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 98.35
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 98.31
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.29
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 98.29
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 98.27
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.21
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.18
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.17
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 98.14
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 98.11
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 98.08
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 98.07
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 98.06
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.02
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 97.96
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 97.95
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.94
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.89
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.87
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.85
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.84
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.8
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.79
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.79
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 97.73
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.72
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.65
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 97.64
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 97.64
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.61
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.57
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 97.57
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 97.46
1via_A175 Shikimate kinase; structural genomics, transferase 97.45
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 97.43
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.42
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 97.33
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 97.31
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.2
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.18
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.1
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 97.09
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.09
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 97.01
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.95
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 96.94
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.92
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.91
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.9
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.88
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 96.87
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.79
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.7
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.7
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.68
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.65
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 96.47
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.41
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.28
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.2
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.18
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 95.99
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.56
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 95.52
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.49
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.08
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.06
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.0
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.97
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 94.95
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.87
3r20_A233 Cytidylate kinase; structural genomics, seattle st 94.84
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.71
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 94.43
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 94.41
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.39
1nd6_A 354 Prostatic acid phosphatase; PAP, prostate, phospha 94.22
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.16
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 94.03
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.03
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.0
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.94
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 93.91
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 93.8
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.74
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.67
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 93.65
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 93.55
1xjc_A169 MOBB protein homolog; structural genomics, midwest 93.51
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 93.43
1dkq_A 410 Phytase; histidine acid phosphatase fold, hydrolas 93.26
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.26
2xxa_A433 Signal recognition particle protein; protein trans 93.24
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.23
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 93.18
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.06
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 93.03
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 92.98
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.97
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.95
3it3_A342 Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A 92.93
2v1u_A387 Cell division control protein 6 homolog; DNA repli 92.88
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 92.87
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 92.87
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 92.76
3bos_A242 Putative DNA replication factor; P-loop containing 92.62
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 92.59
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.59
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 92.57
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 92.46
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 92.45
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 92.42
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.41
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 92.24
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.15
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 92.11
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 92.07
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 92.04
2kjq_A149 DNAA-related protein; solution structure, NESG, st 92.04
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 92.03
2og2_A359 Putative signal recognition particle receptor; nuc 91.99
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 91.94
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 91.8
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 91.8
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 91.44
2wnh_A 418 3-phytase; histidine acid phosphatase, hydrolase; 91.35
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 91.27
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 91.24
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 91.23
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 91.15
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 90.97
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 90.92
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 90.87
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 90.83
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 90.82
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 90.81
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 90.8
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 90.76
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 90.55
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.43
1u94_A356 RECA protein, recombinase A; homologous recombinat 90.39
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 90.37
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.37
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 90.2
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 90.14
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 90.13
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 90.05
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 89.98
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 89.98
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 89.97
3ntl_A 398 Acid glucose-1-phosphate phosphatase; histidine ac 89.93
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 89.83
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 89.82
2chg_A226 Replication factor C small subunit; DNA-binding pr 89.78
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 89.75
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 89.72
1qwo_A 442 Phytase; alpha barrel, beta sandwich, orthogonal b 89.69
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.66
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 89.65
3lxx_A239 GTPase IMAP family member 4; structural genomics c 89.65
2ghi_A260 Transport protein; multidrug resistance protein, M 89.62
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 89.6
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 89.55
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 89.51
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 89.46
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 89.39
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 89.36
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 89.32
2fh5_B214 SR-beta, signal recognition particle receptor beta 89.17
3iby_A256 Ferrous iron transport protein B; G protein, G dom 89.15
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 89.1
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 89.03
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 88.85
2r6a_A454 DNAB helicase, replicative helicase; replication, 88.78
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 88.77
2qgz_A308 Helicase loader, putative primosome component; str 88.72
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 88.63
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 88.54
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 88.48
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 88.46
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 88.41
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 88.35
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 88.31
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 88.31
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 88.26
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 88.23
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 88.14
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 88.11
1b0u_A262 Histidine permease; ABC transporter, transport pro 88.1
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 88.09
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 88.01
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 87.92
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 87.78
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 87.77
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 87.69
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 87.6
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 87.5
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 87.49
1tue_A212 Replication protein E1; helicase, replication, E1E 87.48
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 87.42
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 87.4
3k4q_A 444 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hex 87.36
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 87.22
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 87.21
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 87.03
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 86.93
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 86.75
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 86.68
3czq_A304 Putative polyphosphate kinase 2; structural genomi 86.47
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 86.39
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 86.39
2www_A349 Methylmalonic aciduria type A protein, mitochondri 86.34
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 86.32
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 86.3
1ji0_A240 ABC transporter; ATP binding protein, structural g 86.18
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 86.03
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 85.95
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 85.95
3co5_A143 Putative two-component system transcriptional RES 85.87
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 85.86
2r62_A268 Cell division protease FTSH homolog; ATPase domain 85.75
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 85.72
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 85.7
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 85.56
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 85.47
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 85.36
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 85.34
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 85.27
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 85.15
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 85.13
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 85.1
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 85.09
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 85.08
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 85.02
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 85.0
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 84.92
1sgw_A214 Putative ABC transporter; structural genomics, P p 84.9
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 84.89
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 84.86
2hf9_A226 Probable hydrogenase nickel incorporation protein 84.7
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 84.69
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 84.5
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 84.41
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 84.35
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 84.33
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 84.28
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 84.26
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 84.08
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 84.06
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 84.02
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 84.02
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 83.95
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 83.94
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 83.93
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 83.93
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 83.89
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 83.85
2wji_A165 Ferrous iron transport protein B homolog; membrane 83.83
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 83.78
1ojl_A304 Transcriptional regulatory protein ZRAR; response 83.65
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 83.64
2ged_A193 SR-beta, signal recognition particle receptor beta 83.6
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 83.49
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 83.24
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 83.16
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 83.15
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 83.11
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 83.07
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 82.99
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 82.97
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 82.96
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 82.95
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 82.95
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 82.85
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 82.84
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 82.62
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 82.52
2r44_A331 Uncharacterized protein; putative ATPase, structur 82.51
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 82.43
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 82.31
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 82.26
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 82.26
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 82.17
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 82.13
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 82.07
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 82.06
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 81.97
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 81.95
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 81.95
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 81.93
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 81.93
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 81.81
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 81.74
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 81.73
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 81.71
1nrj_B218 SR-beta, signal recognition particle receptor beta 81.67
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 81.64
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 81.62
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 81.61
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 81.59
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 81.52
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 81.52
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 81.5
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 81.49
2cvh_A220 DNA repair and recombination protein RADB; filamen 81.45
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 81.43
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 81.38
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 81.35
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 81.33
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 81.3
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 81.28
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 81.23
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 81.15
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 81.14
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 81.04
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 81.0
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 80.9
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 80.88
3cwq_A209 Para family chromosome partitioning protein; alpha 80.87
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 80.86
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 80.84
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 80.8
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 80.77
4a74_A231 DNA repair and recombination protein RADA; hydrola 80.63
3ice_A422 Transcription termination factor RHO; transcriptio 80.63
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 80.63
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 80.58
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 80.57
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 80.56
3end_A307 Light-independent protochlorophyllide reductase ir 80.4
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 80.39
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 80.33
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 80.28
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 80.25
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 80.18
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 80.17
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 80.07
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-76  Score=642.70  Aligned_cols=410  Identities=42%  Similarity=0.777  Sum_probs=381.0

Q ss_pred             ccCCCeEEEEecCCCCCCchhhhhHHHHhhhcCCcceeeccchhhhhhcccCCCCCCCCCCChHHHHHHHHHHHHHHHHH
Q psy673           31 RTVTPQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNEYALSIRDQIALQALED  110 (512)
Q Consensus        31 ~~~~~~~i~~vGlp~rGKS~~a~~l~~~l~~~~~~~~~~~~~~~rr~~~~~~~~~~~~f~~~~~~~~~~r~~~~~~~~~~  110 (512)
                      ....|.+|+|+|+||+||||+|++|+++|+|.++++.+|+.|.+|+.+.+.                             
T Consensus        31 ~~~~~~lIvlvGlpGSGKSTia~~La~~L~~~~~d~~v~s~D~~r~~~~~~-----------------------------   81 (520)
T 2axn_A           31 LTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQ-----------------------------   81 (520)
T ss_dssp             --CCCEEEEEECCTTSSHHHHHHHHHHHHHHTTCCEEEEEHHHHHHHHHSC-----------------------------
T ss_pred             CCCCCeEEEEECCCCCCHHHHHHHHHHHHhhcCCCeEEecccHHHHHhccC-----------------------------
Confidence            356789999999999999999999999999999999999999999887761                             


Q ss_pred             HHHHHhcCCCCCCCcccccccCCCCCCCCCcccCCCHHHHHHHHHHHHHHHHHHHHHH-HcCCcEEEEcCCChhHHHHHH
Q psy673          111 LDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRDQIALQALEDLDDWI-IKGGQVAFFDATNSTQARRNT  189 (512)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fd~~n~~~~~~r~~~a~~~l~~~~~~l-~~~g~~~i~Datn~~~~~R~~  189 (512)
                                               ....++|++.+..+...|++++..++.++..+| ++.|.++|+||||.++++|+.
T Consensus        82 -------------------------~~~~~~f~~~~~~~~~~re~~~~~~l~~~~~~L~~~~g~~VIvDat~~~~~~R~~  136 (520)
T 2axn_A           82 -------------------------YSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHM  136 (520)
T ss_dssp             -------------------------CCCGGGGCTTCHHHHHHHHHHHHHHHHHHHHHHHHSCCCEEEEESCCCSHHHHHH
T ss_pred             -------------------------CccccccCcccHHHHHHHHHHHHHHHHHHHHHHHhcCCceEEecCCCCCHHHHHH
Confidence                                     123468998888888888999999999999999 578999999999999999999


Q ss_pred             HHHHHHhhcCceEEEEEEEeCCHHHHHHHHHHHHhcCCCCCCCChhHHHHHHHHHHHHhhHhceecccC----CcceEEE
Q psy673          190 IHHKIVEERQYMLFFVESLCDDPDILDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTED----HLSYMQI  265 (512)
Q Consensus       190 ~~~~~~~~~~~~~~~~e~~~~d~~~~~~n~~~~~~~~~dy~~~~~~~a~~df~~R~~~~~~~yepl~~~----e~~yik~  265 (512)
                      +.+ ++++.|++++|||+.|+|++++++|+++++...|+|.+.+++++.++|.+|++.|++.|||++++    +++|||+
T Consensus       137 ~~~-~a~~~g~~v~~l~~~~~d~e~i~~ri~~r~~~rPdl~~~d~e~~~~~~~~Ri~~y~~~Yepi~~ee~~~dl~yik~  215 (520)
T 2axn_A          137 ILH-FAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKV  215 (520)
T ss_dssp             HHH-HHHHHTCEEEEEEEECCCHHHHHHHHHHHTTTSGGGTTSCHHHHHHHHHHHHHHHHTTCCCCCTTTTTTTSEEEEE
T ss_pred             HHH-HHHHcCCeEEEEEEeCChHHHHHHHHHhhhhcCCccccCCHHHHHHHHHHHHHhhhhhhcccChhhcccCcceEEE
Confidence            999 89999999999999999999999999877878899999999999999999999999999999943    4999999


Q ss_pred             EecCceeEeccCCCccccchhhhccccCcCCcEEEEecccccccccccccCCCCCCCHHHHHHHHHhhhhhhhcCCCCcE
Q psy673          266 YNVGKRIVVHNETGPVQKRIVRFLMHLNITPRTVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLR  345 (512)
Q Consensus       266 ~n~g~~~~~~~~~g~l~s~i~~fLmn~~~~~~~I~LVRHGes~~n~~~~~~gD~pLTe~G~~qA~~l~~~L~~~~~~~~~  345 (512)
                      +|+|+++++|+++|||+++|||||||+|+++++||||||||+++|..++++||+|||+.|++||+.++++|...+++++.
T Consensus       216 id~g~~~~~~~~~g~l~~~~~~~l~n~~~~~~~i~LvRHGet~~n~~~~~~gD~pLt~~G~~qA~~l~~~L~~~~~~~~~  295 (520)
T 2axn_A          216 IDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLR  295 (520)
T ss_dssp             ETTTTEEEEECCCSHHHHHHHHHHTTCCCSCCCEEEEECCCBHHHHHTBCSSCCCBCHHHHHHHHHHHHHHHHHCCSCCE
T ss_pred             EcCccccccCCCCCCcchhhhhhhcccCCCceeEEEeecceeccccCCccCCCcccCHHHHHHHHHHHHHHHhcCCCCCe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988877789


Q ss_pred             EEeCcHHHHHHHHhHcccCcccccccccccCCcCCCCCHHHHHHhchHHHHHHhcCCCCCCCCCCCCHHHHHHHHHHHHH
Q psy673          346 IWTSSKEAAKQTVAQCPGSHKEYKALDDIHAGICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIIL  425 (512)
Q Consensus       346 V~tSpl~RaiqTA~~i~~~~~~~~~L~E~~~G~~eg~t~~ei~~~~p~~~~~~~~d~~~~~~p~gES~~d~~~Rv~~~i~  425 (512)
                      |||||+.||+|||+.+..++..++.|+|+++|.|+|++++++.+.||+.|..|..|++.+++|+|||+.++..|+.+++.
T Consensus       296 v~sSpl~Ra~qTA~~i~~~~~~~~~L~E~~~G~~eG~~~~ei~~~~p~~~~~~~~d~~~~~~p~gEs~~~~~~Rv~~~l~  375 (520)
T 2axn_A          296 VWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIM  375 (520)
T ss_dssp             EEECSSHHHHHHHHTTTSCEEECGGGSCCCCGGGTTCBHHHHHHHCHHHHHHHHHCTTTCCCTTSCCHHHHHHHHHHHHH
T ss_pred             EEeCCcHHHHHHHHHhCCCcEEccccccccCCcccCCcHHHHHHHCHHHHHHHhcCcccCCCCCCCCHHHHHHHHHHHHH
Confidence            99999999999999996688899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHhCCCeEEEEeChHHHHHHHHHhhCCCchhhcc-cCCCceEEEEEEe--CCEEEEEe-ccCCCCCcccCCCCC
Q psy673          426 KIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDRFAY-KVRKKTHFLLSSR--NMTLELIF-PHHSTGTLRPQPFGH  496 (512)
Q Consensus       426 el~~~~~~vlIVsH~~vir~ll~~l~g~~~~~~~~-~ip~~sv~~l~~~--~~~~~~i~-~~~~~~~~~~~p~~~  496 (512)
                      ++.+. ++||||||+++|++++++++|.+.+.++. .+|+++|++|.+.  |+.++++. +.+++++|+++|...
T Consensus       376 ~l~~~-~~vlvVsH~~~ir~ll~~ll~~~~~~~~~l~~p~~sv~~l~~~~~g~~~~~~~ln~~~~~~~~~~~~~~  449 (520)
T 2axn_A          376 ELERQ-ENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDA  449 (520)
T ss_dssp             HHHHC-SSEEEEECHHHHHHHHHHHTTCCTTTGGGCCCCTTEEEEEEEETTEEEEEEEECSCCCCCCCCCCC---
T ss_pred             HHhCC-CcEEEEEChHHHHHHHHHHhCCCHHHhhccCCCCCeEEEEEEcCCCceEEEEECCCccccccCCCcccc
Confidence            99876 78999999999999999999999999999 9999999999986  77888888 999999999999743
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Back     alignment and structure
>4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1nd6_A Prostatic acid phosphatase; PAP, prostate, phosphate, inhibi hydrolase; HET: NAG MAN 1PE; 2.40A {Homo sapiens} SCOP: c.60.1.2 PDB: 1nd5_A* 2hpa_A* 1cvi_A* 1rpa_A* 1rpt_A* 2l3h_A 2l77_A 2l79_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1dkq_A Phytase; histidine acid phosphatase fold, hydrolase; HET: IHP; 2.05A {Escherichia coli} SCOP: c.60.1.2 PDB: 1dkp_A* 1dkm_A 1dkn_A 1dko_A 1dkl_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3it3_A Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A {Francisella tularensis subsp} PDB: 4e3w_A 2glc_A 2glb_A 2gla_A 3it0_A* 3it1_A* 3it2_A 2p36_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2wnh_A 3-phytase; histidine acid phosphatase, hydrolase; 1.68A {Klebsiella pneumoniae} PDB: 2wni_A 2wu0_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3ntl_A Acid glucose-1-phosphate phosphatase; histidine acid phosphatase, phytate binding site, hydrolase; HET: IHP; 1.88A {Enterobacter cloacae} PDB: 1nt4_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1qwo_A Phytase; alpha barrel, beta sandwich, orthogonal bundle, glycoprotein phosphohistidine, hydrolase; HET: NEP NAG; 1.50A {Aspergillus fumigatus} SCOP: c.60.1.2 PDB: 1skb_A* 1sk8_A* 1ska_A* 1sk9_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3k4q_A 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hexakis phosphate phosphohydrolase, 37288-11-2, MYO-inositol hexakis sulfate, 62-1; HET: IHS NAG; 2.20A {Aspergillus niger} SCOP: c.60.1.2 PDB: 3k4p_A* 1ihp_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 512
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 4e-36
d1bifa2219 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc 7e-22
d1fzta_211 c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea 5e-15
d1xq9a_241 c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium 1e-11
d1h2ea_207 c.60.1.1 (A:) Broad specificity phosphatase PhoE ( 3e-11
d1e58a_247 c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia 2e-10
d1riia_243 c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri 2e-08
d1qhfa_240 c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea 8e-07
d2hhja1248 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human 9e-07
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 2e-05
d1v37a_171 c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphat 2e-05
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 3e-05
d2qy9a2211 c.37.1.10 (A:285-495) GTPase domain of the signal 5e-05
d1okkd2207 c.37.1.10 (D:97-303) GTPase domain of the signal r 6e-04
d1vmaa2213 c.37.1.10 (A:82-294) GTPase domain of the signal r 0.002
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
domain: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  131 bits (329), Expect = 4e-36
 Identities = 98/266 (36%), Positives = 139/266 (52%), Gaps = 57/266 (21%)

Query: 35  PQVVAMVGLPARGKSYMATKLCRYLRWLGLNVRLFNLGDYRRRHASISSATHDFFRSDNE 94
           P ++ MVGLPARGK+Y++ KL RYL ++G+  R FN+G Y RR    +  + +FF  DNE
Sbjct: 2   PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQY-RRDMVKTYKSFEFFLPDNE 60

Query: 95  YALSIRDQIALQALEDLDDWIIKGGHFPQLGDYRRRHASGSRATHDFFRSDNEYALSIRD 154
             L IR Q AL AL D+  ++                                       
Sbjct: 61  EGLKIRKQCALAALNDVRKFL--------------------------------------- 81

Query: 155 QIALQALEDLDDWIIKGGQVAFFDATNSTQARRNTIHHKIVEERQYMLFFVESLCDDPDI 214
                          +GG VA FDATN+T+ RR  +     E+  Y  FFVES+C DP++
Sbjct: 82  -------------SEEGGHVAVFDATNTTRERRA-MIFNFGEQNGYKTFFVESICVDPEV 127

Query: 215 LDRNIKEVKLTGPDYQGFEPDKAYEDFMYRIGHYEKQYQTLTEDH---LSYMQIYNVGKR 271
           +  NI +VKL  PDY   + D+A EDFM RI  YE  Y++L E+    LSY++I +VG+ 
Sbjct: 128 IAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEEQDRDLSYIKIMDVGQS 187

Query: 272 IVVHNETGPVQKRIVRFLMHLNITPR 297
            VV+     +Q RIV +LM++++TPR
Sbjct: 188 YVVNRVADHIQSRIVYYLMNIHVTPR 213
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Length = 207 Back     information, alignment and structure
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
d1bifa2219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 100.0
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 100.0
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillu 100.0
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosacc 100.0
d1e58a_247 Phosphoglycerate mutase {Escherichia coli [TaxId: 100.0
d1riia_243 Phosphoglycerate mutase {Mycobacterium tuberculosi 100.0
d2hhja1248 Phosphoglycerate mutase {Human (Homo sapiens) [Tax 100.0
d1xq9a_241 Phosphoglycerate mutase {Plasmodium falciparum [Ta 100.0
d1v37a_171 Alpha-ribazole-5'-phosphate phosphatase {Thermus t 100.0
d1qhfa_240 Phosphoglycerate mutase {Baker's yeast (Saccharomy 99.97
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 99.58
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 99.31
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.06
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.88
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.82
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 98.76
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.71
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.6
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.6
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.57
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.47
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.39
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.37
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.33
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.3
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.29
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.28
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.24
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.16
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.14
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.07
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.04
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.02
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.0
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.97
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.95
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.88
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.82
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.79
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.46
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.42
d1vmaa2213 GTPase domain of the signal recognition particle r 97.26
d2qy9a2211 GTPase domain of the signal recognition particle r 97.24
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.1
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.08
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.02
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.02
d1okkd2207 GTPase domain of the signal recognition particle r 96.96
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.94
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.65
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.48
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.38
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.26
d1qwoa_ 435 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 95.72
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.7
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.64
d1nd6a_ 342 Prostatic acid phosphatase {Human (Homo sapiens) [ 95.64
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.5
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.47
d1nt4a_ 391 Glucose-1-phosphatase {Escherichia coli [TaxId: 56 95.18
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.17
d1ihpa_ 438 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 95.16
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.15
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.14
d1dkla_ 409 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 94.92
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.88
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.74
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.73
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.54
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.51
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.51
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.46
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.95
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.9
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.79
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.49
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.37
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.14
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.1
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.06
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.81
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.55
d1qfxa_ 447 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 92.53
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.47
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.42
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.42
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.22
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.13
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.04
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.89
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.76
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 91.58
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.29
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 91.2
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.16
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.1
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 91.06
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.04
d1svma_362 Papillomavirus large T antigen helicase domain {Si 90.89
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 90.8
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 90.71
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.6
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 90.35
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.34
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 90.15
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.11
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 90.04
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.74
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 89.65
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 89.44
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.29
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.09
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 89.07
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 88.82
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.72
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 88.71
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 88.38
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 87.99
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 87.98
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 87.92
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 87.91
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 87.9
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 87.88
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.86
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.54
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.42
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 87.39
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 87.21
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 87.19
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 87.12
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.09
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.8
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 86.47
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 86.25
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 85.82
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 85.63
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 85.51
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 85.44
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 85.39
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 85.35
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 85.34
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 85.33
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 85.33
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 85.32
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 85.31
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.27
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 84.94
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 84.85
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 84.81
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 84.77
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 84.59
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.55
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 84.49
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 84.45
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 84.16
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 84.14
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 84.08
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 84.02
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 83.99
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 83.85
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 83.82
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.67
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 83.62
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 83.49
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 83.44
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 83.2
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 82.89
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 82.74
d1nrjb_209 Signal recognition particle receptor beta-subunit 82.72
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 82.71
d2fh5b1207 Signal recognition particle receptor beta-subunit 82.02
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 82.01
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 81.96
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 81.92
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 81.74
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 81.66
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 81.63
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 81.41
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 81.19
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 80.96
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 80.81
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 80.76
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 80.75
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 80.71
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 80.54
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 80.44
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 80.25
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 80.25
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 80.18
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 80.16
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 80.08
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 80.01
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain
domain: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=3.6e-39  Score=310.11  Aligned_cols=199  Identities=35%  Similarity=0.639  Sum_probs=187.5

Q ss_pred             EEEEecccccccccccccCCCCCCCHHHHHHHHHhhhhhhhcCCCCcEEEeCcHHHHHHHHhHcccCcccccccccccCC
Q psy673          298 TVYLTRPGESINNVQAILGGDSDLTAGGQEYSKCLSDFVSEKNLSDLRIWTSSKEAAKQTVAQCPGSHKEYKALDDIHAG  377 (512)
Q Consensus       298 ~I~LVRHGes~~n~~~~~~gD~pLTe~G~~qA~~l~~~L~~~~~~~~~V~tSpl~RaiqTA~~i~~~~~~~~~L~E~~~G  377 (512)
                      .||||||||+++|..++++||+|||+.|++||+.++++|.+.++.++.|||||+.||+|||+.+..++..++.|+|+++|
T Consensus         1 siyLvRHGet~~n~~~~~~gD~~LT~~G~~QA~~l~~~l~~~~i~~d~i~sSpl~Ra~qTA~~i~~~~~~~~~L~E~~~g   80 (219)
T d1bifa2           1 SIYLCRHGESELNLKGRIGGDPGLSPRGREFSKHLAQFISDQNIKDLKVFTSQMKRTIQTAEALSVPYEQFKVLNEIDAG   80 (219)
T ss_dssp             CEEEEECSCBHHHHHTBCSSCCCBCHHHHHHHHHHHHHHHHHTCTTCEEEECSSHHHHHHHTTSSSCCEECGGGSCCCCG
T ss_pred             CEEEEeCCCCchhhcCcccCCCCcCHHHHHHHHHHHHHHHhcCCCcceeecccccchHHHHHhhhccccccccccccccc
Confidence            48999999999999999999999999999999999999998888888999999999999999998899999999999999


Q ss_pred             cCCCCCHHHHHHhchHHHHHHhcCCCCCCCCCCCCHHHHHHHHHHHHHHhHhCCCeEEEEeChHHHHHHHHHhhCCCchh
Q psy673          378 ICEGQTYTEIYTNHCAQYIDTRADKFYNRWPQGECYKDVLTRLELIILKIEHSKSNLLIVSHPAVLRCLLGYFQEEPPDR  457 (512)
Q Consensus       378 ~~eg~t~~ei~~~~p~~~~~~~~d~~~~~~p~gES~~d~~~Rv~~~i~el~~~~~~vlIVsH~~vir~ll~~l~g~~~~~  457 (512)
                      .|+|++.+++.+.+|..+..|..+++.+++|+|||+.++..|+..++.++.+. ++|+|||||++|++++++++|.+.+.
T Consensus        81 ~~eg~~~~~~~~~~~~~~~~~~~~~~~~~~p~gEs~~~~~~R~~~~l~~l~~~-~~vliVsHg~~i~~ll~~~l~~~~~~  159 (219)
T d1bifa2          81 VCEEMTYEEIQDHYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQ-ENVLVICHQAVMRCLLAYFLDKAAEE  159 (219)
T ss_dssp             GGTTCBHHHHHHHCHHHHHHHHHCTTTCCCTTCCCHHHHHHHHHHHHHHHHHC-SSEEEEECHHHHHHHHHHHTTCCTTT
T ss_pred             cccccccccchhcchHHHHhhhcCcccccccCCchHHHHHHHHHHHHHHHhCC-CcEEEEECHHHHHHHHHHHhCCCHHH
Confidence            99999999999999999999999999999999999999999999999999775 78999999999999999999999999


Q ss_pred             hcc-cCCCceEEEEEEe--CCEEEEEe-ccCCCCCcccCCCCCC
Q psy673          458 FAY-KVRKKTHFLLSSR--NMTLELIF-PHHSTGTLRPQPFGHL  497 (512)
Q Consensus       458 ~~~-~ip~~sv~~l~~~--~~~~~~i~-~~~~~~~~~~~p~~~~  497 (512)
                      ++. ++|+++|++|++.  +|.++.+. +...+.+++..|.+.+
T Consensus       160 ~~~~~i~~~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~  203 (219)
T d1bifa2         160 LPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVD  203 (219)
T ss_dssp             GGGCCCCTTEEEEEEECSSSEEEEEEECSCCCCCCCCCCCSCCC
T ss_pred             HhcCCCCCCeEEEEEecCCCceEEEEEcCccchhhccCCcccCC
Confidence            999 9999999999987  67777777 6778888988887665
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qwoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qfxa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure