Psyllid ID: psy6893
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 988 | ||||||
| 340719996 | 1011 | PREDICTED: 26S proteasome non-ATPase reg | 0.468 | 0.457 | 0.577 | 1e-166 | |
| 350408109 | 1014 | PREDICTED: 26S proteasome non-ATPase reg | 0.466 | 0.454 | 0.579 | 1e-166 | |
| 350408115 | 938 | PREDICTED: 26S proteasome non-ATPase reg | 0.466 | 0.491 | 0.579 | 1e-166 | |
| 307200649 | 648 | 26S proteasome non-ATPase regulatory sub | 0.453 | 0.691 | 0.592 | 1e-165 | |
| 383862447 | 643 | PREDICTED: 26S proteasome non-ATPase reg | 0.452 | 0.695 | 0.581 | 1e-164 | |
| 383862449 | 570 | PREDICTED: 26S proteasome non-ATPase reg | 0.452 | 0.784 | 0.581 | 1e-164 | |
| 380029242 | 1000 | PREDICTED: 26S proteasome non-ATPase reg | 0.464 | 0.459 | 0.579 | 1e-164 | |
| 380029240 | 932 | PREDICTED: 26S proteasome non-ATPase reg | 0.464 | 0.492 | 0.579 | 1e-164 | |
| 380029238 | 1015 | PREDICTED: 26S proteasome non-ATPase reg | 0.464 | 0.452 | 0.579 | 1e-164 | |
| 156538116 | 1008 | PREDICTED: 26S proteasome non-ATPase reg | 0.470 | 0.461 | 0.564 | 1e-163 |
| >gi|340719996|ref|XP_003398430.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Score = 593 bits (1530), Expect = e-166, Method: Compositional matrix adjust.
Identities = 323/559 (57%), Positives = 369/559 (66%), Gaps = 96/559 (17%)
Query: 1 MDVFEAAIKQMTPPRSFTTRSRWPCPPFSRVHSALKSCVPWCLAMSSIQSRSFRAQILRT 60
MD+FE AI Q + + + + MS IQ+R FR +LR
Sbjct: 162 MDIFETAIMQSDDVSGMLSYA-------------------FQVVMSLIQNRGFRNTVLRC 202
Query: 61 LVRLYHSLSVPDYVNMAQCWIYLDDPRSVANLLGKLVAGSADDDLMAAQIGFDLYESATQ 120
LV LY +L PDYVNM QC I+LDDP +VA LL +L GS D LMA QI FDLYESATQ
Sbjct: 203 LVSLYRNLGTPDYVNMCQCLIFLDDPLAVAELLDRLSKGSQDCVLMAYQIAFDLYESATQ 262
Query: 121 AFLASVLQELKTCAPIPDATHVVVKVPVEGAPTPATPDTEAPTPAPGTESGPSSTTPGPE 180
FL VLQ L+ APIP A ++VK V+ A T + P A E+ SS+TP PE
Sbjct: 263 QFLGRVLQALRATAPIPGA--LMVKPIVKPAVKATTEVSTEPAAATTAETENSSSTPAPE 320
Query: 181 TKT---LESLNEKEKQLQARITKLSKILSGEVSIDLHLQFLIRSNKTDMLILKNTKESIR 237
K+ +ESLN +E++ Q R+ LS IL GE+SIDLHLQFLIRSN TDMLILKNTK++IR
Sbjct: 321 EKSQRSVESLNAEEREQQERVDALSSILGGEISIDLHLQFLIRSNHTDMLILKNTKDTIR 380
Query: 238 VSICHTATIIANAFMHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGHETEALA 297
VSICHTAT+IANA+MHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGHE EALA
Sbjct: 381 VSICHTATVIANAYMHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGHEQEALA 440
Query: 298 HMQSYLPRETGPTSGYYEGGGLYALGLIHANHGAVINDYLLGQVKDATNE---------- 347
MQSYLPR+TG +GY EGGGLYALGLIHANHGA I DYLLGQ+KDA NE
Sbjct: 441 LMQSYLPRDTGAGAGYSEGGGLYALGLIHANHGAAITDYLLGQLKDAQNEMVRHGGCLGL 500
Query: 348 ----------------------DDAVTGEAAGIAMGLVLLGSKSESAIQDMVAYAKETQH 385
DDAVTGEAAGIAMG+V+LGSKS AI+DMVAYA+ETQH
Sbjct: 501 GLAAMGSHRQDVYEQLKFNLYQDDAVTGEAAGIAMGMVMLGSKSTQAIEDMVAYAQETQH 560
Query: 386 EKILRGLAVGISFIMYGQLENADDLVRDLCEEKDAILRRSGMYTIAMAYCVSYLYFDLFS 445
EKILRGLAVGI+F MYG+LE AD LV LC +KD ILRRSGM
Sbjct: 561 EKILRGLAVGIAFTMYGRLEEADPLVASLCADKDPILRRSGM------------------ 602
Query: 446 DLTYRIVKNRSGMYTIAMAYCGSGSNVATKRLLHVAVSDVNDDVRREAVTALGFILFRTL 505
YT+AMAYCG+G+N A ++LLHVAVSDVNDDVRR AVT LGF+LFRT
Sbjct: 603 -------------YTLAMAYCGTGNNQAIRKLLHVAVSDVNDDVRRAAVTGLGFLLFRT- 648
Query: 506 FYVAPACTRSPWPGVISLL 524
C P V+SLL
Sbjct: 649 ---PEQC-----PSVVSLL 659
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350408109|ref|XP_003488307.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|350408115|ref|XP_003488308.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307200649|gb|EFN80757.1| 26S proteasome non-ATPase regulatory subunit 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383862447|ref|XP_003706695.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|383862449|ref|XP_003706696.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380029242|ref|XP_003698288.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like isoform 3 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|380029240|ref|XP_003698287.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|380029238|ref|XP_003698286.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|156538116|ref|XP_001608229.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like isoform 1 [Nasonia vitripennis] gi|345491856|ref|XP_003426721.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like [Nasonia vitripennis] gi|345491858|ref|XP_003426722.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 988 | ||||||
| FB|FBgn0028692 | 1020 | Rpn2 "Regulatory particle non- | 0.455 | 0.441 | 0.523 | 1.6e-104 | |
| UNIPROTKB|E1C5P3 | 958 | PSMD1 "26S proteasome non-ATPa | 0.297 | 0.306 | 0.639 | 5.6e-109 | |
| UNIPROTKB|F1NUT6 | 955 | PSMD1 "26S proteasome non-ATPa | 0.290 | 0.300 | 0.651 | 9.1e-109 | |
| UNIPROTKB|Q5F418 | 955 | PSMD1 "26S proteasome non-ATPa | 0.290 | 0.300 | 0.651 | 9.1e-109 | |
| MGI|MGI:1917497 | 953 | Psmd1 "proteasome (prosome, ma | 0.316 | 0.328 | 0.612 | 9.1e-109 | |
| ZFIN|ZDB-GENE-040426-810 | 959 | psmd1 "proteasome (prosome, ma | 0.332 | 0.343 | 0.581 | 9.1e-109 | |
| UNIPROTKB|Q99460 | 953 | PSMD1 "26S proteasome non-ATPa | 0.299 | 0.310 | 0.637 | 1.9e-108 | |
| UNIPROTKB|Q5R5S4 | 953 | PSMD1 "26S proteasome non-ATPa | 0.299 | 0.310 | 0.637 | 1.9e-108 | |
| UNIPROTKB|F1PX57 | 953 | PSMD1 "Uncharacterized protein | 0.299 | 0.310 | 0.637 | 2.4e-108 | |
| UNIPROTKB|J9P4R4 | 701 | PSMD1 "Uncharacterized protein | 0.299 | 0.422 | 0.637 | 2.4e-108 |
| FB|FBgn0028692 Rpn2 "Regulatory particle non-ATPase 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1035 (369.4 bits), Expect = 1.6e-104, P = 1.6e-104
Identities = 248/474 (52%), Positives = 299/474 (63%)
Query: 43 LAMSSIQSRSFRAQILRTLVRLYHSLSVPDYVNMAQCWIYLDDPRSVANLLGKLVAGSAD 102
+ MS IQ+R FR ++LR LV LY L VPDYVNM QC I+L+DP +VA +L L S +
Sbjct: 183 VTMSLIQNRGFRNEVLRCLVSLYRDLGVPDYVNMCQCLIFLEDPFAVAEMLDNLTRSSVE 242
Query: 103 -DDLMAAQIGFDLYESATQAFLASVLQELKTCAPIPDATHVVVKVPVXXXXXXXXXXXXX 161
++LMA QI FDLYESATQ FL +VLQ LK APIP A K P
Sbjct: 243 TNNLMAYQIAFDLYESATQEFLGNVLQHLKNTAPIPTALPSTFK-PQGTTSEDGAKSEGD 301
Query: 162 XXXXXXXXSGPSSTTPGPETKTLESLNEKEKQLQARITKLSKILSGEVSIDLHLQFLIRS 221
+ + E +T++SLNE EK Q I KL ILSGEVSIDL LQFLIRS
Sbjct: 302 KSKSDEDITEETPADDKVE-RTIDSLNEVEKLHQKNIEKLISILSGEVSIDLQLQFLIRS 360
Query: 222 NKTDMLILKNTKESIRVSICHTATIIANAFMHSGTTSDQFLRDNLEWLARATNWAKLTAT 281
N D+ +L+ TKE++RVSICHTAT+IANAFMHSGTTSDQFLRDNL+WLARATNWAKLTAT
Sbjct: 361 NHADLQVLRGTKEAVRVSICHTATVIANAFMHSGTTSDQFLRDNLDWLARATNWAKLTAT 420
Query: 282 ASLGVIHRGHETEALAHMQSYLPRETGPTSXXXXXXXXXXXXXIHANHGAVINDYLLGQV 341
ASLGVIHRGHE ++LA MQSYLP+E GP+S IHANHGA I DYLL Q+
Sbjct: 421 ASLGVIHRGHEKDSLALMQSYLPKEAGPSSGYSEGGALYALGLIHANHGANIIDYLLQQL 480
Query: 342 KDATNEDDAVTGEAAGIAMGLVLLGSKSESAIQDMVAYAK-ETQHEKILRGLAVGISF-- 398
KDA NE+ G +GL L G + QD+ K + + G A GI+
Sbjct: 481 KDAQNENVRHGG-----CLGLGLAGMGTHR--QDLYEQLKFNLYQDDAVTGEAAGIAMGM 533
Query: 399 IMYGQLENA---DDLVRDLCE-EKDAILRRSGM-YTIAMAYCVSY---LYFDLFSDLTYR 450
+M G +NA +D+V E + + ILR + ++ M + L L SD
Sbjct: 534 VMLGS-KNAQAIEDMVSYAQETQHEKILRGLAVGISLTMFSRLEEADPLVTSLSSDKDP- 591
Query: 451 IVKNRSGMYTIAMAYCGSGSNVATKRLLHVAVSDVNDDVRREAVTALGFILFRT 504
V RSGMYTIAMAY G+GSN A ++LLHVAVSDVNDDVRR AVTA+GFILFR+
Sbjct: 592 -VLRRSGMYTIAMAYNGTGSNKAIRKLLHVAVSDVNDDVRRAAVTAIGFILFRS 644
|
|
| UNIPROTKB|E1C5P3 PSMD1 "26S proteasome non-ATPase regulatory subunit 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NUT6 PSMD1 "26S proteasome non-ATPase regulatory subunit 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5F418 PSMD1 "26S proteasome non-ATPase regulatory subunit 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917497 Psmd1 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-810 psmd1 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q99460 PSMD1 "26S proteasome non-ATPase regulatory subunit 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R5S4 PSMD1 "26S proteasome non-ATPase regulatory subunit 1" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PX57 PSMD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P4R4 PSMD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 988 | |||
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 1e-98 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 9e-92 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-14 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-13 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-13 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-11 | |
| COG5110 | 881 | COG5110, RPN1, 26S proteasome regulatory complex c | 4e-11 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-10 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 9e-10 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-09 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-09 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 3e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-09 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 6e-09 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-08 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-08 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-08 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-08 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-08 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-08 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 5e-08 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 5e-08 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 5e-08 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-08 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 6e-08 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 6e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-08 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 7e-08 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 7e-08 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 9e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 9e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-07 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-07 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 3e-07 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 3e-07 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 3e-07 | |
| pfam07780 | 212 | pfam07780, Spb1_C, Spb1 C-terminal domain | 3e-07 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 4e-07 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 5e-07 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 5e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-07 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 6e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 8e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 8e-07 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 8e-07 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 8e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-07 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 9e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-06 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-06 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 1e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-06 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 1e-06 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 1e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-06 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 2e-06 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 2e-06 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-06 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 2e-06 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 2e-06 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 2e-06 | |
| pfam08524 | 150 | pfam08524, rRNA_processing, rRNA processing | 2e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-06 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 3e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-06 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-06 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 3e-06 | |
| pfam03839 | 217 | pfam03839, Sec62, Translocation protein Sec62 | 3e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-06 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 4e-06 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 4e-06 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 4e-06 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 4e-06 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 5e-06 | |
| pfam03763 | 112 | pfam03763, Remorin_C, Remorin, C-terminal region | 5e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-06 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-06 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 7e-06 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 7e-06 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 7e-06 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 8e-06 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 8e-06 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 9e-06 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 9e-06 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 1e-05 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 1e-05 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 1e-05 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 1e-05 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 1e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-05 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 2e-05 | |
| pfam08555 | 90 | pfam08555, DUF1754, Eukaryotic family of unknown f | 2e-05 | |
| pfam10169 | 124 | pfam10169, Laps, Learning-associated protein | 2e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 2e-05 | |
| pfam10595 | 349 | pfam10595, UPF0564, Uncharacterized protein family | 2e-05 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 2e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-05 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 3e-05 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 3e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-05 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 3e-05 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 3e-05 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 3e-05 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 3e-05 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 3e-05 | |
| pfam09135 | 112 | pfam09135, Alb1, Alb1 | 3e-05 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 4e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 4e-05 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 4e-05 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 4e-05 | |
| cd12951 | 129 | cd12951, RRP7_Rrp7A, RRP7 domain ribosomal RNA-pro | 4e-05 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 4e-05 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 5e-05 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 5e-05 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 5e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 6e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-05 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 6e-05 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 6e-05 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 7e-05 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 7e-05 | |
| pfam08555 | 90 | pfam08555, DUF1754, Eukaryotic family of unknown f | 7e-05 | |
| PRK14900 | 1052 | PRK14900, valS, valyl-tRNA synthetase; Provisional | 7e-05 | |
| pfam05890 | 270 | pfam05890, Ebp2, Eukaryotic rRNA processing protei | 7e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-05 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 8e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 8e-05 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 8e-05 | |
| pfam08555 | 90 | pfam08555, DUF1754, Eukaryotic family of unknown f | 9e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 9e-05 | |
| pfam03998 | 239 | pfam03998, Utp11, Utp11 protein | 9e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 1e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 1e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 1e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 1e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 1e-04 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 1e-04 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 1e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 1e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-04 | |
| pfam05890 | 270 | pfam05890, Ebp2, Eukaryotic rRNA processing protei | 1e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 1e-04 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 1e-04 | |
| pfam01577 | 245 | pfam01577, Peptidase_S30, Potyvirus P1 protease | 1e-04 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 1e-04 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 1e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 1e-04 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 1e-04 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 2e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 2e-04 | |
| pfam07780 | 212 | pfam07780, Spb1_C, Spb1 C-terminal domain | 2e-04 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 2e-04 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam08555 | 90 | pfam08555, DUF1754, Eukaryotic family of unknown f | 2e-04 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 2e-04 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 2e-04 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 2e-04 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 2e-04 | |
| pfam11208 | 132 | pfam11208, DUF2992, Protein of unknown function (D | 2e-04 | |
| pfam13863 | 126 | pfam13863, DUF4200, Domain of unknown function (DU | 2e-04 | |
| pfam10147 | 217 | pfam10147, CR6_interact, Growth arrest and DNA-dam | 2e-04 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 2e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 3e-04 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 3e-04 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 3e-04 | |
| pfam08555 | 90 | pfam08555, DUF1754, Eukaryotic family of unknown f | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 3e-04 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 3e-04 | |
| pfam11208 | 132 | pfam11208, DUF2992, Protein of unknown function (D | 3e-04 | |
| pfam08079 | 71 | pfam08079, Ribosomal_L30_N, Ribosomal L30 N-termin | 3e-04 | |
| pfam14303 | 147 | pfam14303, NAM-associated, No apical meristem-asso | 3e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 4e-04 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 4e-04 | |
| PRK14900 | 1052 | PRK14900, valS, valyl-tRNA synthetase; Provisional | 4e-04 | |
| pfam14303 | 147 | pfam14303, NAM-associated, No apical meristem-asso | 4e-04 | |
| pfam01851 | 35 | pfam01851, PC_rep, Proteasome/cyclosome repeat | 4e-04 | |
| pfam01851 | 35 | pfam01851, PC_rep, Proteasome/cyclosome repeat | 4e-04 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 4e-04 | |
| PRK05244 | 177 | PRK05244, PRK05244, Der GTPase activator; Provisio | 4e-04 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 4e-04 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 4e-04 | |
| pfam04939 | 164 | pfam04939, RRS1, Ribosome biogenesis regulatory pr | 4e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 4e-04 | |
| PRK13042 | 291 | PRK13042, PRK13042, superantigen-like protein; Rev | 4e-04 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 5e-04 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 5e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 5e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 5e-04 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 5e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-04 | |
| pfam10595 | 349 | pfam10595, UPF0564, Uncharacterized protein family | 5e-04 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 5e-04 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 5e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 5e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 5e-04 | |
| pfam02349 | 81 | pfam02349, MSG, Major surface glycoprotein | 5e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 6e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 6e-04 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 6e-04 | |
| cd12932 | 118 | cd12932, RRP7_like, RRP7 domain ribosomal RNA-proc | 6e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 6e-04 | |
| pfam08524 | 150 | pfam08524, rRNA_processing, rRNA processing | 7e-04 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 7e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-04 | |
| pfam05890 | 270 | pfam05890, Ebp2, Eukaryotic rRNA processing protei | 7e-04 | |
| pfam03998 | 239 | pfam03998, Utp11, Utp11 protein | 7e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 7e-04 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 7e-04 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 7e-04 | |
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 7e-04 | |
| COG5163 | 591 | COG5163, NOP7, Protein required for biogenesis of | 7e-04 | |
| pfam01577 | 245 | pfam01577, Peptidase_S30, Potyvirus P1 protease | 8e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 8e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 8e-04 | |
| pfam08701 | 80 | pfam08701, GN3L_Grn1, GNL3L/Grn1 putative GTPase | 8e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 8e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 9e-04 | |
| pfam08524 | 150 | pfam08524, rRNA_processing, rRNA processing | 9e-04 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.001 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam08555 | 90 | pfam08555, DUF1754, Eukaryotic family of unknown f | 0.001 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.001 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.001 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 0.001 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.001 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.001 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 0.001 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 0.001 | |
| COG2825 | 170 | COG2825, HlpA, Outer membrane protein [Cell envelo | 0.001 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 0.001 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 0.001 | |
| pfam04747 | 517 | pfam04747, DUF612, Protein of unknown function, DU | 0.001 | |
| pfam04086 | 272 | pfam04086, SRP-alpha_N, Signal recognition particl | 0.001 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 0.001 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.002 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 0.002 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.002 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 0.002 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 0.002 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 0.002 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 0.002 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.002 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.002 | |
| pfam01851 | 35 | pfam01851, PC_rep, Proteasome/cyclosome repeat | 0.002 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.002 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 0.002 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 0.002 | |
| pfam04747 | 517 | pfam04747, DUF612, Protein of unknown function, DU | 0.002 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 0.002 | |
| pfam10659 | 98 | pfam10659, Trypan_glycop_C, Trypanosome variant su | 0.002 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.002 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 0.002 | |
| COG4487 | 438 | COG4487, COG4487, Uncharacterized protein conserve | 0.002 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 0.002 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 0.002 | |
| PRK07219 | 822 | PRK07219, PRK07219, DNA topoisomerase I; Validated | 0.002 | |
| pfam02414 | 285 | pfam02414, Borrelia_orfA, Borrelia ORF-A | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.003 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.003 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.003 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.003 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.003 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.003 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.003 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.003 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 0.003 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.003 | |
| pfam04086 | 272 | pfam04086, SRP-alpha_N, Signal recognition particl | 0.003 | |
| pfam10659 | 98 | pfam10659, Trypan_glycop_C, Trypanosome variant su | 0.003 | |
| pfam10659 | 98 | pfam10659, Trypan_glycop_C, Trypanosome variant su | 0.003 | |
| PRK07219 | 822 | PRK07219, PRK07219, DNA topoisomerase I; Validated | 0.003 | |
| COG3078 | 169 | COG3078, COG3078, Uncharacterized protein conserve | 0.003 | |
| pfam12923 | 131 | pfam12923, RRP7, Ribosomal RNA-processing protein | 0.003 | |
| pfam09736 | 141 | pfam09736, Bud13, Pre-mRNA-splicing factor of RES | 0.003 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.003 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 0.003 | |
| pfam07432 | 123 | pfam07432, Hc1, Histone H1-like protein Hc1 | 0.003 | |
| pfam05424 | 276 | pfam05424, Duffy_binding, Duffy binding domain | 0.003 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.004 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 0.004 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 0.004 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 0.004 | |
| pfam09736 | 141 | pfam09736, Bud13, Pre-mRNA-splicing factor of RES | 0.004 | |
| cd08045 | 212 | cd08045, TAF4, TATA Binding Protein (TBP) Associat | 0.004 | |
| PRK06319 | 860 | PRK06319, PRK06319, DNA topoisomerase I/SWI domain | 0.004 | |
| COG5252 | 299 | COG5252, COG5252, Uncharacterized conserved protei | 0.004 |
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 331 bits (849), Expect = 1e-98
Identities = 154/365 (42%), Positives = 207/365 (56%), Gaps = 40/365 (10%)
Query: 541 DIVDDFWPENEK----EKQLQARITKLSKILSGEVSIDLHLQFLIRSNKTDMLILKNTKE 596
D+ D E + E Q + ILSGE + FL+ N TD L ++K
Sbjct: 249 DLEDSASQEILEILVTELVAQGYDQAVMSILSGEFTKKYLGAFLLEKNNTDFKFLNSSKS 308
Query: 597 SI--RVSICHTATIIANAFMHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGHE 654
S+ + S H A +AN+FM+ GT++D F R+NL+WL +A+NWAK TATASLGVIH G+
Sbjct: 309 SLARKFSRFHYAVSLANSFMNLGTSNDSFYRNNLDWLGKASNWAKFTATASLGVIHLGNS 368
Query: 655 TEALAHMQSYLPRETGPTSGYYEGGGLYALGLIHANHGAVINDYLLGQVKDATNEM---V 711
++ YLP E +S EGG LYALGLI A G +YLL D +E+ +
Sbjct: 369 NPGYEILKPYLPSEVA-SSRQKEGGALYALGLIKAGFGREDTEYLLEYFLDTEDELTPEL 427
Query: 712 RHGGCLGLGLAAMGSARDDIYEQLKFNLYQDDAVTGEAAGIAMGLVLLGSKSESAIQDMV 771
+G CLG+GL MGSA +IYE+LK L D A+ GEAA MGL++LG+ S AI+DM
Sbjct: 428 AYGVCLGIGLINMGSANREIYEKLKELLKNDRALLGEAAVYGMGLLMLGTWSVEAIEDMR 487
Query: 772 AYAKETQHEKILRGLAVGISFIMYGQLENADDLVRDLCEEKDAILRRSGMYTIAMAYCGS 831
YA ETQHE+I RGL +G + I+YG+ E ADD + +L +K
Sbjct: 488 TYAGETQHERIKRGLGIGFALILYGRQEMADDYINELLYDK------------------- 528
Query: 832 GSNVATKRLLHDAILRRSGMYTIAMAYCGSGSNVATKRLLHVAVSDVNDDVRREAVTALG 891
D+ILR +G++++A+AY G+G+ LLH AVSD NDDVRR AV ALG
Sbjct: 529 -----------DSILRYNGVFSLALAYVGTGNLGVVSTLLHYAVSDGNDDVRRAAVIALG 577
Query: 892 FILFR 896
F+
Sbjct: 578 FVCCD 582
|
Length = 926 |
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227441 COG5110, RPN1, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|219572 pfam07780, Spb1_C, Spb1 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219882 pfam08524, rRNA_processing, rRNA processing | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|190741 pfam03763, Remorin_C, Remorin, C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) | Back alignment and domain information |
|---|
| >gnl|CDD|220611 pfam10169, Laps, Learning-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|220818 pfam10595, UPF0564, Uncharacterized protein family UPF0564 | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|220121 pfam09135, Alb1, Alb1 | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|240578 cd12951, RRP7_Rrp7A, RRP7 domain ribosomal RNA-processing protein 7 homolog A (Rrp7A) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) | Back alignment and domain information |
|---|
| >gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218797 pfam05890, Ebp2, Eukaryotic rRNA processing protein EBP2 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|217834 pfam03998, Utp11, Utp11 protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218797 pfam05890, Ebp2, Eukaryotic rRNA processing protein EBP2 | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|216581 pfam01577, Peptidase_S30, Potyvirus P1 protease | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|219572 pfam07780, Spb1_C, Spb1 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) | Back alignment and domain information |
|---|
| >gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >gnl|CDD|220600 pfam10147, CR6_interact, Growth arrest and DNA-damage-inducible proteins-interacting protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) | Back alignment and domain information |
|---|
| >gnl|CDD|203848 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|216739 pfam01851, PC_rep, Proteasome/cyclosome repeat | Back alignment and domain information |
|---|
| >gnl|CDD|216739 pfam01851, PC_rep, Proteasome/cyclosome repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235370 PRK05244, PRK05244, Der GTPase activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|218337 pfam04939, RRS1, Ribosome biogenesis regulatory protein (RRS1) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|183854 PRK13042, PRK13042, superantigen-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|220818 pfam10595, UPF0564, Uncharacterized protein family UPF0564 | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|216985 pfam02349, MSG, Major surface glycoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240576 cd12932, RRP7_like, RRP7 domain ribosomal RNA-processing protein 7 (Rrp7p), ribosomal RNA-processing protein 7 homolog A (Rrp7A), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219882 pfam08524, rRNA_processing, rRNA processing | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218797 pfam05890, Ebp2, Eukaryotic rRNA processing protein EBP2 | Back alignment and domain information |
|---|
| >gnl|CDD|217834 pfam03998, Utp11, Utp11 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216581 pfam01577, Peptidase_S30, Potyvirus P1 protease | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|219978 pfam08701, GN3L_Grn1, GNL3L/Grn1 putative GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219882 pfam08524, rRNA_processing, rRNA processing | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225381 COG2825, HlpA, Outer membrane protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|113514 pfam04747, DUF612, Protein of unknown function, DUF612 | Back alignment and domain information |
|---|
| >gnl|CDD|217884 pfam04086, SRP-alpha_N, Signal recognition particle, alpha subunit, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216739 pfam01851, PC_rep, Proteasome/cyclosome repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|113514 pfam04747, DUF612, Protein of unknown function, DUF612 | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220838 pfam10659, Trypan_glycop_C, Trypanosome variant surface glycoprotein C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235971 PRK07219, PRK07219, DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217023 pfam02414, Borrelia_orfA, Borrelia ORF-A | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217884 pfam04086, SRP-alpha_N, Signal recognition particle, alpha subunit, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|220838 pfam10659, Trypan_glycop_C, Trypanosome variant surface glycoprotein C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|220838 pfam10659, Trypan_glycop_C, Trypanosome variant surface glycoprotein C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235971 PRK07219, PRK07219, DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225620 COG3078, COG3078, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221857 pfam12923, RRP7, Ribosomal RNA-processing protein 7 (RRP7) | Back alignment and domain information |
|---|
| >gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|148820 pfam07432, Hc1, Histone H1-like protein Hc1 | Back alignment and domain information |
|---|
| >gnl|CDD|218585 pfam05424, Duffy_binding, Duffy binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex | Back alignment and domain information |
|---|
| >gnl|CDD|173965 cd08045, TAF4, TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227577 COG5252, COG5252, Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 988 | |||
| KOG2062|consensus | 929 | 100.0 | ||
| KOG2062|consensus | 929 | 100.0 | ||
| COG5116 | 926 | RPN2 26S proteasome regulatory complex component [ | 100.0 | |
| KOG2005|consensus | 878 | 100.0 | ||
| COG5116 | 926 | RPN2 26S proteasome regulatory complex component [ | 100.0 | |
| COG5110 | 881 | RPN1 26S proteasome regulatory complex component [ | 100.0 | |
| KOG2005|consensus | 878 | 100.0 | ||
| COG5110 | 881 | RPN1 26S proteasome regulatory complex component [ | 100.0 | |
| PRK09687 | 280 | putative lyase; Provisional | 98.73 | |
| PRK09687 | 280 | putative lyase; Provisional | 98.63 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.33 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 98.19 | |
| KOG1858|consensus | 1496 | 98.15 | ||
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 98.06 | |
| PF01851 | 35 | PC_rep: Proteasome/cyclosome repeat; InterPro: IPR | 98.04 | |
| PF01851 | 35 | PC_rep: Proteasome/cyclosome repeat; InterPro: IPR | 97.68 | |
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 97.44 | |
| KOG2002|consensus | 1018 | 97.38 | ||
| KOG1858|consensus | 1496 | 97.37 | ||
| KOG4364|consensus | 811 | 97.24 | ||
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 96.56 | |
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 96.5 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 96.35 | |
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 95.93 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 95.82 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 95.75 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 95.58 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 95.3 | |
| KOG2572|consensus | 498 | 94.12 | ||
| KOG1824|consensus | 1233 | 93.47 | ||
| PTZ00121 | 2084 | MAEBL; Provisional | 93.15 | |
| KOG0166|consensus | 514 | 92.35 | ||
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 92.27 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 92.09 | |
| smart00638 | 574 | LPD_N Lipoprotein N-terminal Domain. | 91.98 | |
| KOG2573|consensus | 498 | 91.58 | ||
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 90.66 | |
| KOG2573|consensus | 498 | 90.41 | ||
| KOG2171|consensus | 1075 | 90.39 | ||
| KOG0166|consensus | 514 | 90.19 | ||
| KOG1144|consensus | 1064 | 90.07 | ||
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 89.98 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 89.31 | |
| PF05004 | 309 | IFRD: Interferon-related developmental regulator ( | 88.47 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 88.29 | |
| KOG1824|consensus | 1233 | 88.2 | ||
| KOG1943|consensus | 1133 | 87.4 | ||
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 87.32 | |
| PF07946 | 321 | DUF1682: Protein of unknown function (DUF1682); In | 87.01 | |
| KOG0567|consensus | 289 | 86.9 | ||
| KOG0163|consensus | 1259 | 86.74 | ||
| KOG2171|consensus | 1075 | 86.15 | ||
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 85.33 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 84.84 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 84.76 | |
| PF08208 | 198 | RNA_polI_A34: DNA-directed RNA polymerase I subuni | 84.38 | |
| PF01347 | 618 | Vitellogenin_N: Lipoprotein amino terminal region; | 84.02 | |
| KOG3809|consensus | 583 | 83.72 | ||
| KOG1029|consensus | 1118 | 82.97 | ||
| COG5181 | 975 | HSH155 U2 snRNP spliceosome subunit [RNA processin | 82.41 | |
| PF07946 | 321 | DUF1682: Protein of unknown function (DUF1682); In | 82.22 | |
| KOG0112|consensus | 975 | 81.1 |
| >KOG2062|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.7e-111 Score=958.90 Aligned_cols=516 Identities=50% Similarity=0.792 Sum_probs=451.5
Q ss_pred HHHHHHHhcCCCC---Cc---cccCCC---CCCCCCChhhhhhhhhhhhhhcccccChHHHHHHHHHHHHHHhcCCcccH
Q psy6893 3 VFEAAIKQMTPPR---SF---TTRSRW---PCPPFSRVHSALKSCVPWCLAMSSIQSRSFRAQILRTLVRLYHSLSVPDY 73 (988)
Q Consensus 3 ~~~~~~~~~~~~~---~~---~~~~~~---~~~~~~~~~~~L~y~~~~~~~~~~v~~~~fR~~vL~lL~~ly~~~~~pDy 73 (988)
||.+|+. -++.+ |. |+|+|- --+++.++..++.|+++ ++|++|+|++||++||+++++.|+.+++|||
T Consensus 137 mi~kcl~-d~e~~~aiGia~E~~rld~ie~Ail~~d~~~~~~~yll~--l~~s~v~~~efR~~vlr~lv~~y~~~~~PDy 213 (929)
T KOG2062|consen 137 MIQKCLD-DNEYKQAIGIAFETRRLDIIEEAILKSDSVIGNLTYLLE--LLISLVNNREFRNKVLRLLVKTYLKLPSPDY 213 (929)
T ss_pred HHHHhhh-hhHHHHHHhHHhhhhhHHHHHHHhccccccchHHHHHHH--HHHHHHhhHHHHHHHHHHHHHHHccCCCCCe
Confidence 6677776 55555 33 788877 35677788888999999 5599999999999999999999999999999
Q ss_pred HHHHHHHHHcCChHHHHHHHHHhhcCCCCchhHHHHHHHhhcccccHHHHHHHHHhhcccCCCCCCCccccccCCCCCCC
Q psy6893 74 VNMAQCWIYLDDPRSVANLLGKLVAGSADDDLMAAQIGFDLYESATQAFLASVLQELKTCAPIPDATHVVVKVPVEGAPT 153 (988)
Q Consensus 74 ~~~~qc~~~Lnd~~~va~il~~L~~~~~~~~l~ayQiaFdL~~~~~Q~fl~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~ 153 (988)
+++|||+++||||+.|+++|.+|++ +++.++||||||||+|+++|+||..|++.|+.+ .
T Consensus 214 ~~vc~c~v~Ldd~~~va~ll~kL~~--e~~~llayQIAFDL~esasQefL~~v~~~l~~d-~------------------ 272 (929)
T KOG2062|consen 214 FSVCQCYVFLDDAEAVADLLEKLVK--EDDLLLAYQIAFDLYESASQEFLDSVLDRLPAD-D------------------ 272 (929)
T ss_pred eeeeeeeEEcCCHHHHHHHHHHHHh--cchhhhHHHHHHHHhhccCHHHHHHHHHHcccc-c------------------
Confidence 9999999999999999999999998 466899999999999999999999999999742 0
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCcccchhhHHHHHHHHHHHHhhhcccCccchhhHHHHhhhcccchHHhHHhhh
Q psy6893 154 PATPDTEAPTPAPGTESGPSSTTPGPETKTLESLNEKEKQLQARITKLSKILSGEVSIDLHLQFLIRSNKTDMLILKNTK 233 (988)
Q Consensus 154 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~IL~g~~~~~l~~~fL~~~n~~d~~iL~~~k 233 (988)
. +++ ..+.++++||+|++++++|++||++||+||+.||+++|
T Consensus 273 -----~--------~de-------------------------~p~~kii~ILSGe~tik~~l~FL~~~N~tD~~iL~~iK 314 (929)
T KOG2062|consen 273 -----A--------RDE-------------------------KPMEKIISILSGEETIKLYLQFLLRHNNTDLLILEEIK 314 (929)
T ss_pred -----c--------ccc-------------------------ChHHHHHHHhcCchHHHHHHHHHHHcCCchHHHHHHHH
Confidence 0 000 01578999999999999999999999999999999999
Q ss_pred hhhhhhhhhhHHHHHHHhhhccCCcccccccchhHHHhhccchhhHHhhhccceecCChHHHHHHHhcccCCCCCCCCCc
Q psy6893 234 ESIRVSICHTATIIANAFMHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGHETEALAHMQSYLPRETGPTSGY 313 (988)
Q Consensus 234 ~s~r~s~~~~A~~~~Naf~naG~~~D~fl~~n~~Wl~k~~~~~~~sAtASLG~Ih~~~~~~gl~~l~~yL~s~~~~~~~y 313 (988)
+++|+|+||+|++|+|||||+|||+|+|+|+|++|+.|++||+||||||||||||+||..+|+++|.+|||+++++++.|
T Consensus 315 ~s~r~sv~H~A~~iAN~fMh~GTT~D~FlR~NL~WlskAtNWaKFtAtAsLGvIH~G~~~~~~~ll~pYLP~~~~~~s~y 394 (929)
T KOG2062|consen 315 ESVRNSVCHTATLIANAFMHAGTTSDTFLRNNLDWLSKATNWAKFTATASLGVIHRGHENQAMKLLAPYLPKEAGEGSGY 394 (929)
T ss_pred HHHHHhhhhHHHHHHHHHHhcCCcchHHHHhchhHHhhcchHhhhhhhhhcceeeccccchHHHHhhhhCCccCCCCCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999988889999
Q ss_pred cchhHHHHHhhhccCCCCchhHHHHHHhhhhc--------------------------------CCCchhHHHHHHHHHH
Q psy6893 314 YEGGGLYALGLIHANHGAVINDYLLGQVKDAT--------------------------------NEDDAVTGEAAGIAMG 361 (988)
Q Consensus 314 ~~~GaL~alGli~~g~~~~~~d~l~~lL~~~~--------------------------------~~d~~~~~~aA~lglG 361 (988)
++||||||+||||+||+....+||+..|++.. ..|+++.|+||++|||
T Consensus 395 ~EGGalyAlGLIhA~hG~~~~~yL~~~Lk~~~~e~v~hG~cLGlGLa~mGSa~~eiYe~lKevLy~D~AvsGEAAgi~MG 474 (929)
T KOG2062|consen 395 KEGGALYALGLIHANHGRGITDYLLQQLKTAENEVVRHGACLGLGLAGMGSANEEIYEKLKEVLYNDSAVSGEAAGIAMG 474 (929)
T ss_pred cccchhhhhhccccCcCccHHHHHHHHHHhccchhhhhhhhhhccchhcccccHHHHHHHHHHHhccchhhhhHHHHhhh
Confidence 99999999999999999889999988665543 3699999999999999
Q ss_pred HhhccCCChhHHHHHHHhhhhcchHHHHHHHHHHHHHHhcCChhhHHHHHHHHhhcchhhhhccchhHHHHHhhhhhhhc
Q psy6893 362 LVLLGSKSESAIQDMVAYAKETQHEKILRGLAVGISFIMYGQLENADDLVRDLCEEKDAILRRSGMYTIAMAYCVSYLYF 441 (988)
Q Consensus 362 L~~~Gs~~~~~~~~L~~~~~dt~~E~~~r~lalgl~~v~~g~~e~a~~li~~L~~~~d~~lr~~~~~~~~l~l~Lgll~~ 441 (988)
|+|+||.+.+++++|+.|+++||||+|+||+++|++++.||++|.++.+|..|+.++||+||++
T Consensus 475 l~mlGt~~~eaiedm~~Ya~ETQHeki~RGl~vGiaL~~ygrqe~Ad~lI~el~~dkdpilR~~---------------- 538 (929)
T KOG2062|consen 475 LLMLGTANQEAIEDMLTYAQETQHEKIIRGLAVGIALVVYGRQEDADPLIKELLRDKDPILRYG---------------- 538 (929)
T ss_pred hHhhCcCcHHHHHHHHHHhhhhhHHHHHHHHHHhHHHHHhhhhhhhHHHHHHHhcCCchhhhhh----------------
Confidence 9999999999999999999999999999999999999999999999999999999999999997
Q ss_pred cccchhhHHhhccchhHHHHHhhhccCCCHHHHHHHHHHhccCCCchhhHHHHHHHHHHhhcCccccccccCCCCchhHH
Q psy6893 442 DLFSDLTYRIVKNRSGMYTIAMAYCGSGSNVATKRLLHVAVSDVNDDVRREAVTALGFILFRTLFYVAPACTRSPWPGVI 521 (988)
Q Consensus 442 g~~~e~~l~~~~~~~~~~~~~~AYaGTGN~~~Iq~LLhi~~s~~~~dvrr~AV~~lg~I~~~~~~~~g~~~~~~~~p~ai 521 (988)
|+|+.++||+||||+.+|++|||++|||++|||||+||++||||++++| ..+|..+
T Consensus 539 ---------------Gm~t~alAy~GTgnnkair~lLh~aVsD~nDDVrRaAVialGFVl~~dp---------~~~~s~V 594 (929)
T KOG2062|consen 539 ---------------GMYTLALAYVGTGNNKAIRRLLHVAVSDVNDDVRRAAVIALGFVLFRDP---------EQLPSTV 594 (929)
T ss_pred ---------------hHHHHHHHHhccCchhhHHHhhcccccccchHHHHHHHHHheeeEecCh---------hhchHHH
Confidence 6779999999999999999999999999999999999999999999999 7889999
Q ss_pred hhccchhhhhhHhhHHHhhhhcccCCCCchhhHHHHHHHHHhhhccCCchhHHHHHHHHHhcCCchHHHHHhhhhhhhhh
Q psy6893 522 SLLDDPMIELKEFSLKKLNDIVDDFWPENEKEKQLQARITKLSKILSGEVSIDLHLQFLIRSNKTDMLILKNTKESIRVS 601 (988)
Q Consensus 522 ~lL~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~Il~g~~~~~l~l~fL~~~n~tD~~il~~~kds~r~s 601 (988)
++|++.- |.. +|
T Consensus 595 ~lLses~-------------------------------------------------------N~H-----------VR-- 606 (929)
T KOG2062|consen 595 SLLSESY-------------------------------------------------------NPH-----------VR-- 606 (929)
T ss_pred HHHhhhc-------------------------------------------------------Chh-----------hh--
Confidence 8888322 000 13
Q ss_pred hhhhHHHHHHHHhhcCCCchhhhcchhHHHHhhcccchhhhhhhhcccccCChHHHHHHHhhcCCCCCCCCCccchhhHH
Q psy6893 602 ICHTATIIANAFMHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGHETEALAHMQSYLPRETGPTSGYYEGGGL 681 (988)
Q Consensus 602 ~~h~A~~~ana~~naGt~~D~flr~~~~wl~k~~~w~kfsA~ASLG~Ih~gn~~~~l~~L~~yL~~~~~s~~~~~k~GAL 681 (988)
.++.+|.|+.-||||+ .+++.+|+|..+ ...+|+|-||+
T Consensus 607 ---yGaA~ALGIaCAGtG~----------------------------------~eAi~lLepl~~----D~~~fVRQgAl 645 (929)
T KOG2062|consen 607 ---YGAAMALGIACAGTGL----------------------------------KEAINLLEPLTS----DPVDFVRQGAL 645 (929)
T ss_pred ---hhHHHHHhhhhcCCCc----------------------------------HHHHHHHhhhhc----ChHHHHHHHHH
Confidence 2567888888888884 157888888874 44579999999
Q ss_pred HHHhhhccCCchH-------HHHHHHHHhhh-cCchhhHHHHHHhhHhhhcCCCCH
Q psy6893 682 YALGLIHANHGAV-------INDYLLGQVKD-ATNEMVRHGGCLGLGLAAMGSARD 729 (988)
Q Consensus 682 ~AlGlI~ag~~~~-------~~~~Ll~~l~~-s~~~~ir~gA~LGLGla~~Gs~~~ 729 (988)
.|+++|..-+-+. ....|...+.+ +.+.....||||+=|+.-+|-+|.
T Consensus 646 Ia~amIm~Q~t~~~~pkv~~frk~l~kvI~dKhEd~~aK~GAilAqGildaGGrNv 701 (929)
T KOG2062|consen 646 IALAMIMIQQTEQLCPKVNGFRKQLEKVINDKHEDGMAKFGAILAQGILDAGGRNV 701 (929)
T ss_pred HHHHHHHHhcccccCchHHHHHHHHHHHhhhhhhHHHHHHHHHHHhhhhhcCCceE
Confidence 9999997765331 23333322222 123478888888888888887775
|
|
| >KOG2062|consensus | Back alignment and domain information |
|---|
| >COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2005|consensus | Back alignment and domain information |
|---|
| >COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5110 RPN1 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2005|consensus | Back alignment and domain information |
|---|
| >COG5110 RPN1 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1858|consensus | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF01851 PC_rep: Proteasome/cyclosome repeat; InterPro: IPR002015 A weakly conserved repeat module of unknown function, which occurs in two regulatory subunits of the 26S-proteasome and in one subunit of the APC-complex (cyclosome) [] | Back alignment and domain information |
|---|
| >PF01851 PC_rep: Proteasome/cyclosome repeat; InterPro: IPR002015 A weakly conserved repeat module of unknown function, which occurs in two regulatory subunits of the 26S-proteasome and in one subunit of the APC-complex (cyclosome) [] | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG2002|consensus | Back alignment and domain information |
|---|
| >KOG1858|consensus | Back alignment and domain information |
|---|
| >KOG4364|consensus | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG2572|consensus | Back alignment and domain information |
|---|
| >KOG1824|consensus | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >smart00638 LPD_N Lipoprotein N-terminal Domain | Back alignment and domain information |
|---|
| >KOG2573|consensus | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2573|consensus | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >KOG1144|consensus | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG1824|consensus | Back alignment and domain information |
|---|
| >KOG1943|consensus | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF07946 DUF1682: Protein of unknown function (DUF1682); InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0567|consensus | Back alignment and domain information |
|---|
| >KOG0163|consensus | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >PF08208 RNA_polI_A34: DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] | Back alignment and domain information |
|---|
| >KOG3809|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07946 DUF1682: Protein of unknown function (DUF1682); InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0112|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 988 | ||||
| 4b4t_N | 945 | Near-Atomic Resolution Structural Model Of The Yeas | 4e-61 | ||
| 4ady_A | 963 | Crystal Structure Of 26s Proteasome Subunit Rpn2 Le | 5e-52 |
| >pdb|4B4T|N Chain N, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 945 | Back alignment and structure |
|
| >pdb|4ADY|A Chain A, Crystal Structure Of 26s Proteasome Subunit Rpn2 Length = 963 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 988 | |||
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 4e-88 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 2e-75 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 4e-10 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 3e-10 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 4e-08 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 3e-09 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 2e-08 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 4e-08 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 4e-08 | |
| 2zkr_c | 421 | 60S ribosomal protein L4; protein-RNA complex, 60S | 2e-07 | |
| 2xzm_Y | 293 | RPS6E; ribosome, translation; 3.93A {Tetrahymena t | 3e-08 | |
| 2zkr_u | 157 | 60S ribosomal protein L24; protein-RNA complex, 60 | 1e-07 | |
| 2zkr_u | 157 | 60S ribosomal protein L24; protein-RNA complex, 60 | 2e-07 | |
| 2zkr_u | 157 | 60S ribosomal protein L24; protein-RNA complex, 60 | 6e-04 | |
| 2zkr_w | 270 | 60S ribosomal protein L7; protein-RNA complex, 60S | 2e-07 | |
| 2zkr_w | 270 | 60S ribosomal protein L7; protein-RNA complex, 60S | 2e-05 | |
| 2zkr_w | 270 | 60S ribosomal protein L7; protein-RNA complex, 60S | 2e-04 | |
| 1a31_A | 591 | Protein (topoisomerase I); topoisomerase I/DNA, DN | 2e-07 | |
| 1a31_A | 591 | Protein (topoisomerase I); topoisomerase I/DNA, DN | 6e-05 | |
| 1a31_A | 591 | Protein (topoisomerase I); topoisomerase I/DNA, DN | 8e-04 | |
| 4a17_T | 158 | RPL24, 60S ribosomal protein L21; eukaryotic ribos | 2e-07 | |
| 4a17_T | 158 | RPL24, 60S ribosomal protein L21; eukaryotic ribos | 3e-06 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 4e-07 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 6e-07 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 5e-06 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 2e-04 | |
| 4a17_C | 410 | RPL4, ribosomal protein L3; eukaryotic ribosome, r | 6e-07 | |
| 4a17_C | 410 | RPL4, ribosomal protein L3; eukaryotic ribosome, r | 8e-07 | |
| 4a17_C | 410 | RPL4, ribosomal protein L3; eukaryotic ribosome, r | 3e-06 | |
| 4a17_C | 410 | RPL4, ribosomal protein L3; eukaryotic ribosome, r | 2e-04 | |
| 3iz5_Z | 162 | 60S ribosomal protein L24 (L24E); eukaryotic ribos | 6e-07 | |
| 3iz5_Z | 162 | 60S ribosomal protein L24 (L24E); eukaryotic ribos | 5e-06 | |
| 3iz5_Z | 162 | 60S ribosomal protein L24 (L24E); eukaryotic ribos | 4e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 2e-06 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 9e-05 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 6e-04 | |
| 3kio_B | 332 | Ribonuclease H2 subunit B; aicardi-goutieres syndr | 9e-04 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 3e-06 | |
| 3izc_Z | 155 | 60S ribosomal protein RPL24 (L24E); eukaryotic rib | 5e-06 | |
| 3izc_Z | 155 | 60S ribosomal protein RPL24 (L24E); eukaryotic rib | 9e-05 | |
| 3izc_Z | 155 | 60S ribosomal protein RPL24 (L24E); eukaryotic rib | 4e-04 | |
| 4f61_I | 240 | Stathmin-like domain R4; alpha-tubulin, beta-tubul | 6e-06 | |
| 4f61_I | 240 | Stathmin-like domain R4; alpha-tubulin, beta-tubul | 6e-05 | |
| 3iz5_e | 244 | 60S ribosomal protein L7 (L30P); eukaryotic riboso | 2e-05 | |
| 3iz5_e | 244 | 60S ribosomal protein L7 (L30P); eukaryotic riboso | 8e-05 | |
| 4a17_V | 239 | RPL7, 60S ribosomal protein L7; eukaryotic ribosom | 2e-05 | |
| 4a17_V | 239 | RPL7, 60S ribosomal protein L7; eukaryotic ribosom | 6e-05 | |
| 4a17_V | 239 | RPL7, 60S ribosomal protein L7; eukaryotic ribosom | 1e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 3e-05 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 7e-05 | |
| 1jad_A | 251 | PLC-beta, phospholipase C beta; alpha helical coil | 5e-05 | |
| 3izc_e | 244 | 60S ribosomal protein RPL7 (L30P); eukaryotic ribo | 7e-05 | |
| 3izc_e | 244 | 60S ribosomal protein RPL7 (L30P); eukaryotic ribo | 1e-04 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 1e-04 | |
| 3iz5_D | 405 | 60S ribosomal protein L4 (L4P); eukaryotic ribosom | 1e-04 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 2e-04 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 8e-04 | |
| 4dyl_A | 406 | Tyrosine-protein kinase FES/FPS; structural genomi | 2e-04 | |
| 3ryc_E | 143 | Stathmin-4; alpha-tubulin, beta-tubulin, GTPase, m | 2e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-04 | |
| 3qwe_A | 279 | GMIP, GEM-interacting protein; structural genomics | 3e-04 | |
| 3lvh_D | 205 | LCB, clathrin light chain B; SELF assembly, coated | 4e-04 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 4e-04 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 8e-04 | |
| 2a9u_A | 144 | Ubiquitin carboxyl-terminal hydrolase 8; coil-COIL | 5e-04 |
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
Score = 302 bits (774), Expect = 4e-88
Identities = 146/365 (40%), Positives = 205/365 (56%), Gaps = 18/365 (4%)
Query: 544 DDFWPENEKEKQLQARITKLSKILSGEVSIDLHLQFLIRSNKTDMLILKNTKESI--RVS 601
E Q L ILSG + D + FL+ + D+ +L +K S+ + S
Sbjct: 278 QQLLEILVTELTAQGYDPALLNILSGLPTCDYYNTFLLNNKNIDIGLLNKSKSSLDGKFS 337
Query: 602 ICHTATIIANAFMHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGHETEALAHM 661
+ HTA +AN FMH+GTT + F++ NL WL +A NWAK TATASLGVIH+G+ E M
Sbjct: 338 LFHTAVSVANGFMHAGTTDNSFIKANLPWLGKAQNWAKFTATASLGVIHKGNLLEGKKVM 397
Query: 662 QSYLPRETGPTSGYYEGGGLYALGLIHANHGAVINDYLLGQVKDAT-------NEMVRHG 714
YLP + +S + +GG LY LGLI+A G DYL + + + +++ HG
Sbjct: 398 APYLP-GSRASSRFIKGGSLYGLGLIYAGFGRDTTDYLKNIIVENSGTSGDEDVDVLLHG 456
Query: 715 GCLGLGLAAMGSARDDIYEQLKFNLYQDDAVTGEAAGIAMGLVLLGSKSESAIQDMVAYA 774
LG+GLAAMGSA ++YE LK LY D A +GEAA + MGL +LG+ AI DM Y+
Sbjct: 457 ASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEAAALGMGLCMLGTGKPEAIHDMFTYS 516
Query: 775 KETQHEKILRGLAVGISFIMYGQLENADDLVRDLCEEKDAILRRSGMYTIAMAYCGSGSN 834
+ETQH I RGLAVG++ I YG+ E ADDL+ + +++LR G +TIA+AY G+G+N
Sbjct: 517 QETQHGNITRGLAVGLALINYGRQELADDLITKMLASDESLLRYGGAFTIALAYAGTGNN 576
Query: 835 VATKRLLHDAI------LRRSGMYTIAMAYCGSGSNVATKRLLHVAVSDVNDDVRREAVT 888
A KRLLH A+ +RR+ + + + R++ + N VR
Sbjct: 577 SAVKRLLHVAVSDSNDDVRRAAVIALGFVLLRDYT--TVPRIVQLLSKSHNAHVRCGTAF 634
Query: 889 ALGFI 893
ALG
Sbjct: 635 ALGIA 639
|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2zkr_c 60S ribosomal protein L4; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 421 | Back alignment and structure |
|---|
| >2xzm_Y RPS6E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_Y Length = 293 | Back alignment and structure |
|---|
| >2zkr_u 60S ribosomal protein L24; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 157 | Back alignment and structure |
|---|
| >2zkr_u 60S ribosomal protein L24; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 157 | Back alignment and structure |
|---|
| >2zkr_u 60S ribosomal protein L24; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 157 | Back alignment and structure |
|---|
| >2zkr_w 60S ribosomal protein L7; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 270 | Back alignment and structure |
|---|
| >2zkr_w 60S ribosomal protein L7; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 270 | Back alignment and structure |
|---|
| >2zkr_w 60S ribosomal protein L7; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 270 | Back alignment and structure |
|---|
| >1a31_A Protein (topoisomerase I); topoisomerase I/DNA, DNA, isomerase/DNA complex; HET: DNA 5IU PTR; 2.10A {Homo sapiens} SCOP: d.163.1.2 e.15.1.1 PDB: 1k4t_A* 1k4s_A* 1sc7_A* 1t8i_A* 1tl8_A* 1seu_A* 1a35_A* 1a36_A* 1r49_A* 1rrj_A* 1nh3_A* 1lpq_A* 1rr8_C* 1ej9_A* Length = 591 | Back alignment and structure |
|---|
| >1a31_A Protein (topoisomerase I); topoisomerase I/DNA, DNA, isomerase/DNA complex; HET: DNA 5IU PTR; 2.10A {Homo sapiens} SCOP: d.163.1.2 e.15.1.1 PDB: 1k4t_A* 1k4s_A* 1sc7_A* 1t8i_A* 1tl8_A* 1seu_A* 1a35_A* 1a36_A* 1r49_A* 1rrj_A* 1nh3_A* 1lpq_A* 1rr8_C* 1ej9_A* Length = 591 | Back alignment and structure |
|---|
| >1a31_A Protein (topoisomerase I); topoisomerase I/DNA, DNA, isomerase/DNA complex; HET: DNA 5IU PTR; 2.10A {Homo sapiens} SCOP: d.163.1.2 e.15.1.1 PDB: 1k4t_A* 1k4s_A* 1sc7_A* 1t8i_A* 1tl8_A* 1seu_A* 1a35_A* 1a36_A* 1r49_A* 1rrj_A* 1nh3_A* 1lpq_A* 1rr8_C* 1ej9_A* Length = 591 | Back alignment and structure |
|---|
| >4a17_T RPL24, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_T 4a1c_T 4a1e_T Length = 158 | Back alignment and structure |
|---|
| >4a17_T RPL24, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_T 4a1c_T 4a1e_T Length = 158 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >4a17_C RPL4, ribosomal protein L3; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_C 4a1c_C 4a1e_C Length = 410 | Back alignment and structure |
|---|
| >4a17_C RPL4, ribosomal protein L3; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_C 4a1c_C 4a1e_C Length = 410 | Back alignment and structure |
|---|
| >4a17_C RPL4, ribosomal protein L3; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_C 4a1c_C 4a1e_C Length = 410 | Back alignment and structure |
|---|
| >4a17_C RPL4, ribosomal protein L3; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_C 4a1c_C 4a1e_C Length = 410 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >3kio_B Ribonuclease H2 subunit B; aicardi-goutieres syndrome, RNAse H2, protein complex, autoimmune disease, endonuclease, hydrolase, metal-binding; 2.90A {Mus musculus} PDB: 3p5j_B 3puf_B 3p56_B Length = 332 | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Length = 374 | Back alignment and structure |
|---|
| >4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 | Back alignment and structure |
|---|
| >4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 | Back alignment and structure |
|---|
| >4a17_V RPL7, 60S ribosomal protein L7; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_V 4a1c_V 4a1e_V Length = 239 | Back alignment and structure |
|---|
| >4a17_V RPL7, 60S ribosomal protein L7; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_V 4a1c_V 4a1e_V Length = 239 | Back alignment and structure |
|---|
| >4a17_V RPL7, 60S ribosomal protein L7; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_V 4a1c_V 4a1e_V Length = 239 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1jad_A PLC-beta, phospholipase C beta; alpha helical coiled coil, hydrolase; 2.40A {Meleagris gallopavo} SCOP: h.4.10.1 Length = 251 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3ryc_E Stathmin-4; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Rattus norvegicus} PDB: 3ryf_E* 3ryh_E* 3ryi_E* 1sa0_E* 1sa1_E* 1z2b_E* 3du7_E* 3e22_E* 3hkb_E* 3hkc_E* 3hkd_E* 3hke_E* 3n2g_E* 3n2k_E* Length = 143 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} Length = 279 | Back alignment and structure |
|---|
| >3lvh_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 9.00A {Bos taurus} Length = 205 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >2a9u_A Ubiquitin carboxyl-terminal hydrolase 8; coil-COIL, protease, SH3-binding, thiol protease, UBL conjugation pathway, structural genomics; 2.10A {Homo sapiens} SCOP: a.118.23.1 Length = 144 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 988 | |||
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 100.0 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 100.0 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 98.32 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 98.2 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 98.17 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 98.06 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 98.0 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 97.85 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.79 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 97.71 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 97.7 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 97.6 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 97.54 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 97.33 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 97.31 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.23 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.22 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 97.17 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 97.11 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 97.04 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 96.96 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 96.74 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 96.64 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 96.61 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 96.55 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 96.35 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 96.32 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 96.3 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 96.07 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 96.03 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 95.99 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 95.95 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 95.82 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 95.67 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 95.67 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 95.5 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 95.44 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 95.32 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 95.26 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 95.23 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 95.18 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 95.18 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 95.15 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 94.79 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 94.36 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 94.23 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 94.16 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 93.89 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 93.55 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 92.69 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 92.27 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 91.91 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 91.57 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 90.88 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 89.85 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 89.42 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 89.16 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 89.15 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 88.82 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 87.63 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 87.25 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 86.07 | |
| 3l9t_A | 240 | Putative uncharacterized protein SMU.31; hypotheti | 85.98 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 85.22 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 85.15 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 85.11 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 84.99 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 84.93 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 84.78 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 84.5 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 84.4 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 83.88 | |
| 3l9t_A | 240 | Putative uncharacterized protein SMU.31; hypotheti | 83.73 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 83.06 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 82.73 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 81.74 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 80.83 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 80.72 |
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
Probab=100.00 E-value=5.1e-94 Score=879.59 Aligned_cols=533 Identities=30% Similarity=0.459 Sum_probs=450.7
Q ss_pred hHHHHHHHhcCCCC-Cc-----cccCCC--CCCCC-------CChhhhhhhhhhhhhhcccccChHHHHHHHHHHHHHHh
Q psy6893 2 DVFEAAIKQMTPPR-SF-----TTRSRW--PCPPF-------SRVHSALKSCVPWCLAMSSIQSRSFRAQILRTLVRLYH 66 (988)
Q Consensus 2 ~~~~~~~~~~~~~~-~~-----~~~~~~--~~~~~-------~~~~~~L~y~~~~~~~~~~v~~~~fR~~vL~lL~~ly~ 66 (988)
.||++|++ .+..+ ++ ++|+|+ +++.= ++...+|.|++. +|++++++++||++|||+++++|+
T Consensus 150 ~iv~~cl~-hnae~~AvdLalE~erLD~Le~~vd~~~~~~~~~n~~rvclYlls--~v~~lv~p~~fr~~vLr~l~~Iy~ 226 (963)
T 4ady_A 150 RMIEKCLK-ASELKLALGIALEGYRLDIIESALKSKLDQDSTSENVKIINYLLT--LAITTVTNSKFRSSILRKSFDFLM 226 (963)
T ss_dssp HHHHHHHH-HTCHHHHHHHHHHTTCHHHHHHHHHHHCCC-CHHHHHHHHHHHHH--HHHHTCCCHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHh-CCCHHHHHHHHHHHhhHHHHHHHHHhhccccccccHHHHHHHHHH--HhhccCCChHHHHHHHHHHHHHHH
Confidence 58889998 67766 33 999998 43321 456799999999 559999999999999999999999
Q ss_pred cCCcccHHHHHHHHHHcCChHHHHHHHHHhhcCCCCchhHHHHHHHhhcccccHHHHHHHHHhhcccCCCCCCCcccccc
Q psy6893 67 SLSVPDYVNMAQCWIYLDDPRSVANLLGKLVAGSADDDLMAAQIGFDLYESATQAFLASVLQELKTCAPIPDATHVVVKV 146 (988)
Q Consensus 67 ~~~~pDy~~~~qc~~~Lnd~~~va~il~~L~~~~~~~~l~ayQiaFdL~~~~~Q~fl~~v~~~l~~~~~~~~~~~~~~~~ 146 (988)
+++.|||+++|||+++|||++.|+++|.+|+. .++.+|||||||||+++++|.||..|++.|+...
T Consensus 227 k~~~~dy~~a~~~ai~LnD~~li~~if~~l~~--~~d~l~ayQiAFdL~~~~~Q~fL~~v~~~l~~~e------------ 292 (963)
T 4ady_A 227 NMPNCDYLTLNKVVVNLNDAGLALQLFKKLKE--ENDEGLSAQIAFDLVSSASQQLLEILVTELTAQG------------ 292 (963)
T ss_dssp HSSSCCHHHHHHHHHHHTCHHHHHHHHHHHHT--TCCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHTT------------
T ss_pred hCCchhHHHHHHHHHHcCCHHHHHHHHHHHHh--cccHHHHHHHHHHHhcccchHHHHHHHHhccccc------------
Confidence 99999999999999999999999999999985 3678999999999999999999999999886410
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccchhhHHHHHHHHHHHHhhhcccCccchhhHHHHhhhcccchH
Q psy6893 147 PVEGAPTPATPDTEAPTPAPGTESGPSSTTPGPETKTLESLNEKEKQLQARITKLSKILSGEVSIDLHLQFLIRSNKTDM 226 (988)
Q Consensus 147 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~IL~g~~~~~l~~~fL~~~n~~d~ 226 (988)
.++++++||+|+.++++|++||+++|++|+
T Consensus 293 --------------------------------------------------~~~kL~~ILsg~~~~~Lyl~FL~~~n~~d~ 322 (963)
T 4ady_A 293 --------------------------------------------------YDPALLNILSGLPTCDYYNTFLLNNKNIDI 322 (963)
T ss_dssp --------------------------------------------------CCHHHHHHTTSHHHHHHHHHHHHHHCCCCH
T ss_pred --------------------------------------------------hhHHHHHHhCCCChHHHHHHHHHhccccch
Confidence 025899999999999999999999999999
Q ss_pred HhHHhhhhhh--hhhhhhhHHHHHHHhhhccCCcccccccchhHHHhhccchhhHHhhhccceecCChHHHHHHHhcccC
Q psy6893 227 LILKNTKESI--RVSICHTATIIANAFMHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGHETEALAHMQSYLP 304 (988)
Q Consensus 227 ~iL~~~k~s~--r~s~~~~A~~~~Naf~naG~~~D~fl~~n~~Wl~k~~~~~~~sAtASLG~Ih~~~~~~gl~~l~~yL~ 304 (988)
.+|+++|+++ |+|++|+|++|||||||||||+|+|||+|.+|++|+++|+||+|+||||+||+||+++|+++|++|||
T Consensus 323 ~~l~~~K~~ld~r~s~~~~A~~f~Naf~naG~~~D~~l~~~~~Wl~k~~~~~k~sA~aSLGlIh~g~~~~gl~~L~~yL~ 402 (963)
T 4ady_A 323 GLLNKSKSSLDGKFSLFHTAVSVANGFMHAGTTDNSFIKANLPWLGKAQNWAKFTATASLGVIHKGNLLEGKKVMAPYLP 402 (963)
T ss_dssp HHHHHHHHHSCTTSHHHHHHHHHHHHHHTTTTCCCHHHHHCHHHHHHCCTHHHHHHHHHHHHHTSSCTTTHHHHHTTTST
T ss_pred hhHHHHHhhhcchhhHHHHHHHHHHHHHhCCCCcchhhhcchhhhhccchHHHHHHHHHhhhhccCchHHHHHHHHHhcc
Confidence 9999999998 88999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCccchhHHHHHhhhccCCCCchhHHHHHHhhhhcCCCc--------hhHHHHHHHHHHHhhccCCChhHHHHH
Q psy6893 305 RETGPTSGYYEGGGLYALGLIHANHGAVINDYLLGQVKDATNEDD--------AVTGEAAGIAMGLVLLGSKSESAIQDM 376 (988)
Q Consensus 305 s~~~~~~~y~~~GaL~alGli~~g~~~~~~d~l~~lL~~~~~~d~--------~~~~~aA~lglGL~~~Gs~~~~~~~~L 376 (988)
++ +++++|+++|||||||+|++|+++.. +++|.+++.+++ ..++.+|++|||++|+||+++++++.|
T Consensus 403 ~~-~s~~~~ik~GAllaLGli~ag~~~~~----~~lL~~~L~~~~~~~~~~~~~~ir~gAaLGLGla~~GS~~eev~e~L 477 (963)
T 4ady_A 403 GS-RASSRFIKGGSLYGLGLIYAGFGRDT----TDYLKNIIVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIEVYEAL 477 (963)
T ss_dssp TS-CCSCHHHHHHHHHHHHHHTTTTTHHH----HHHHHHHHHHHSSCCSCHHHHHHHHHHHHHHHHHSTTCCCHHHHHHH
T ss_pred cc-CCCcHHHHHHHHHHHHHhcCCCcHHH----HHHHHHHHcCccccccccccHHHHHHHHHHHHHHhcCCCCHHHHHHH
Confidence 42 12578999999999999999998633 455555443333 678899999999999999999999999
Q ss_pred HHhhhhcchHH-HHHHHHHHHHHHhcCChhhHHHHHHHHhhcchhhhhccchhHHHHHhhhhhhhcccc--chhhHHh--
Q psy6893 377 VAYAKETQHEK-ILRGLAVGISFIMYGQLENADDLVRDLCEEKDAILRRSGMYTIAMAYCVSYLYFDLF--SDLTYRI-- 451 (988)
Q Consensus 377 ~~~~~dt~~E~-~~r~lalgl~~v~~g~~e~a~~li~~L~~~~d~~lr~~~~~~~~l~l~Lgll~~g~~--~e~~l~~-- 451 (988)
+|++.+++... ..+++++|++|+|+||.++++.|++.++++.+. .+.|++++|||++++|++ ++.+++.
T Consensus 478 ~~~L~dd~~~~~~~AalALGli~vGTgn~~ai~~LL~~~~e~~~e------~vrR~aalgLGll~~g~~e~~~~li~~L~ 551 (963)
T 4ady_A 478 KEVLYNDSATSGEAAALGMGLCMLGTGKPEAIHDMFTYSQETQHG------NITRGLAVGLALINYGRQELADDLITKML 551 (963)
T ss_dssp HHHHHTCCHHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHCSCH------HHHHHHHHHHHHHTTTCGGGGHHHHHHHH
T ss_pred HHHHhcCCHHHHHHHHHHHhhhhcccCCHHHHHHHHHHHhccCcH------HHHHHHHHHHHhhhCCChHHHHHHHHHHH
Confidence 99999777433 578999999999999999999999999876532 466789999999999999 8888887
Q ss_pred -hccchh----HHHHHhhhccCCCHHHHHHHHHHhccCCCchhhHHHHHHHHHHhhcCccccccccCCCCchhHHhhccc
Q psy6893 452 -VKNRSG----MYTIAMAYCGSGSNVATKRLLHVAVSDVNDDVRREAVTALGFILFRTLFYVAPACTRSPWPGVISLLDD 526 (988)
Q Consensus 452 -~~~~~~----~~~~~~AYaGTGN~~~Iq~LLhi~~s~~~~dvrr~AV~~lg~I~~~~~~~~g~~~~~~~~p~ai~lL~~ 526 (988)
.++|.. +++++||||||||+++||+|||+|++|.++||||.||++||||++++| ..+|..+.+|
T Consensus 552 ~~~dp~vRygaa~alglAyaGTGn~~aIq~LL~~~~~d~~d~VRraAViaLGlI~~g~~---------e~v~rlv~~L-- 620 (963)
T 4ady_A 552 ASDESLLRYGGAFTIALAYAGTGNNSAVKRLLHVAVSDSNDDVRRAAVIALGFVLLRDY---------TTVPRIVQLL-- 620 (963)
T ss_dssp HCSCHHHHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHCSCHHHHHHHHHHHHHHTSSSC---------SSHHHHTTTG--
T ss_pred hCCCHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHhccCCcHHHHHHHHHHHHhhccCCH---------HHHHHHHHHH--
Confidence 355544 449999999999999999999999999999999999999999999876 1111111100
Q ss_pred hhhhhhHhhHHHhhhhcccCCCCchhhHHHHHHHHHhhhccCCchhHHHHHHHHHhcCCchHHHHHhhhhhhhhhhhhhH
Q psy6893 527 PMIELKEFSLKKLNDIVDDFWPENEKEKQLQARITKLSKILSGEVSIDLHLQFLIRSNKTDMLILKNTKESIRVSICHTA 606 (988)
Q Consensus 527 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~Il~g~~~~~l~l~fL~~~n~tD~~il~~~kds~r~s~~h~A 606 (988)
T Consensus 621 -------------------------------------------------------------------------------- 620 (963)
T 4ady_A 621 -------------------------------------------------------------------------------- 620 (963)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred HHHHHHHhhcCCCchhhhcchhHHHHhhcccchhhhhhhhcccccCChHHHHHHHhhcCCCCCCCCCccchhhHHHHHhh
Q psy6893 607 TIIANAFMHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGHETEALAHMQSYLPRETGPTSGYYEGGGLYALGL 686 (988)
Q Consensus 607 ~~~ana~~naGt~~D~flr~~~~wl~k~~~w~kfsA~ASLG~Ih~gn~~~~l~~L~~yL~~~~~s~~~~~k~GAL~AlGl 686 (988)
+. +.++++|.||.+|||+
T Consensus 621 ----------------------------------------------------------~~----~~d~~VR~gAalALGl 638 (963)
T 4ady_A 621 ----------------------------------------------------------SK----SHNAHVRCGTAFALGI 638 (963)
T ss_dssp ----------------------------------------------------------GG----CSCHHHHHHHHHHHHH
T ss_pred ----------------------------------------------------------Hh----cCCHHHHHHHHHHHHH
Confidence 00 2357889999999999
Q ss_pred hccCCchH-HHHHHHHHhhhcCchhhHHHHHHhhHhhhcCCCCH---HHHHHHHHhh--ccC---ChhhHHHHHHHhhcc
Q psy6893 687 IHANHGAV-INDYLLGQVKDATNEMVRHGGCLGLGLAAMGSARD---DIYEQLKFNL--YQD---DAVTGEAAGIAMGLV 757 (988)
Q Consensus 687 I~ag~~~~-~~~~Ll~~l~~s~~~~ir~gA~LGLGla~~Gs~~~---dv~~~L~~~l--~~D---~~~~~e~AalAlGLI 757 (988)
+++|.+.. +++.| ..+.+.++..||.+|+++||++.+|+.+. .+-..+..+. +.| +......+.+|+|+|
T Consensus 639 i~aGn~~~~aid~L-~~L~~D~d~~Vrq~Ai~ALG~Ig~gtnna~~~rva~~l~~L~~~~~dk~~d~~~~fga~iAqGll 717 (963)
T 4ady_A 639 ACAGKGLQSAIDVL-DPLTKDPVDFVRQAAMIALSMILIQQTEKLNPQVADINKNFLSVITNKHQEGLAKFGACVAQGIM 717 (963)
T ss_dssp HTSSSCCHHHHHHH-HHHHTCSSHHHHHHHHHHHHHHSTTCCTTTCTTHHHHHHHHHHHHHCSSSCHHHHHHHHHHHHHH
T ss_pred hccCCCcHHHHHHH-HHHccCCCHHHHHHHHHHHHHHhcCCccccchHHHHHHHHHHHHHhcccccHHHHHHHHHHHHHH
Confidence 99998864 66644 56656667899999999999999999887 5555444333 234 233445799999999
Q ss_pred cCCCCCHHH
Q psy6893 758 LLGSKSESA 766 (988)
Q Consensus 758 ~vGs~n~d~ 766 (988)
.+|-+|..+
T Consensus 718 ~aG~~n~ti 726 (963)
T 4ady_A 718 NAGGRNVTI 726 (963)
T ss_dssp TTGGGTEEE
T ss_pred hcCCCceEE
Confidence 999888655
|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 988 | ||||
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 3e-07 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 1e-06 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 1e-05 | |
| d2lefa_ | 86 | a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE | 3e-06 | |
| d1zroa2 | 314 | a.264.1.1 (A:283-596) Erythrocyte binding antigen | 2e-05 | |
| d1zroa2 | 314 | a.264.1.1 (A:283-596) Erythrocyte binding antigen | 1e-04 | |
| d1zroa2 | 314 | a.264.1.1 (A:283-596) Erythrocyte binding antigen | 2e-04 | |
| d1zroa1 | 275 | a.264.1.1 (A:8-282) Erythrocyte binding antigen re | 5e-05 | |
| d1zroa1 | 275 | a.264.1.1 (A:8-282) Erythrocyte binding antigen re | 2e-04 | |
| d1zroa1 | 275 | a.264.1.1 (A:8-282) Erythrocyte binding antigen re | 0.003 | |
| d2c6ja1 | 294 | a.264.1.1 (A:15-308) Duffy receptor, alpha form {P | 2e-04 | |
| d2c6ja1 | 294 | a.264.1.1 (A:15-308) Duffy receptor, alpha form {P | 2e-04 | |
| d2c6ja1 | 294 | a.264.1.1 (A:15-308) Duffy receptor, alpha form {P | 0.001 | |
| d1j46a_ | 85 | a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 | 4e-04 | |
| d1v63a_ | 101 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 6e-04 | |
| d2a9ua1 | 134 | a.118.23.1 (A:6-139) Ubiquitin carboxyl-terminal h | 9e-04 | |
| d1k4ta1 | 72 | a.2.8.1 (A:641-712) Eukaryotic DNA topoisomerase I | 0.001 | |
| d1k99a_ | 91 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 0.002 | |
| d2efla1 | 288 | a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP | 0.003 | |
| d1v64a_ | 108 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 0.003 |
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Non-globular all-alpha subunits of globular proteins superfamily: Stathmin family: Stathmin domain: Stathmin 4 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 48.3 bits (115), Expect = 3e-07
Identities = 17/89 (19%), Positives = 41/89 (46%), Gaps = 5/89 (5%)
Query: 905 KKGAEKIRKKKKKKKEAEKMRKKKGAEKMKKKKKDAEKMKKKGAEKIGKKKKKKKKKKKK 964
++ + + +KK + AE+ RK + AE +K + E ++ + I + K K+K
Sbjct: 38 RRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEK 97
Query: 965 KKKK-----KKKKKKEAEKMKKKTEEAEK 988
+K + ++ A +++ E+ +
Sbjct: 98 LAQKMESNKENREAHLAAMLERLQEKDKH 126
|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d2a9ua1 a.118.23.1 (A:6-139) Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 | Back information, alignment and structure |
|---|
| >d1k4ta1 a.2.8.1 (A:641-712) Eukaryotic DNA topoisomerase I, dispensable insert domain {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 988 | |||
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 98.13 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 97.92 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 97.89 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 97.21 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 96.93 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 96.44 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 96.15 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 95.4 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 95.28 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 94.79 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 94.65 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 94.56 | |
| d1lsha1 | 336 | Lipovitellin-phosvitin complex, superhelical domai | 93.15 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 93.12 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 92.98 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 86.35 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 84.44 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 83.93 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 82.09 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 81.28 |
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: HEAT repeat domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.13 E-value=0.00027 Score=79.67 Aligned_cols=495 Identities=14% Similarity=0.111 Sum_probs=230.2
Q ss_pred HHHHHhhhhcCCCchhHHHHHHHHHHHhhccCCChhHHHHHHHhhhhcc--hHHHHHHHHHHHHHHh--cCChhhHHHH-
Q psy6893 336 YLLGQVKDATNEDDAVTGEAAGIAMGLVLLGSKSESAIQDMVAYAKETQ--HEKILRGLAVGISFIM--YGQLENADDL- 410 (988)
Q Consensus 336 ~l~~lL~~~~~~d~~~~~~aA~lglGL~~~Gs~~~~~~~~L~~~~~dt~--~E~~~r~lalgl~~v~--~g~~e~a~~l- 410 (988)
+.++.|.+.+.+++...|..|+-.++-+-..-|.+...++|+|++.+.- .+..+.+++-.|+.+. -|..+.+..+
T Consensus 10 ~~i~~l~~~l~~~~~~~R~~a~~~l~~ia~~lg~~~~~~~lip~l~~~~~~~~ev~~~~~~~l~~~~~~~~~~~~~~~ll 89 (588)
T d1b3ua_ 10 YPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLL 89 (588)
T ss_dssp HHHHHHHHHTTCSCHHHHHHHHHTHHHHHHHSCHHHHHHTHHHHHHHTCCCCHHHHHHHHHHHTTCSGGGTSGGGGGGGH
T ss_pred hHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHhCcHhhHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHcCChhHHHHHH
Confidence 3466677778888999999999888877666677778888999887642 2344555555555432 1344444444
Q ss_pred --HHHHhhcchhhhhccchhHHHHHhhhhhhhcccc---chh-hHHh----hccchhHH--------HHHhhhccCCCHH
Q psy6893 411 --VRDLCEEKDAILRRSGMYTIAMAYCVSYLYFDLF---SDL-TYRI----VKNRSGMY--------TIAMAYCGSGSNV 472 (988)
Q Consensus 411 --i~~L~~~~d~~lr~~~~~~~~l~l~Lgll~~g~~---~e~-~l~~----~~~~~~~~--------~~~~AYaGTGN~~ 472 (988)
++.++.++++..|..+ +.+|+.+.-.-. .+. ++.. ...+.... .....+.+.....
T Consensus 90 ~~l~~l~~~~~~~Vr~~a------~~~l~~i~~~~~~~~~~~~l~p~i~~L~~~~~~~~r~~a~~ll~~~~~~~~~~~~~ 163 (588)
T d1b3ua_ 90 PPLESLATVEETVVRDKA------VESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKA 163 (588)
T ss_dssp HHHHHHTTSSCHHHHHHH------HHHHHHHHTTSCHHHHHHTHHHHHHHHHTCSSHHHHHHHGGGHHHHTTTSCHHHHH
T ss_pred HHHHHHccCCCHHHHHHH------HHHHHHHHHhCCHHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHHhhHHHHH
Confidence 4456677777777732 223332221111 111 1111 22221111 1112233333344
Q ss_pred HHHHHHHHhccCCCchhhHHHHHHHHHHhhcCccccccccCCCCchhHHhhccchhhhhhHhhHHH-----hhhhcccCC
Q psy6893 473 ATKRLLHVAVSDVNDDVRREAVTALGFILFRTLFYVAPACTRSPWPGVISLLDDPMIELKEFSLKK-----LNDIVDDFW 547 (988)
Q Consensus 473 ~Iq~LLhi~~s~~~~dvrr~AV~~lg~I~~~~~~~~g~~~~~~~~p~ai~lL~~~~~~~~~~~~~~-----l~~~~~~~~ 547 (988)
.+..++.-+.+|.++.||+.|+.+++-++-.-+. .. ..+..+.+|.... ++.+..+|. +..+...+.
T Consensus 164 ~l~~~~~~l~~D~~~~VR~~a~~~l~~~~~~~~~----~~---~~~~l~~~l~~l~-~d~~~~vr~~a~~~l~~i~~~~~ 235 (588)
T d1b3ua_ 164 ELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLEL----DN---VKSEIIPMFSNLA-SDEQDSVRLLAVEACVNIAQLLP 235 (588)
T ss_dssp HHHHHHHHHHTCSCHHHHHHHHHHHHHHHHTSCH----HH---HHHTHHHHHHHHH-TCSCHHHHTTHHHHHHHHHHHSC
T ss_pred HHHHHHHHHhccCCHHHHHHHHHHHHHHHHHhcH----HH---HHHHHHHHHHHHh-cCCchhhHHHHHHHHHHhhccCC
Confidence 4444555556788899999999999988753210 00 0011111111111 111112221 222221110
Q ss_pred CCc---------------hh---hHHHHHHHHHhhhccCCchhHHHHHHHHHhcCCchHHHHHhhhh---hhhhhhhhhH
Q psy6893 548 PEN---------------EK---EKQLQARITKLSKILSGEVSIDLHLQFLIRSNKTDMLILKNTKE---SIRVSICHTA 606 (988)
Q Consensus 548 ~~~---------------~~---~~~~~~~~~~l~~Il~g~~~~~l~l~fL~~~n~tD~~il~~~kd---s~r~s~~h~A 606 (988)
... .. -......+.++.....++......+. .+..-..| .+|....+
T Consensus 236 ~~~~~~~i~~~l~~~~~D~~~~Vr~~~~~~l~~l~~~~~~~~~~~~l~~----------~l~~ll~d~~~~vr~~a~~-- 303 (588)
T d1b3ua_ 236 QEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVP----------AFQNLMKDCEAEVRAAASH-- 303 (588)
T ss_dssp HHHHHHHTHHHHHHHHTCSSHHHHHHHHHTHHHHHHHHCHHHHHHTHHH----------HHHHHHTCSSHHHHHHHHH--
T ss_pred HHHHHHHHHHHHHHhcccccHHHHHHHHHhHHHHHHHhhhhhhhhhhhH----------HHHHHHhccchHHHHHHHH--
Confidence 000 00 00000111222222222111110000 01111111 13432211
Q ss_pred HHHHHHHhhcCCCc-hh-hhcc---hhHHHHhhccc-chhhhhhhhccccc--CCh---HHHHHHHhhcCCCCCCCCCcc
Q psy6893 607 TIIANAFMHSGTTS-DQ-FLRD---NLEWLARATNW-AKLTATASLGVIHR--GHE---TEALAHMQSYLPRETGPTSGY 675 (988)
Q Consensus 607 ~~~ana~~naGt~~-D~-flr~---~~~wl~k~~~w-~kfsA~ASLG~Ih~--gn~---~~~l~~L~~yL~~~~~s~~~~ 675 (988)
.+..-+...+... +. ++.. .+.+..+..+| -+..++.+++.+.. |.. +..+..+..++. ..++.
T Consensus 304 -~l~~~~~~l~~~~~~~~~~~~i~~~l~~~~~d~~~~vr~~~~~~l~~~~~~~~~~~~~~~l~p~l~~~l~----d~~~~ 378 (588)
T d1b3ua_ 304 -KVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLK----DECPE 378 (588)
T ss_dssp -HHHHHHHTSCTTTHHHHHHHTHHHHHHHHHTCSCHHHHHHHHTTGGGGHHHHCHHHHHHHTHHHHHHHHT----CSCHH
T ss_pred -HHHHHHHHHhhhhhhhhhHHHHHHHHHHhhcCCChHHHHHHHHHHhhhhhccchhHHHHHHHHHHHHHHH----hhhhh
Confidence 2222223333322 11 1111 23334444454 34555556655432 221 222334444553 45678
Q ss_pred chhhHHHHHhhhccCCchH-----HHHHHHHHhhhcCchhhHHHHHHhhHhhh--cCCC--CHHHHHHHHHhhccCChh-
Q psy6893 676 YEGGGLYALGLIHANHGAV-----INDYLLGQVKDATNEMVRHGGCLGLGLAA--MGSA--RDDIYEQLKFNLYQDDAV- 745 (988)
Q Consensus 676 ~k~GAL~AlGlI~ag~~~~-----~~~~Ll~~l~~s~~~~ir~gA~LGLGla~--~Gs~--~~dv~~~L~~~l~~D~~~- 745 (988)
++.+++.+++.+....+.. ++..+.+. .++.+.-+|..++..++... .|.. .+.+...+...+ .|+..
T Consensus 379 v~~~~~~~l~~~~~~~~~~~~~~~ll~~l~~~-~~d~~~~~r~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l-~D~~~~ 456 (588)
T d1b3ua_ 379 VRLNIISNLDCVNEVIGIRQLSQSLLPAIVEL-AEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWL-VDHVYA 456 (588)
T ss_dssp HHHHHHTTCHHHHHHSCHHHHHHHHHHHHHHH-HTCSSHHHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHHGG-GCSSHH
T ss_pred hhhHHHHHHHHHHhhcchhhhhhHHHHHHHHH-HhcccHHHHHHHHHHHHHHHHHcChHhHHHHHHHHHHhhc-cCCchh
Confidence 8999999888775544432 23334333 34456678888888777653 2322 234444454444 45543
Q ss_pred hHHHHHHHhhcccCCCCCHHHHHHHHHHHHhc-ccchh-hhHH-HHHHHHHh--cCCc---hhHHHHHHHHhcccchhhh
Q psy6893 746 TGEAAGIAMGLVLLGSKSESAIQDMVAYAKET-QHEKI-LRGL-AVGISFIM--YGQL---ENADDLVRDLCEEKDAILR 817 (988)
Q Consensus 746 ~~e~AalAlGLI~vGs~n~d~i~~ll~~~~et-q~e~i-~R~l-algLgLi~--~Gr~---e~a~~li~~L~~~~dp~~r 817 (988)
.++.|+-++|.+.-.-|...+...+++.+.+- .+.++ .|.. +.+++.+. ++.. +.+-+.+-.+..++.|..|
T Consensus 457 VR~~A~~~L~~l~~~~~~~~~~~~i~~~l~~~~~~~~~~~R~~~~~~l~~l~~~~~~~~~~~~ilp~ll~~~~D~v~nVR 536 (588)
T d1b3ua_ 457 IREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVR 536 (588)
T ss_dssp HHHHHHHHHHHHHHHHCHHHHHHHTHHHHHHTTTCSCHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHGGGCSCHHHH
T ss_pred HHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHcChHHHHHHHHHHHHHHcCCCCHHHH
Confidence 34567778887754434444555566655432 23333 2432 22333322 2221 2223333344556666677
Q ss_pred hhcHHHHHHHHcCCCChhHHHHHHHHHHHhhhhhhhhhhhccCCCc---hHHHHHhhhhhccCCChhhhhhHHhhhhhh
Q psy6893 818 RSGMYTIAMAYCGSGSNVATKRLLHDAILRRSGMYTIAMAYCGSGS---NVATKRLLHVAVSDVNDDVRREAVTALGFI 893 (988)
Q Consensus 818 ~~~~~~lslAyaGtGnvl~iq~lL~~~~~~~lG~alia~g~~~tgn---~~air~ll~~~~sd~~~~vrraa~~alg~i 893 (988)
.. .+.++.+++ .. .++ +..+..+++-+.+|+|.|||..|-.++..+
T Consensus 537 ~~--a~~~l~~i~---------------------------~~-~~~~~~~~~i~~~l~~L~~D~d~dVr~~A~~al~~l 585 (588)
T d1b3ua_ 537 FN--VAKSLQKIG---------------------------PI-LDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVL 585 (588)
T ss_dssp HH--HHHHHHHHG---------------------------GG-SCHHHHHHHHHHHHHHHTTCSSHHHHHHHHHHHHHT
T ss_pred HH--HHHHHHHHH---------------------------HH-cCcHhHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHH
Confidence 65 333333332 11 122 223455666668899999999998888655
|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|