Psyllid ID: psy6886

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MSKIGINGFGRIGLNNLNSQPCLRLVSMVSDVLDVLYSELLLPREPSFVTVSNSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR
ccccccccEEEEEEccccccccccEEEcccccHHHHHHHcccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHccccccccccEEEEEccccccEEEEEEEc
ccEEEEEcccHHHHHcccccccccccEEEEEEccccccccccEEEEcccHHHHHHHHHHHHHHHHHcEEEEEEEEEEccccccEccccccccccHHHcEcccccEEEcccHHHHHHHHcHHHcccEEEEEEEccccccEEEEEEEE
mskigingfgriglnnlnsqpclRLVSMVSDVLDVLYselllprepsfvtVSNSLLTLAKVIHDNFEIVEGLMTTVHAttatqktvdgpsgklwrdgrgaaqniiPAATGAAKAVGKvipalngkltgmaFRVPVANVSVVDLTVR
MSKIGINGFGRIGLNNLNSQPCLRLVSMVSDVLDVLYSELLLPREPSFVTVSNSLLTLAKVIHDNFEIVEGLMTTVHattatqktvdgpsgkLWRDGRGAAQNIIPAATGAAKAVGKVIPALNgkltgmafrvpvanvsvvdltvr
MSKIGINGFGRIGLNNLNSQPClrlvsmvsdvldvlYSELLLPREPSFVTVSNSLLTLAKVIHDNFEIVEGLMttvhattatqktvDGPSGKLWRDGRGAAQNIIPaatgaakavgkvIPALNGKLTGMAFRVPVANVSVVDLTVR
***IGINGFGRIGLNNLNSQPCLRLVSMVSDVLDVLYSELLLPREPSFVTVSNSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPVANVSVVDL***
******NGFGRIGLNNLNSQPCLRLVSMVSDVLDVLYSELLLPREPSFVTVSNSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR
MSKIGINGFGRIGLNNLNSQPCLRLVSMVSDVLDVLYSELLLPREPSFVTVSNSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR
*SKIGINGFGRIGLNNLNSQPCLRLVSMVSDVLDVLYSELLLPREPSFVTVSNSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKIGINGFGRIGLNNLNSQPCLRLVSMVSDVLDVLYSELLLPREPSFVTVSNSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
Q4U3L0333 Glyceraldehyde-3-phosphat N/A N/A 0.650 0.285 0.915 2e-44
P07486332 Glyceraldehyde-3-phosphat yes N/A 0.650 0.286 0.926 2e-44
O44104332 Glyceraldehyde-3-phosphat yes N/A 0.650 0.286 0.926 2e-44
O44105304 Glyceraldehyde-3-phosphat N/A N/A 0.650 0.312 0.926 3e-44
P07487332 Glyceraldehyde-3-phosphat yes N/A 0.650 0.286 0.915 5e-44
Q01597332 Glyceraldehyde-3-phosphat N/A N/A 0.650 0.286 0.894 2e-42
P17244333 Glyceraldehyde-3-phosphat yes N/A 0.650 0.285 0.884 2e-42
A3FKF7333 Glyceraldehyde-3-phosphat N/A N/A 0.650 0.285 0.884 2e-42
P16858333 Glyceraldehyde-3-phosphat yes N/A 0.650 0.285 0.884 2e-42
P04797333 Glyceraldehyde-3-phosphat yes N/A 0.650 0.285 0.884 2e-42
>sp|Q4U3L0|G3P_GLOMM Glyceraldehyde-3-phosphate dehydrogenase OS=Glossina morsitans morsitans GN=Gapdh PE=2 SV=1 Back     alignment and function desciption
 Score =  177 bits (449), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/95 (91%), Positives = 89/95 (93%)

Query: 52  SNSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGA 111
           +N L  LAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPA+TGA
Sbjct: 151 TNCLAPLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPASTGA 210

Query: 112 AKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR 146
           AKAVGKVIP LNGKLTGMAFRVP  NVSVVDLTVR
Sbjct: 211 AKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVR 245

Glossina morsitans morsitans (taxid: 37546)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2
>sp|P07486|G3P1_DROME Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Drosophila melanogaster GN=Gapdh1 PE=2 SV=2 Back     alignment and function description
>sp|O44104|G3P2_DROPS Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila pseudoobscura pseudoobscura GN=Gapdh2 PE=2 SV=2 Back     alignment and function description
>sp|O44105|G3P2_DROSU Glyceraldehyde-3-phosphate dehydrogenase 2 (Fragment) OS=Drosophila subobscura GN=Gapdh2 PE=2 SV=1 Back     alignment and function description
>sp|P07487|G3P2_DROME Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila melanogaster GN=Gapdh2 PE=1 SV=2 Back     alignment and function description
>sp|Q01597|G3P_DROHY Glyceraldehyde-3-phosphate dehydrogenase OS=Drosophila hydei GN=Gapdh1 PE=3 SV=1 Back     alignment and function description
>sp|P17244|G3P_CRIGR Glyceraldehyde-3-phosphate dehydrogenase OS=Cricetulus griseus GN=GAPDH PE=2 SV=2 Back     alignment and function description
>sp|A3FKF7|G3P_MUSPF Glyceraldehyde-3-phosphate dehydrogenase OS=Mustela putorius furo GN=GAPDH PE=2 SV=1 Back     alignment and function description
>sp|P16858|G3P_MOUSE Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus GN=Gapdh PE=1 SV=2 Back     alignment and function description
>sp|P04797|G3P_RAT Glyceraldehyde-3-phosphate dehydrogenase OS=Rattus norvegicus GN=Gapdh PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
373132114172 glyceraldhyde-3-phosphate dehydrogenase, 0.726 0.616 0.857 1e-45
343112947230 glyceraldehyde-3-phosphate dehydrogenase 0.726 0.460 0.848 2e-45
307643737230 glyceraldhyde-3-phosphate dehydrogenase 0.726 0.460 0.848 3e-45
269117507230 glyceraldhyde-3-phosphate dehydrogenase 0.698 0.443 0.870 3e-45
307643777230 glyceraldhyde-3-phosphate dehydrogenase 0.726 0.460 0.848 3e-45
269117469230 glyceraldhyde-3-phosphate dehydrogenase 0.698 0.443 0.870 3e-45
269117407230 glyceraldhyde-3-phosphate dehydrogenase 0.698 0.443 0.870 3e-45
343112957229 glyceraldehyde-3-phosphate dehydrogenase 0.726 0.462 0.848 3e-45
269117417230 glyceraldhyde-3-phosphate dehydrogenase 0.698 0.443 0.870 3e-45
343113017214 glyceraldehyde-3-phosphate dehydrogenase 0.698 0.476 0.870 3e-45
>gi|373132114|gb|AEY63550.1| glyceraldhyde-3-phosphate dehydrogenase, partial [Tamsia hieroglyphica] Back     alignment and taxonomy information
 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/112 (85%), Positives = 98/112 (87%), Gaps = 6/112 (5%)

Query: 41  LLPREPSFVTVSN------SLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLW 94
           L   EPSF  +SN      SL  LAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLW
Sbjct: 18  LEAYEPSFKVISNASCTTNSLAPLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLW 77

Query: 95  RDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR 146
           RDGRGA QNIIPA+TGAAKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR
Sbjct: 78  RDGRGAQQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR 129

Source: Tamsia hieroglyphica

Species: Tamsia hieroglyphica

Genus: Tamsia

Family: Erebidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|343112947|gb|AEL87432.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Coleophora caelebipennella] Back     alignment and taxonomy information
>gi|307643737|gb|ADN82685.1| glyceraldhyde-3-phosphate dehydrogenase [Phyllonorycter sorbi] Back     alignment and taxonomy information
>gi|269117507|gb|ACZ27233.1| glyceraldhyde-3-phosphate dehydrogenase [Issoria eugenia] Back     alignment and taxonomy information
>gi|307643777|gb|ADN82705.1| glyceraldhyde-3-phosphate dehydrogenase [Phyllonorycter apparella] Back     alignment and taxonomy information
>gi|269117469|gb|ACZ27214.1| glyceraldhyde-3-phosphate dehydrogenase [Euptoieta claudia] Back     alignment and taxonomy information
>gi|269117407|gb|ACZ27183.1| glyceraldhyde-3-phosphate dehydrogenase [Boloria napaea] gi|269117617|gb|ACZ27288.1| glyceraldhyde-3-phosphate dehydrogenase [Terinos atlita] Back     alignment and taxonomy information
>gi|343112957|gb|AEL87437.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Eumenodora encrypta] Back     alignment and taxonomy information
>gi|269117417|gb|ACZ27188.1| glyceraldhyde-3-phosphate dehydrogenase [Cethosia cyane] Back     alignment and taxonomy information
>gi|343113017|gb|AEL87467.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Epiplema inconspicua] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
UNIPROTKB|Q4U3L0333 Gapdh "Glyceraldehyde-3-phosph 0.650 0.285 0.663 3.8e-33
FB|FBgn0001091332 Gapdh1 "Glyceraldehyde 3 phosp 0.650 0.286 0.663 6.2e-33
FB|FBgn0001092332 Gapdh2 "Glyceraldehyde 3 phosp 0.650 0.286 0.663 6.2e-33
UNIPROTKB|Q01597332 Gapdh1 "Glyceraldehyde-3-phosp 0.650 0.286 0.642 1.4e-31
UNIPROTKB|P00356333 GAPDH "Glyceraldehyde-3-phosph 0.650 0.285 0.642 6.1e-31
UNIPROTKB|A3FKF7333 GAPDH "Glyceraldehyde-3-phosph 0.650 0.285 0.642 6.1e-31
UNIPROTKB|O57479333 GAPDH "Glyceraldehyde-3-phosph 0.650 0.285 0.642 6.1e-31
UNIPROTKB|P17244333 GAPDH "Glyceraldehyde-3-phosph 0.650 0.285 0.642 6.1e-31
UNIPROTKB|Q05025333 GAPDH "Glyceraldehyde-3-phosph 0.650 0.285 0.642 6.1e-31
UNIPROTKB|Q4KYY3333 GAPDH "Glyceraldehyde-3-phosph 0.650 0.285 0.642 6.1e-31
UNIPROTKB|Q4U3L0 Gapdh "Glyceraldehyde-3-phosphate dehydrogenase" [Glossina morsitans morsitans (taxid:37546)] Back     alignment and assigned GO terms
 Score = 310 (114.2 bits), Expect = 3.8e-33, Sum P(2) = 3.8e-33
 Identities = 63/95 (66%), Positives = 64/95 (67%)

Query:    52 SNSLLTLAKVIHDNFEIVEGLMXXXXXXXXXXXXXDGPSGKLWRDGRGAAQNIIPXXXXX 111
             +N L  LAKVIHDNFEIVEGLM             DGPSGKLWRDGRGAAQNIIP     
Sbjct:   151 TNCLAPLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPASTGA 210

Query:   112 XXXXXXXIPALNGKLTGMAFRVPVANVSVVDLTVR 146
                    IP LNGKLTGMAFRVP  NVSVVDLTVR
Sbjct:   211 AKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVR 245
GO:0005737 "cytoplasm" evidence=ISS
GO:0015630 "microtubule cytoskeleton" evidence=ISS
FB|FBgn0001091 Gapdh1 "Glyceraldehyde 3 phosphate dehydrogenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0001092 Gapdh2 "Glyceraldehyde 3 phosphate dehydrogenase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q01597 Gapdh1 "Glyceraldehyde-3-phosphate dehydrogenase" [Drosophila hydei (taxid:7224)] Back     alignment and assigned GO terms
UNIPROTKB|P00356 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A3FKF7 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Mustela putorius furo (taxid:9669)] Back     alignment and assigned GO terms
UNIPROTKB|O57479 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Columba livia (taxid:8932)] Back     alignment and assigned GO terms
UNIPROTKB|P17244 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|Q05025 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Coturnix japonica (taxid:93934)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KYY3 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Spermophilus citellus (taxid:9997)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P17244G3P_CRIGR2, ., 6, ., 9, 9, ., -0.88420.65060.2852yesN/A
P0A9B5G3P1_SHIFL1, ., 2, ., 1, ., 1, 20.82100.65060.2870yesN/A
P46406G3P_RABIT2, ., 6, ., 9, 9, ., -0.87360.65060.2852yesN/A
P07487G3P2_DROME1, ., 2, ., 1, ., 1, 20.91570.65060.2861yesN/A
P07486G3P1_DROME1, ., 2, ., 1, ., 1, 20.92630.65060.2861yesN/A
P04797G3P_RAT2, ., 6, ., 9, 9, ., -0.88420.65060.2852yesN/A
P00356G3P_CHICK2, ., 6, ., 9, 9, ., -0.88420.65060.2852yesN/A
P00355G3P_PIG2, ., 6, ., 9, 9, ., -0.87360.65060.2852yesN/A
P04406G3P_HUMAN2, ., 6, ., 9, 9, ., -0.88420.65060.2835yesN/A
P24164G3P_KLEPN1, ., 2, ., 1, ., 1, 20.84210.65060.3135yesN/A
P04970G3P1_CAEEL1, ., 2, ., 1, ., 1, 20.85260.65060.2785yesN/A
Q4U3L0G3P_GLOMM1, ., 2, ., 1, ., 1, 20.91570.65060.2852N/AN/A
Q28259G3P_CANFA2, ., 6, ., 9, 9, ., -0.86310.65060.2852yesN/A
P17331G3P4_CAEEL1, ., 2, ., 1, ., 1, 20.85260.65060.2785yesN/A
O44104G3P2_DROPS1, ., 2, ., 1, ., 1, 20.92630.65060.2861yesN/A
O44105G3P2_DROSU1, ., 2, ., 1, ., 1, 20.92630.65060.3125N/AN/A
Q5XJ10G3P_DANRE2, ., 6, ., 9, 9, ., -0.86310.65060.2852yesN/A
P0A1P0G3P1_SALTY1, ., 2, ., 1, ., 1, 20.82100.65060.2870yesN/A
Q5RAB4G3P_PONAB2, ., 6, ., 9, 9, ., -0.88420.65060.2835yesN/A
P10096G3P_BOVIN2, ., 6, ., 9, 9, ., -0.87360.65060.2852yesN/A
P16858G3P_MOUSE2, ., 6, ., 9, 9, ., -0.88420.65060.2852yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
PLN02272421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 5e-57
pfam02800157 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh 3e-50
PTZ00023337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 5e-50
PRK15425331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 2e-47
COG0057335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 4e-47
TIGR01534326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 8e-47
PLN02358338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 2e-43
PTZ00434361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 1e-35
PRK07729343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 4e-33
PRK07403337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 2e-28
PLN03096395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 3e-25
PLN02237 442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 7e-25
PRK08289477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 4e-20
PRK08955334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 5e-20
TIGR01532325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 6e-15
PRK13535336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 3e-13
PTZ00353342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 2e-08
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information 
 Score =  182 bits (464), Expect = 5e-57
 Identities = 75/95 (78%), Positives = 83/95 (87%)

Query: 52  SNSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGA 111
           +N L  LAKV+H+ F I+EGLMTTVHATTATQKTVDGPS K WR GRGA+QNIIP++TGA
Sbjct: 237 TNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGA 296

Query: 112 AKAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR 146
           AKAVGKV+P LNGKLTGMAFRVP  NVSVVDLT R
Sbjct: 297 AKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTCR 331

Length = 421
>gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 100.0
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 100.0
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
KOG0657|consensus285 100.0
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 100.0
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 100.0
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
PF02800157 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 100.0
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 99.91
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 99.83
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 99.68
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 99.32
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 99.32
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 98.89
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 98.25
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 95.86
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 94.34
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 94.3
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 93.28
TIGR00036 266 dapB dihydrodipicolinate reductase. 93.11
KOG0657|consensus 285 91.16
PRK13303 265 L-aspartate dehydrogenase; Provisional 90.82
PRK00048 257 dihydrodipicolinate reductase; Provisional 90.57
TIGR01745 366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 89.43
COG0289 266 DapB Dihydrodipicolinate reductase [Amino acid tra 88.9
PTZ00353 342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 88.15
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 87.73
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 83.33
PRK13304 265 L-aspartate dehydrogenase; Reviewed 81.58
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 80.61
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=7.2e-60  Score=400.96  Aligned_cols=144  Identities=53%  Similarity=0.769  Sum_probs=134.3

Q ss_pred             cceeEeccCceeeeeeec---C----CCceEEEEecCC-cchhhhhhhcc------------------------------
Q psy6886           2 SKIGINGFGRIGLNNLNS---Q----PCLRLVSMVSDV-LDVLYSELLLP------------------------------   43 (146)
Q Consensus         2 ~kv~ingfgriGr~v~r~---~----~~~~vva~Ind~-~d~~y~~~~~~------------------------------   43 (146)
                      +||||||||||||+|+|+   .    +++|||| |||| +|++||+||||                              
T Consensus         4 ikVgINGFGRIGR~v~R~~~~~~~~~~~ievVA-INd~~~~~~~~ayLlkyDS~hG~~~~~v~~~~~~~~~~~~~~l~in   82 (361)
T PTZ00434          4 IKVGINGFGRIGRMVFQAICDQGLIGTEIDVVA-VVDMSTNAEYFAYQMKYDTVHGRPKYTVETTKSSPSVKTDDVLVVN   82 (361)
T ss_pred             eEEEEECcChHHHHHHHHHHHcccCCCCeEEEE-EeCCCCChhheeeeeeeecCCCCcCCceeecccccccccCCEEEEC
Confidence            699999999999999998   2    5799999 9997 99999999811                              


Q ss_pred             -----------------------------------------------------------------------c-------c
Q psy6886          44 -----------------------------------------------------------------------R-------E   45 (146)
Q Consensus        44 -----------------------------------------------------------------------~-------~   45 (146)
                                                                                             |       .
T Consensus        83 g~~I~~~~~~~dP~~ipW~~~gvD~ViE~TG~f~t~~~a~~Hl~~GAKkViiSAP~~d~~~t~V~GVN~~~y~~~~~~Ii  162 (361)
T PTZ00434         83 GHRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTEHHVV  162 (361)
T ss_pred             CEEEEEEEecCChhhCchhhcCCCEEEeCceeeccHHHHhhhhhcCCCEEEECCCCCCCCceEEEcCChHHcCcccCcEE
Confidence                                                                                   1       1


Q ss_pred             CCCCccccchhHHHHHh-hhceeeeeeeeeeeeccCccccccCCCCCCCCcCcccccceeeecccCccceeeeeecCCCC
Q psy6886          46 PSFVTVSNSLLTLAKVI-HDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNG  124 (146)
Q Consensus        46 ~s~~cttnclaPl~kvi-~~~fgI~~g~mTtvha~t~~Q~~~D~p~~~~~r~~r~a~~niIP~sTgaakav~kviP~L~G  124 (146)
                      +++|||||||||++|+| ||+|||++|+|||||+||++|+++|+|+++||||+|+|+|||||+|||||||++||+|||+|
T Consensus       163 SnASCTTNcLAP~~kvL~~~~fGI~~g~mTTVHayT~~Q~~~D~~~~kD~Rr~Raaa~nIIPtsTGAAkAv~~VlP~L~G  242 (361)
T PTZ00434        163 SNASCTTNCLAPIVHVLTKEGFGIETGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTKG  242 (361)
T ss_pred             ECCChHHHhhHHHHHHhhcCCcceEEEEEEEEecccCCcccccCcCcccccccccccccCccCCcchhhhhceeccccCC
Confidence            34569999999999999 89999999999999999999999999987999999999999999999999999999999999


Q ss_pred             CcceEEEeeecCCeeEEEeEEC
Q psy6886         125 KLTGMAFRVPVANVSVVDLTVR  146 (146)
Q Consensus       125 k~~g~a~~VP~~~~s~~dlt~~  146 (146)
                      |++|++||||++|||++||||+
T Consensus       243 Kl~G~a~RVPt~nvS~vDLt~~  264 (361)
T PTZ00434        243 KLTGMSFRVPTPDVSVVDLTFR  264 (361)
T ss_pred             ceeeEEEecccCcEeEEEEEEE
Confidence            9999999999999999999984

>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG0657|consensus Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>KOG0657|consensus Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1znq_O338 Crsytal Structure Of Human Liver Gapdh Length = 338 4e-28
1u8f_O335 Crystal Structure Of Human Placental Glyceraldehyde 4e-28
1j0x_O332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 1e-27
1ihx_A333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 1e-25
1szj_G333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 1e-25
1dss_G333 Structure Of Active-Site Carboxymethylated D-Glycer 1e-25
3gpd_R334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 2e-25
1gpd_G334 Studies Of Asymmetry In The Three-Dimensional Struc 3e-25
4gpd_1333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 3e-25
1gae_O330 Comparison Of The Structures Of Wild Type And A N31 3e-24
1gad_O330 Comparison Of The Structures Of Wild Type And A N31 3e-24
1s7c_A331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 3e-24
2vyn_A331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 4e-24
3h9e_B346 Crystal Structure Of Human Sperm-Specific Glycerald 6e-24
2vyn_D334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 1e-23
3e5r_O337 Crystal Structure And Functional Analysis Of Glycer 1e-22
3e6a_O336 Crystal Structure And Functional Analysis Of Glycer 1e-22
1dc4_A330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 4e-22
3cif_A359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 9e-20
3cps_A354 Crystal Structure Of Cryptosporidium Parvum Glycera 1e-19
1vsu_A359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 1e-19
3pym_A332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 1e-19
4iq8_A340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 1e-19
2i5p_O342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-19
2b4r_O345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 8e-19
1ywg_O337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 8e-19
3sth_A361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 6e-16
2x0n_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 2e-15
1a7k_A360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 3e-15
1gyp_A358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 3e-15
1k3t_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 9e-14
3dmt_C359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 1e-13
1nq5_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-12
1gd1_O334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 2e-12
1npt_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 3e-12
1dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 4e-12
3dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 4e-12
3hq4_R336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 8e-12
3ksd_Q336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 9e-12
3vaz_P344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 1e-11
3lvf_P338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 1e-11
3lc7_O339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 1e-11
3k9q_Q336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 1e-11
3k73_Q336 Crystal Structure Of Phosphate Bound Holo Glycerald 1e-11
3lc1_P336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 1e-11
3hja_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-10
1hdg_O332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 1e-10
3doc_A335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 2e-08
2ep7_A342 Structural Study Of Project Id Aq_1065 From Aquifex 3e-08
4dib_A345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 1e-07
1cer_O331 Determinants Of Enzyme Thermostability Observed In 2e-07
2g82_O331 High Resolution Structures Of Thermus Aquaticus Gly 2e-07
3l0d_A356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 3e-07
3b1j_A339 Crystal Structure Of Dehydrogenese Length = 339 1e-06
2d2i_A 380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 1e-06
1vc2_A331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 2e-06
1obf_O335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 2e-06
3gnq_A344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-06
2pkq_O 368 Crystal Structure Of The Photosynthetic A2b2-Glycer 1e-05
1jn0_O335 Crystal Structure Of The Non-Regulatory A4 Isoform 2e-05
2pkr_O 365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 4e-05
1rm5_O337 Crystal Structure Of Mutant S188a Of Photosynthetic 4e-05
1nbo_O337 The Dual Coenzyme Specificity Of Photosynthetic Gly 4e-05
1rm3_O337 Crystal Structure Of Mutant T33a Of Photosynthetic 4e-05
2x5k_O339 Structure Of An Active Site Mutant Of The D-Erythro 5e-05
2xf8_A338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 2e-04
2x5j_O339 Crystal Structure Of The Apoform Of The D-Erythrose 2e-04
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure 
Iteration: 1

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/96 (63%), Positives = 62/96 (64%)
Query: 51  VSNSLLTLAKVIHDNFEIVEGLMXXXXXXXXXXXXXDGPSGKLWRDGRGAAQNIIPXXXX 110
            +N L  LAKVIHDNF IVEGLM             DGPSGKLWRDGRGA QNIIP    
Sbjct: 156 TTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTG 215
Query: 111 XXXXXXXXIPALNGKLTGMAFRVPVANVSVVDLTVR 146
                   IP LNGKLTGMAFRVP ANVSVVDLT R
Sbjct: 216 AAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCR 251
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 5e-72
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 4e-71
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 5e-71
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 7e-71
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 7e-70
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 2e-69
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 3e-69
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 7e-69
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 4e-57
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 5e-56
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 5e-54
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 4e-53
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 1e-52
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 3e-51
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 7e-51
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 1e-50
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 2e-50
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 7e-49
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 7e-45
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 4e-42
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 4e-42
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 2e-33
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 2e-31
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 5e-24
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 5e-16
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
 Score =  217 bits (556), Expect = 5e-72
 Identities = 78/94 (82%), Positives = 84/94 (89%)

Query: 53  NSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAA 112
           N L  LAKVI+DNF I+EGLMTTVHATTATQKTVDGPS K WR GRGA+QNIIP++TGAA
Sbjct: 152 NCLAPLAKVINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGASQNIIPSSTGAA 211

Query: 113 KAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR 146
           KAVGKV+P LNGKLTGMAFRVP  NVSVVDLTVR
Sbjct: 212 KAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTVR 245
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 99.97
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 99.91
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 99.87
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 99.87
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 99.84
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 99.77
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 99.73
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 99.68
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 99.63
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 99.52
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 99.35
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 99.18
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 99.16
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 99.13
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 98.86
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 98.68
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 98.51
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 97.82
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 97.8
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 97.75
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 97.37
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.49
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 95.94
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 95.19
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 95.11
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 94.92
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 94.75
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 93.93
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 93.75
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 93.53
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 93.27
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 92.58
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 92.42
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 91.07
2yv3_A 331 Aspartate-semialdehyde dehydrogenase; aspartate pa 89.91
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 89.27
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 88.51
4had_A 350 Probable oxidoreductase protein; structural genomi 88.14
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 87.73
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 87.05
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 83.98
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 82.33
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 81.95
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 81.46
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 81.36
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 80.14
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 80.12
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
Probab=100.00  E-value=2.4e-55  Score=369.51  Aligned_cols=145  Identities=57%  Similarity=0.862  Sum_probs=137.9

Q ss_pred             CcceeEeccCceeeeeeec---CCCceEEEEecCC-cchhhhhhhcccc-------------------------------
Q psy6886           1 MSKIGINGFGRIGLNNLNS---QPCLRLVSMVSDV-LDVLYSELLLPRE-------------------------------   45 (146)
Q Consensus         1 ~~kv~ingfgriGr~v~r~---~~~~~vva~Ind~-~d~~y~~~~~~~~-------------------------------   45 (146)
                      |+||||||||||||+|+|+   ++++|||| |||| +|++||+|||||+                               
T Consensus         1 ~~kv~INGfGrIGr~v~R~~~~~~~~~iva-iNd~~~d~~~~a~l~kyDS~hG~f~~~v~~~~~~l~i~Gk~I~v~~e~d   79 (332)
T 3pym_A            1 MVRVAINGFGRIGRLVMRIALSRPNVEVVA-LNDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQERD   79 (332)
T ss_dssp             CCEEEEECCSHHHHHHHHHHHHSTTCEEEE-EECTTCCHHHHHHHHHCCTTTCSCSSCEEECSSEEEETTEEEEEECCSS
T ss_pred             CeEEEEECCCcHHHHHHHHHHhCCCcEEEE-EeCCCCCHHHHHHHhcccCCCCCCCCcEEEcCCEEEECCEEEEEEeecc
Confidence            8999999999999999998   78999999 9999 9999999995532                               


Q ss_pred             ------------------------------------------------------------------CCCCccccchhHHH
Q psy6886          46 ------------------------------------------------------------------PSFVTVSNSLLTLA   59 (146)
Q Consensus        46 ------------------------------------------------------------------~s~~cttnclaPl~   59 (146)
                                                                                        .++|||||||+|++
T Consensus        80 p~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViIsaps~d~p~vV~gVN~~~~~~~~~IISnasCTTn~Lap~l  159 (332)
T 3pym_A           80 PANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLA  159 (332)
T ss_dssp             GGGSCTTTTTCSEEEECSSSSCSHHHHHHHHHTTCSEEEESSCCSSSCBCCTTTTGGGCCTTCCEEECCCHHHHHHHHHH
T ss_pred             cccCCccccCccEEEEecccccCHHHHHHHHHcCCCEEEECCCCCCCCeEeeccchhhcCccccEEecCcchhhhhHHHH
Confidence                                                                              24569999999999


Q ss_pred             HHhhhceeeeeeeeeeeeccCccccccCCCCCCCCcCcccccceeeecccCccceeeeeecCCCCCcceEEEeeecCCee
Q psy6886          60 KVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPVANVS  139 (146)
Q Consensus        60 kvi~~~fgI~~g~mTtvha~t~~Q~~~D~p~~~~~r~~r~a~~niIP~sTgaakav~kviP~L~Gk~~g~a~~VP~~~~s  139 (146)
                      |+|||+|||++|+|||+|++|++|+++|+|+++|||++|++++||||++||++|+++|++|+|+||++|++||||++++|
T Consensus       160 kvL~d~fGI~~g~mTTvha~T~~Q~~vDg~~~kd~r~~r~aa~NiIP~~tGaakav~kVlPeL~gkltg~avRVPv~~~s  239 (332)
T 3pym_A          160 KVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVS  239 (332)
T ss_dssp             HHHHHHHCEEEEEEEEEEECCTTSCSSSCCCTTCTGGGSCGGGCCEEEECSHHHHHHHHSGGGTTSEEEEEEEESCSSCE
T ss_pred             HHHHHhcCeEEEEEEEEeeccccchhccCCCcccCccccchhhcccCCCCChHHHHHHhhhhhcCCEEEEEEEcCCCCcE
Confidence            99999999999999999999999999999998999999999999999999999999999999999999999999999999


Q ss_pred             EEEeEEC
Q psy6886         140 VVDLTVR  146 (146)
Q Consensus       140 ~~dlt~~  146 (146)
                      ++||+|+
T Consensus       240 ~~dlt~~  246 (332)
T 3pym_A          240 VVDLTVK  246 (332)
T ss_dssp             EEEEEEE
T ss_pred             eeEEEEE
Confidence            9999984
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1u8fo2164 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de 1e-47
d1rm4a2163 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de 1e-45
d3cmco2163 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de 1e-44
d1k3ta2169 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de 3e-39
d2g82a2162 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de 6e-37
d1obfo2162 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de 5e-36
d1b7go2162 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de 1e-23
d1cf2o2165 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de 9e-23
d1obfo1173 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp 2e-04
d1obfo1173 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp 0.002
d1dssg1169 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp 7e-04
d1hdgo1169 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp 7e-04
d2g82a1168 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp 9e-04
d2b4ro1166 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp 0.001
d1rm4a1172 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp 0.001
d1cf2o1171 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp 0.002
d1k3ta1190 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp 0.002
d3cmco1171 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp 0.002
d1u8fo1169 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp 0.002
d1gado1166 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp 0.003
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 0.003
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Human(Homo sapiens), liver isoform [TaxId: 9606]

 Score =  149 bits (377), Expect = 1e-47
 Identities = 84/94 (89%), Positives = 85/94 (90%)

Query: 53  NSLLTLAKVIHDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAA 112
           N L  LAKVIHDNF IVEGLMTTVHA TATQKTVDGPSGKLWRDGRGA QNIIPA+TGAA
Sbjct: 4   NCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAA 63

Query: 113 KAVGKVIPALNGKLTGMAFRVPVANVSVVDLTVR 146
           KAVGKVIP LNGKLTGMAFRVP ANVSVVDLT R
Sbjct: 64  KAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCR 97
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 Back     information, alignment and structure
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1k3ta2169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d3cmco2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo2164 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1rm4a2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.89
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.88
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.87
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.87
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.86
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.86
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.86
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.86
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.85
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.85
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.84
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.82
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.78
d1cf2o2165 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.7
d1b7go2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.67
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.45
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.32
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.09
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.4
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.39
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.25
d2czca1162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.06
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.0
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.62
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.25
d2hjsa2190 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 95.3
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 94.91
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 92.41
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.25
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 90.31
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 88.61
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 85.13
d2gz1a2 202 Aspartate beta-semialdehyde dehydrogenase {Strepto 84.66
d1mb4a2 222 Aspartate beta-semialdehyde dehydrogenase {Vibrio 81.86
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Trypanosoma cruzi [TaxId: 5693]

Probab=100.00  E-value=1e-46  Score=289.74  Aligned_cols=98  Identities=60%  Similarity=0.880  Sum_probs=95.5

Q ss_pred             CccccchhHHHHHh-hhceeeeeeeeeeeeccCccccccCCCCCCCCcCcccccceeeecccCccceeeeeecCCCCCcc
Q psy6886          49 VTVSNSLLTLAKVI-HDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLT  127 (146)
Q Consensus        49 ~cttnclaPl~kvi-~~~fgI~~g~mTtvha~t~~Q~~~D~p~~~~~r~~r~a~~niIP~sTgaakav~kviP~L~Gk~~  127 (146)
                      |||||||||++|+| ||+|||++|+|||||+||++|+++|+++++|||++|+|++||||++|||++|++||+|+|+||++
T Consensus         1 SCTTNclaP~~kvL~~~~fgI~~g~mtTvHa~T~~Q~~lD~~~~~d~Rr~Raa~~nIIPtsTgAakav~~vlP~L~gKi~   80 (169)
T d1k3ta2           1 SCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLT   80 (169)
T ss_dssp             CHHHHHHHHHHHHHHHTTCCCSEEEEEEEEECCTTSBSSSCCCSSCTGGGSBGGGCCEEEECSHHHHHHHHSGGGTTTEE
T ss_pred             CcHHHHHHHHHHHhhccccceeEEEEEEeccccCCCcccccccCCCCcCccccccccccccchHHHHHHHhccccCCCcc
Confidence            69999999999995 99999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEeeecCCeeEEEeEEC
Q psy6886         128 GMAFRVPVANVSVVDLTVR  146 (146)
Q Consensus       128 g~a~~VP~~~~s~~dlt~~  146 (146)
                      |++||||++|||++||++.
T Consensus        81 g~a~RVPt~nvS~vDLt~~   99 (169)
T d1k3ta2          81 GMSFRVPTPDVSVVDLTFT   99 (169)
T ss_dssp             EEEEEESCSSCEEEEEEEE
T ss_pred             ceeecccccccceeeeeee
Confidence            9999999999999999973
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure