Psyllid ID: psy7365


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-
MFVVEYGTVRYDVTQLIRSFLPAANIHKISGSEVTYVLPQDPASMGAYVSLFESLSENRDKLGIDSYGISDTSLEEQPLGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRTDMTTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLDNVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSFVPASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVFLKNSFARGYYLSLDMKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCAEGRSADAQTYLSLNLPVADLVETHATQLQYRISGAVSDLGALFRTLESAKTEAGLIVDYSLSQTSLEDS
cccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHcccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHcccccccccEEEEEEHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHcccccccccEEEEEEcccccHHHcccccccccccccEEcccEEEEccEEEEEEEEcccccccccccEEEEEcccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHcccEEEEEccEEEEEccHHHHHHcccccEEEEEEEcccccHHHHHHHHHHccccEEEEccccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEcccccccc
cEEEEccccccccccHHHHHHHHccHHHHccccccEEccccccccccEEEEEEEEEEEccccEEEEEcEEEEcccccEEEEEcccccccccccHHHHHHHHHccccccccEEEEEcccccHHHHHHcccEEEccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHcccEEEEccccHHHHHHHcccHHHHccccccccccHHHccccccEEEEcccEEEccccEEEEEEccHHHHHHHccEEEEEEccEEEEEEccccccccEEEEccccccccHHHHHHHEEEccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHcccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHcccEEEcccHHHHHHHHccccHHHHHHHHHHHHHHccccccccccHHHHcccccccccccccccccHHHHHHHHHHHccccEEEEEEEcccccHccc
mfvveygtvryDVTQLIRSFlpaanihkisgsevtyvlpqdpasmGAYVSLFESLSenrdklgidsygisdtsleeqplgpsgitlglhtlgLEFVSRSMLmgmlpvssgtakiydhdirtDMTTIRRslgvcpqynaLFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIgdlgiphkrtslantlsggmqrklDNVKVWFNNKAWIAAVSFMNAANNVILraslpsnvsrddyaIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSfvpastvildeptsgvdpysrRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGklqccgssvflknsfARGYYLsldmksapqksyigycpqfdalndrltprehLEFYSRVRNLPSVLLNTIVNESLNKFAlghysdrevrtlsggnkRKLSTAIALlgntplifldeptsgmdpgaRRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVngqftclgsathlkskygqgysvkvrcaegrsadaQTYLSLNLPVADLVETHATQLQYRISGAVSDLGALFRTLESAKTEAGLIVdyslsqtsleds
mfvveygtvrydVTQLIRSFLPAANIHKISGSEVTYVLPQDPASMGAYVSLFESLSENRDKLGIDSYGISDTSLEEQPLGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRTDMTTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLDNVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSFVPAstvildeptsgvdpySRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVFLKNSFARGYYLSLDMKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCAEGRSADAQTYLSLNLPVADLVETHATQLQYRISGAVSDLGALFRTLesakteaglivdyslsqtsleds
MFVVEYGTVRYDVTQLIRSFLPAANIHKISGSEVTYVLPQDPASMGAYVSLFESLSENRDKLGIDSYGISDTSLEEQPLGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRTDMTTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLDNVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSFVPASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVFLKNSFARGYYLSLDMKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCAEGRSADAQTYLSLNLPVADLVETHATQLQYRISGAVSDLGALFRTLESAKTEAGLIVDYSLSQTSLEDS
*FVVEYGTVRYDVTQLIRSFLPAANIHKISGSEVTYVLPQDPASMGAYVSLFESL******LGIDSYGI***********PSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRTDMTTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLDNVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSFVPASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVFLKNSFARGYYLSLDMKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCAEGRSADAQTYLSLNLPVADLVETHATQLQYRISGAVSDLGALFRTLESAKTEAGLIVDYS*********
MFVVEYGTVRYDVTQLIRSFLP********************************LSENRDKLGIDSYGISDTSLEEQPLGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRTDMTTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLDNVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMAL**********LVAVTVLFAMSFVPASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVFLKNSFARGYYLSLDMKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCAEGRSADAQTYLSLNLPVADLVETHATQLQYRISGAVSDLGALFRTLESAKTEAGLIVDYSLSQTSLE**
MFVVEYGTVRYDVTQLIRSFLPAANIHKISGSEVTYVLPQDPASMGAYVSLFESLSENRDKLGIDSYGISDTSLEEQPLGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRTDMTTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLDNVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSFVPASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVFLKNSFARGYYLSLDMKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCAEGRSADAQTYLSLNLPVADLVETHATQLQYRISGAVSDLGALFRTLESAKTEAGLIVDYSLSQTSLEDS
MFVVEYGTVRYDVTQLIRSFLPAANIHKISGSEVTYVLPQDPASMGAYVSLFESLSENRDKLGIDSYGISDTSLEEQPLGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRTDMTTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLDNVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSFVPASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVFLKNSFARGYYLSLDMKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCAEGRSADAQ*****NLPV********TQLQYRISGAVSDLGALFRTLESAKTEAGLIVDYSLSQ******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVVEYGTVRYDVTQLIRSFLPAANIHKISGSEVTYVLPQDPASMGAYVSLFESLSENRDKLGIDSYGISDTSLEEQPLGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRTDMTTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLDNVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSFVPASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVFLKNSFARGYYLSLDMKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCAEGRSADAQTYLSLNLPVADLVETHATQLQYRISGAVSDLGALFRTLESAKTEAGLIVDYSLSQTSLEDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query601 2.2.26 [Sep-21-2011]
O954772261 ATP-binding cassette sub- yes N/A 0.372 0.099 0.493 4e-61
P412332261 ATP-binding cassette sub- yes N/A 0.372 0.099 0.493 4e-61
P412342434 ATP-binding cassette sub- no N/A 0.405 0.100 0.483 9e-61
Q8R4201704 ATP-binding cassette sub- no N/A 0.407 0.143 0.464 2e-60
Q7TNJ22170 ATP-binding cassette sub- no N/A 0.386 0.106 0.485 2e-59
Q91V242159 ATP-binding cassette sub- no N/A 0.387 0.107 0.474 3e-59
Q9ESR92434 ATP-binding cassette sub- no N/A 0.405 0.100 0.471 6e-59
Q997581704 ATP-binding cassette sub- no N/A 0.407 0.143 0.464 8e-59
Q9BZC72435 ATP-binding cassette sub- no N/A 0.376 0.092 0.504 9e-59
Q8IZY22146 ATP-binding cassette sub- no N/A 0.376 0.105 0.469 6e-57
>sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 Back     alignment and function desciption
 Score =  236 bits (602), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 154/229 (67%), Gaps = 5/229 (2%)

Query: 374  IGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSG 433
            +GYCPQFDA+ + LT REH+EF++ +R +P   +  +   ++ K  L  Y ++     SG
Sbjct: 1988 MGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSG 2047

Query: 434  GNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEEC 493
            GNKRKLSTA+AL+G  P++FLDEPT+GMDP ARRFLW C    V EGR V+LTSH+MEEC
Sbjct: 2048 GNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEEC 2107

Query: 494  EALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCAEGRSAD---AQTYLSLNLPVA 550
            EALCT++ IMVNG+F CLGS  HLK+++G GY++ VR A G + D    Q +  L  P +
Sbjct: 2108 EALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIA-GSNPDLKPVQDFFGLAFPGS 2166

Query: 551  DLVETHATQLQYRISGAVSDLGALFRTLESAKTEAGLIVDYSLSQTSLE 599
             L E H   LQY++  ++S L  +F  L  +K     I DYS+SQT+L+
Sbjct: 2167 VLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLH-IEDYSVSQTTLD 2214




cAMP-dependent and sulfonylurea-sensitive anion transporter. Key gatekeeper influencing intracellular cholesterol transport.
Homo sapiens (taxid: 9606)
>sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 Back     alignment and function description
>sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 Back     alignment and function description
>sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=2 SV=3 Back     alignment and function description
>sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 Back     alignment and function description
>sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 Back     alignment and function description
>sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 Back     alignment and function description
>sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 Back     alignment and function description
>sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 Back     alignment and function description
>sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query601
345323749 855 PREDICTED: retinal-specific ATP-binding 0.535 0.376 0.432 8e-77
410043445 1642 PREDICTED: LOW QUALITY PROTEIN: ATP-bind 0.647 0.236 0.365 5e-69
351704781 2749 ATP-binding cassette sub-family A member 0.514 0.112 0.414 1e-63
363743792 2137 PREDICTED: ATP-binding cassette sub-fami 0.417 0.117 0.496 4e-63
326671570 2323 PREDICTED: ATP-binding cassette sub-fami 0.371 0.095 0.526 4e-63
291228183 1821 PREDICTED: ATP-binding cassette transpor 0.404 0.133 0.493 5e-63
427794409 797 Putative lipid exporter abca1, partial [ 0.402 0.303 0.515 6e-63
427784385 2338 Putative lipid exporter abca1 [Rhipiceph 0.402 0.103 0.515 8e-63
390344366 2717 PREDICTED: ATP-binding cassette sub-fami 0.374 0.082 0.513 1e-62
260810768 722 hypothetical protein BRAFLDRAFT_118238 [ 0.420 0.350 0.488 5e-62
>gi|345323749|ref|XP_001511114.2| PREDICTED: retinal-specific ATP-binding cassette transporter-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information
 Score =  294 bits (753), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 171/395 (43%), Positives = 224/395 (56%), Gaps = 73/395 (18%)

Query: 272 AMSFV-PASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLL 330
           AM+FV  A  V+LDEPTSGVDPYSRRSIW+LL+K         GRT+I++TH+MDEAD+L
Sbjct: 426 AMAFVGEAKVVVLDEPTSGVDPYSRRSIWDLLLKYR------PGRTLIMSTHHMDEADML 479

Query: 331 GDRIAIIAAGKLQCCGSSVFLKNSFARGYYLSL--DMKSAPQKSYI-------------- 374
           GD+IAII+ GKL C G+ +FLKN F  G+YL+L   MK+ P    +              
Sbjct: 480 GDQIAIISQGKLYCSGTPLFLKNCFGSGFYLTLVRKMKTVPVPGRLQEVGAGLLGLGGGA 539

Query: 375 -------------------------------GYCPQFDALNDRLTPREHLEFYSRVRNLP 403
                                          GYCPQFDA++D LT REHL  Y+R+R +P
Sbjct: 540 LGSRRAIPAWKPDLSTLSSVLTHISDVHQATGYCPQFDAIDDLLTGREHLHLYARLRGVP 599

Query: 404 S---VLLNTIVNESLNKFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFL------ 454
                ++     ES   + LG ++D    T SGG KRKLSTAIAL+G  PL+ L      
Sbjct: 600 MEEIAMVRGWQTESFRAWGLGLHADHLAGTYSGGTKRKLSTAIALVGCPPLVLLIRAPTT 659

Query: 455 DEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSA 514
           DEPT+GMDP +RR LW  I   + EGR V+LTSH+MEECEALCT+L IMV G F CLG+ 
Sbjct: 660 DEPTTGMDPLSRRLLWNTIVNIIREGRAVVLTSHSMEECEALCTRLAIMVKGTFQCLGTI 719

Query: 515 THLKSKYGQGYSVKVRCAEGRSA------DAQTYLSLNLPVADLVETHATQLQYRI---S 565
            HLK ++G GY V ++    +          + +L  + P +   E H   LQY+I   S
Sbjct: 720 QHLKRRFGDGYVVTMKIKPPKPGLLPDLNPVEQFLQTHFPGSIQTERHYNTLQYQISSSS 779

Query: 566 GAVSDLGALFRTLESAKTEAGLIVDYSLSQTSLED 600
            + S L  +F+ L S K     I +YSL+QT+L+ 
Sbjct: 780 SSSSSLARIFQLLISNKDSLN-IEEYSLTQTTLDQ 813




Source: Ornithorhynchus anatinus

Species: Ornithorhynchus anatinus

Genus: Ornithorhynchus

Family: Ornithorhynchidae

Order: Monotremata

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|410043445|ref|XP_003951616.1| PREDICTED: LOW QUALITY PROTEIN: ATP-binding cassette sub-family A member 2, partial [Pan troglodytes] Back     alignment and taxonomy information
>gi|351704781|gb|EHB07700.1| ATP-binding cassette sub-family A member 2 [Heterocephalus glaber] Back     alignment and taxonomy information
>gi|363743792|ref|XP_001233948.2| PREDICTED: ATP-binding cassette sub-family A member 1-like [Gallus gallus] Back     alignment and taxonomy information
>gi|326671570|ref|XP_001920862.3| PREDICTED: ATP-binding cassette sub-family A member 1 [Danio rerio] Back     alignment and taxonomy information
>gi|291228183|ref|XP_002734059.1| PREDICTED: ATP-binding cassette transporter subfamily A-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|427794409|gb|JAA62656.1| Putative lipid exporter abca1, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427784385|gb|JAA57644.1| Putative lipid exporter abca1 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|390344366|ref|XP_003726106.1| PREDICTED: ATP-binding cassette sub-family A member 1-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|260810768|ref|XP_002600120.1| hypothetical protein BRAFLDRAFT_118238 [Branchiostoma floridae] gi|229285406|gb|EEN56132.1| hypothetical protein BRAFLDRAFT_118238 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query601
ZFIN|ZDB-GENE-031006-122268 abca1a "ATP-binding cassette, 0.374 0.099 0.5 3.5e-112
ZFIN|ZDB-GENE-030131-98262282 abca1b "ATP-binding cassette, 0.415 0.109 0.472 8.4e-111
UNIPROTKB|O954772261 ABCA1 "ATP-binding cassette su 0.372 0.099 0.493 8.3e-109
UNIPROTKB|F1MG242261 ABCA1 "Uncharacterized protein 0.372 0.099 0.489 1.1e-108
RGD|6313442201 Abca1 "ATP-binding cassette, s 0.372 0.101 0.497 1.9e-108
MGI|MGI:996072261 Abca1 "ATP-binding cassette, s 0.372 0.099 0.493 5.7e-108
UNIPROTKB|E2QUX22262 ABCA1 "Uncharacterized protein 0.372 0.099 0.497 7.3e-108
UNIPROTKB|F1LNL32258 Abca1 "Protein Abca1" [Rattus 0.372 0.099 0.497 8.1e-107
UNIPROTKB|F1LRX92258 Abca1 "Protein Abca1" [Rattus 0.372 0.099 0.497 8.1e-107
ZFIN|ZDB-GENE-050517-42350 abca4b "ATP-binding cassette, 0.394 0.100 0.467 1.1e-106
ZFIN|ZDB-GENE-031006-12 abca1a "ATP-binding cassette, sub-family A (ABC1), member 1A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 594 (214.2 bits), Expect = 3.5e-112, Sum P(3) = 3.5e-112
 Identities = 114/228 (50%), Positives = 155/228 (67%)

Query:   374 IGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRTLSG 433
             +GYCPQFDA+ND LT REHLEFY+ +R +P   +  + +  + K  L  Y D+   + SG
Sbjct:  1995 MGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSG 2054

Query:   434 GNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEEC 493
             GN RKLSTA+AL+G  P++FLDEPT+GMDP ARR LW CI   + EGR V+LTSH+MEEC
Sbjct:  2055 GNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRSVVLTSHSMEEC 2114

Query:   494 EALCTKLTIMVNGQFTCLGSATHLKSKYGQGYSVKVRCA--EGRSADAQTYLSLNLPVAD 551
             EALCT++ IMVNG+F CLGS  HLK+K+G GY++ +R A  + R      ++   LP + 
Sbjct:  2115 EALCTRMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRVAGADPRLEPVMEFIERELPGST 2174

Query:   552 LVETHATQLQYRISGAVSDLGALFRTLESAKTEAGLIVDYSLSQTSLE 599
             L E H   LQY++S +++ L  +F  L   K +   I DYS+SQT+L+
Sbjct:  2175 LKEKHRNMLQYQLSSSLTSLARIFNILSKNKEQLH-IEDYSVSQTTLD 2221


GO:0016887 "ATPase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
ZFIN|ZDB-GENE-030131-9826 abca1b "ATP-binding cassette, sub-family A (ABC1), member 1B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O95477 ABCA1 "ATP-binding cassette sub-family A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG24 ABCA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|631344 Abca1 "ATP-binding cassette, subfamily A (ABC1), member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:99607 Abca1 "ATP-binding cassette, sub-family A (ABC1), member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUX2 ABCA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1LNL3 Abca1 "Protein Abca1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRX9 Abca1 "Protein Abca1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050517-4 abca4b "ATP-binding cassette, sub-family A (ABC1), member 4b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query601
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 7e-69
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 8e-64
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 2e-44
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 1e-34
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-34
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 4e-32
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 1e-31
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 9e-31
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 4e-29
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 3e-26
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-25
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 4e-25
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 6e-25
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 3e-24
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 5e-24
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 6e-24
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 5e-23
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 7e-23
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 1e-22
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 2e-21
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 2e-21
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 4e-20
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 5e-20
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 3e-19
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 5e-19
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 5e-19
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 3e-17
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 8e-17
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 8e-17
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-16
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-16
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 1e-15
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-15
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 2e-15
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 3e-15
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 4e-15
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 9e-15
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 1e-14
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 1e-14
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-14
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-14
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 4e-14
cd03234226 cd03234, ABCG_White, White pigment protein homolog 4e-14
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 5e-14
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 5e-14
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 7e-14
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 2e-13
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 2e-13
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 7e-13
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 1e-12
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 2e-12
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 2e-12
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-12
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 3e-12
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 3e-12
COG4133209 COG4133, CcmA, ABC-type transport system involved 4e-12
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 7e-12
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 1e-11
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 1e-11
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 1e-11
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 1e-11
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 2e-11
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 2e-11
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 2e-11
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-11
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 2e-11
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-11
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 2e-11
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 2e-11
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 3e-11
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 3e-11
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 3e-11
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 4e-11
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 4e-11
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 6e-11
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 7e-11
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 8e-11
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 9e-11
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 9e-11
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 1e-10
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 1e-10
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-10
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 2e-10
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 2e-10
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 3e-10
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 3e-10
COG4525259 COG4525, TauB, ABC-type taurine transport system, 4e-10
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 4e-10
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 5e-10
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 5e-10
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 9e-10
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 1e-09
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 1e-09
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 1e-09
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 1e-09
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 2e-09
COG4987573 COG4987, CydC, ABC-type transport system involved 2e-09
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 2e-09
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-09
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 3e-09
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 3e-09
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 3e-09
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 3e-09
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 3e-09
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 5e-09
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 6e-09
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 7e-09
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 8e-09
COG0488530 COG0488, Uup, ATPase components of ABC transporter 9e-09
COG4148352 COG4148, ModC, ABC-type molybdate transport system 1e-08
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 1e-08
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 1e-08
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 2e-08
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-08
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 2e-08
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 3e-08
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 3e-08
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 3e-08
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 3e-08
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 3e-08
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 3e-08
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 3e-08
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 3e-08
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 4e-08
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 4e-08
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 4e-08
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 5e-08
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 5e-08
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 5e-08
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 6e-08
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 6e-08
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 7e-08
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 8e-08
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 8e-08
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 9e-08
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-07
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 1e-07
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 1e-07
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 1e-07
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 1e-07
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-07
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 1e-07
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 1e-07
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 1e-07
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-07
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-07
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 2e-07
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 2e-07
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 2e-07
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 2e-07
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 2e-07
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 2e-07
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-07
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-07
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 2e-07
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 2e-07
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 2e-07
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-07
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 2e-07
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 3e-07
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 3e-07
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 3e-07
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 3e-07
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 3e-07
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 3e-07
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 3e-07
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 3e-07
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 3e-07
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 3e-07
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 3e-07
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 4e-07
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 4e-07
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 4e-07
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 5e-07
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 6e-07
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 6e-07
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 6e-07
pfam13304256 pfam13304, AAA_21, AAA domain 6e-07
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 6e-07
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 7e-07
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 7e-07
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 7e-07
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 8e-07
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 8e-07
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 8e-07
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 9e-07
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 9e-07
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 9e-07
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-06
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 1e-06
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 1e-06
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 1e-06
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 1e-06
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 1e-06
COG4988559 COG4988, CydD, ABC-type transport system involved 1e-06
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 1e-06
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 1e-06
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-06
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 2e-06
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 2e-06
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 2e-06
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 2e-06
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-06
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 2e-06
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-06
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-06
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 2e-06
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 2e-06
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 2e-06
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-06
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 3e-06
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 3e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 3e-06
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 4e-06
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 4e-06
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 4e-06
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 4e-06
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 4e-06
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 5e-06
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 5e-06
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 5e-06
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 5e-06
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 6e-06
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 6e-06
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 6e-06
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 6e-06
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 7e-06
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 7e-06
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 7e-06
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 8e-06
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 8e-06
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 8e-06
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 9e-06
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 9e-06
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 9e-06
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 9e-06
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 9e-06
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 1e-05
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 1e-05
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-05
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 1e-05
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 1e-05
COG1123539 COG1123, COG1123, ATPase components of various ABC 1e-05
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 1e-05
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 1e-05
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 1e-05
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 1e-05
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 1e-05
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-05
cd03240204 cd03240, ABC_Rad50, ATP-binding cassette domain of 1e-05
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 1e-05
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-05
COG4525259 COG4525, TauB, ABC-type taurine transport system, 2e-05
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 2e-05
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 2e-05
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside t 2e-05
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 2e-05
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 2e-05
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 2e-05
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 2e-05
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 2e-05
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 3e-05
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 3e-05
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 3e-05
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 3e-05
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 3e-05
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 3e-05
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 3e-05
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 3e-05
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 3e-05
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 3e-05
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 3e-05
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 4e-05
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 4e-05
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 4e-05
pfam13304256 pfam13304, AAA_21, AAA domain 4e-05
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 4e-05
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 4e-05
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 4e-05
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 5e-05
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 5e-05
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 5e-05
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 6e-05
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 6e-05
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 6e-05
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provision 6e-05
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 6e-05
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 7e-05
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 7e-05
COG1117253 COG1117, PstB, ABC-type phosphate transport system 7e-05
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 8e-05
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 8e-05
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 8e-05
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 8e-05
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 8e-05
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 9e-05
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 1e-04
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 1e-04
COG4987573 COG4987, CydC, ABC-type transport system involved 1e-04
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 1e-04
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 1e-04
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 1e-04
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 1e-04
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 1e-04
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 1e-04
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 1e-04
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 1e-04
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 1e-04
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 1e-04
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 1e-04
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 1e-04
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 1e-04
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 2e-04
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-04
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 2e-04
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 2e-04
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 2e-04
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 2e-04
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 2e-04
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 2e-04
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 2e-04
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 2e-04
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 2e-04
COG4598256 COG4598, HisP, ABC-type histidine transport system 2e-04
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 2e-04
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 2e-04
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 2e-04
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 3e-04
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 3e-04
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP bindi 3e-04
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 3e-04
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 3e-04
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 3e-04
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 3e-04
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 3e-04
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 3e-04
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 3e-04
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 3e-04
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP- 3e-04
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 3e-04
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 3e-04
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 4e-04
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 4e-04
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 4e-04
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 5e-04
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 5e-04
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 5e-04
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 5e-04
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 5e-04
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 5e-04
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 5e-04
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 5e-04
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 6e-04
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 6e-04
COG1117253 COG1117, PstB, ABC-type phosphate transport system 6e-04
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 6e-04
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 6e-04
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 6e-04
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 6e-04
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 7e-04
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 7e-04
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 7e-04
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 7e-04
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 7e-04
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 7e-04
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 7e-04
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 7e-04
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 7e-04
cd03234226 cd03234, ABCG_White, White pigment protein homolog 8e-04
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 8e-04
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 8e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 8e-04
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 8e-04
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 9e-04
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 0.001
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 0.001
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 0.001
COG4988559 COG4988, CydD, ABC-type transport system involved 0.001
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 0.001
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 0.001
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 0.001
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 0.001
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 0.001
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protei 0.001
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 0.001
cd03279213 cd03279, ABC_sbcCD, ATP-binding cassette domain of 0.001
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 0.001
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 0.001
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 0.001
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 0.001
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 0.001
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 0.001
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 0.001
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 0.001
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 0.002
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 0.002
COG4133209 COG4133, CcmA, ABC-type transport system involved 0.002
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 0.002
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 0.002
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 0.002
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 0.002
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 0.002
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 0.002
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 0.002
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 0.002
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 0.002
PRK13546264 PRK13546, PRK13546, teichoic acids export protein 0.002
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 0.002
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 0.003
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 0.003
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 0.003
cd03271261 cd03271, ABC_UvrA_II, ATP-binding cassette domain 0.003
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 0.003
TIGR00630925 TIGR00630, uvra, excinuclease ABC, A subunit 0.003
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 0.003
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 0.004
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 0.004
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 0.004
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 0.004
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 0.004
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 0.004
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide tran 0.004
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 0.004
pfam1355879 pfam13558, SbcCD_C, Putative exonuclease SbcCD, C 0.004
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
 Score =  221 bits (567), Expect = 7e-69
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 3/162 (1%)

Query: 357 RGYYLSLDMKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLN 416
            GY +  D K+A Q   +GYCPQFDAL D LT REHL FY+R++ LP   +   V   L 
Sbjct: 62  NGYSIRTDRKAARQ--SLGYCPQFDALFDELTVREHLRFYARLKGLPKSEIKEEVELLLR 119

Query: 417 KFALGHYSDREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERA 476
              L   +++  RTLSGG KRKLS AIAL+G   ++ LDEPTSG+DP +RR +W  I   
Sbjct: 120 VLGLTDKANKRARTLSGGMKRKLSLAIALIGGPSVLLLDEPTSGLDPASRRAIWDLILE- 178

Query: 477 VSEGRCVILTSHNMEECEALCTKLTIMVNGQFTCLGSATHLK 518
           V +GR +ILT+H+M+E EALC ++ IM +G+  C+GS   LK
Sbjct: 179 VRKGRSIILTTHSMDEAEALCDRIAIMSDGKLRCIGSPQELK 220


The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages. Length = 220

>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|222036 pfam13304, AAA_21, AAA domain Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|222036 pfam13304, AAA_21, AAA domain Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|184128 PRK13541, PRK13541, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|213246 cd03279, ABC_sbcCD, ATP-binding cassette domain of sbcCD Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|184131 PRK13546, PRK13546, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|222219 pfam13558, SbcCD_C, Putative exonuclease SbcCD, C subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 601
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
KOG0055|consensus 1228 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
PTZ002431560 ABC transporter; Provisional 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
KOG0059|consensus885 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
KOG0054|consensus1381 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK00635 1809 excinuclease ABC subunit A; Provisional 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
KOG0927|consensus614 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
KOG0062|consensus582 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4148352 ModC ABC-type molybdate transport system, ATPase c 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG4674249 Uncharacterized ABC-type transport system, ATPase 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; 100.0
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
PLN03211 659 ABC transporter G-25; Provisional 100.0
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
PRK10535 648 macrolide transporter ATP-binding /permease protei 100.0
PRK13545549 tagH teichoic acids export protein ATP-binding sub 100.0
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.98
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.98
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.98
PRK10938490 putative molybdenum transport ATP-binding protein 99.98
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.98
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.98
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.98
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.98
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.98
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.98
COG4619223 ABC-type uncharacterized transport system, ATPase 99.98
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.98
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.98
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.98
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.98
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.98
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.98
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.98
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.98
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.97
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.97
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.97
COG4172534 ABC-type uncharacterized transport system, duplica 99.97
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.97
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.97
COG4586325 ABC-type uncharacterized transport system, ATPase 99.97
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.97
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.97
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.97
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.97
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.97
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.97
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.97
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.97
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.97
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.97
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.97
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.97
PRK13409590 putative ATPase RIL; Provisional 99.97
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.97
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.97
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.97
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.97
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.97
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.97
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.97
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.97
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.97
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.97
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.97
KOG0058|consensus716 99.97
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.97
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.97
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.97
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.97
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.97
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.97
COG4987573 CydC ABC-type transport system involved in cytochr 99.97
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.97
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.97
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.97
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.97
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.97
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.97
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.97
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.97
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.97
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.97
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.97
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.97
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.97
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.97
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.97
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.97
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.97
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.97
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.97
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.97
PRK11147635 ABC transporter ATPase component; Reviewed 99.97
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.97
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.97
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.97
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.97
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.97
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.97
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.97
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.97
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.97
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.97
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
PRK10908222 cell division protein FtsE; Provisional 99.97
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.97
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.97
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.97
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.97
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.97
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.97
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.97
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.97
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.97
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.97
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.97
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.97
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.97
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.97
PLN032321495 ABC transporter C family member; Provisional 99.97
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.97
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.97
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.97
PLN031301622 ABC transporter C family member; Provisional 99.97
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.96
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.96
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.96
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.96
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.96
COG0411250 LivG ABC-type branched-chain amino acid transport 99.96
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.96
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.96
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.96
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.96
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.96
KOG0057|consensus591 99.96
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.96
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.96
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.96
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.96
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.96
PLN03140 1470 ABC transporter G family member; Provisional 99.96
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.96
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.96
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.96
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.96
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.96
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.96
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.96
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.96
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.96
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.96
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.96
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.96
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.96
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.96
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.96
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.96
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.96
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.96
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.96
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.96
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.96
PRK09984262 phosphonate/organophosphate ester transporter subu 99.96
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.96
KOG0065|consensus 1391 99.96
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.96
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.96
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.96
KOG0055|consensus1228 99.96
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.96
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.96
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.96
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.96
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.96
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.96
PTZ002431560 ABC transporter; Provisional 99.96
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.96
PLN03073718 ABC transporter F family; Provisional 99.96
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.96
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.96
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.4e-65  Score=568.77  Aligned_cols=379  Identities=19%  Similarity=0.301  Sum_probs=305.0

Q ss_pred             hhhhcccccccccCCCccceeecceEEeec------ccCCCCCCCccccchhhhHHHhccCCCCCCeeEEEEccccCCCc
Q psy7365          49 VSLFESLSENRDKLGIDSYGISDTSLEEQP------LGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRTD  122 (601)
Q Consensus        49 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~g~~g~~~g~~~~g~~~~~~~~l~Gl~~~~~G~v~~~g~~~~~~  122 (601)
                      ++.+++|++.|++    ..+++|+||++.+      +|||||  |||||      .++|+|+++|++|+|.++|.++...
T Consensus         4 ~i~~~~l~~~~~~----~~~l~~is~~i~~Ge~~~l~G~NGs--GKSTL------l~~l~G~~~p~~G~i~~~g~~~~~~   71 (501)
T PRK10762          4 LLQLKGIDKAFPG----VKALSGAALNVYPGRVMALVGENGA--GKSTM------MKVLTGIYTRDAGSILYLGKEVTFN   71 (501)
T ss_pred             eEEEeeeEEEeCC----eEEeeeeeEEEcCCeEEEEECCCCC--CHHHH------HHHHhCCCCCCCcEEEECCEECCCC
Confidence            3568999999864    4599999999988      999999  56665      6799999999999999999987532


Q ss_pred             -h-HHhcccEEEEccCCCCCCCCCHHHHHHHhHhhc---C-CChHHHHHHHHHHHHHcCCCcccCCccccCChHHHhhhh
Q psy7365         123 -M-TTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLK---Q-VPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLD  196 (601)
Q Consensus       123 -~-~~~~~~ig~v~Q~~~~~~~~tv~e~l~~~~~~~---~-~~~~~~~~~~~~~l~~~gl~~~~~~~~~~LSgG~~qr~~  196 (601)
                       . ...++.+||+||++.+|+.+||+||+.|+...+   + .+..+.++++.++++.+||.+..++++++||||||||++
T Consensus        72 ~~~~~~~~~i~~v~q~~~~~~~~tv~e~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSgG~~qrv~  151 (501)
T PRK10762         72 GPKSSQEAGIGIIHQELNLIPQLTIAENIFLGREFVNRFGRIDWKKMYAEADKLLARLNLRFSSDKLVGELSIGEQQMVE  151 (501)
T ss_pred             CHHHHHhCCEEEEEcchhccCCCcHHHHhhhccccccccCccCHHHHHHHHHHHHHHcCCCCCccCchhhCCHHHHHHHH
Confidence             2 223567999999999999999999999875432   2 334455667889999999999999999999999999998


Q ss_pred             chhhhcchhhHHHHHHHhhhhhhhhHhhcCCCCCCcchhhHHhhcCCcchhhHHHHHHHHhhhcchhHHHHHHHHhhccC
Q psy7365         197 NVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSFV  276 (601)
Q Consensus       197 ~~~~~~~~~~~~a~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~  276 (601)
                      +|+||                                      +.+                                  
T Consensus       152 la~al--------------------------------------~~~----------------------------------  159 (501)
T PRK10762        152 IAKVL--------------------------------------SFE----------------------------------  159 (501)
T ss_pred             HHHHH--------------------------------------hcC----------------------------------
Confidence            65432                                      233                                  


Q ss_pred             CCcEEEEecCCCCCCHHHHHHHHHHHHHHhhhccccCCcEEEEEecchhHHHhcCCEEEEecCCccccccCcccc-----
Q psy7365         277 PASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVFL-----  351 (601)
Q Consensus       277 ~~~~liLDEPtsgLD~~~~~~l~~~l~~l~~~~~~~~G~TVI~~tHdl~~~~~l~Drv~vL~~GkIv~~G~~~lL-----  351 (601)
                       |++|||||||+|||+.++..++++|+++.     ..|+|||++|||++++..+||++++|.+|+++..++...+     
T Consensus       160 -p~lllLDEPt~~LD~~~~~~l~~~l~~l~-----~~~~tvii~sHd~~~~~~~~d~i~~l~~G~i~~~~~~~~~~~~~~  233 (501)
T PRK10762        160 -SKVIIMDEPTDALTDTETESLFRVIRELK-----SQGRGIVYISHRLKEIFEICDDVTVFRDGQFIAEREVADLTEDSL  233 (501)
T ss_pred             -CCEEEEeCCcCCCCHHHHHHHHHHHHHHH-----HCCCEEEEEeCCHHHHHHhCCEEEEEeCCEEEEecCcCcCCHHHH
Confidence             58999999999999999999999999883     3489999999999999999999999999998654322100     


Q ss_pred             ---------c-----------ccc------------------------------c-------------------cccccc
Q psy7365         352 ---------K-----------NSF------------------------------A-------------------RGYYLS  362 (601)
Q Consensus       352 ---------k-----------~~~------------------------------g-------------------~g~~ig  362 (601)
                               .           ...                              |                   ..++.+
T Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~l~~vsl~i~~Ge~~~liG~NGsGKSTLl~~l~G~~~p~~G~I~~~g  313 (501)
T PRK10762        234 IEMMVGRKLEDQYPRLDKAPGEVRLKVDNLSGPGVNDVSFTLRKGEILGVSGLMGAGRTELMKVLYGALPRTSGYVTLDG  313 (501)
T ss_pred             HHHhcCCCccccccccccCCCCcEEEEeCcccCCcccceEEEcCCcEEEEecCCCCCHHHHHHHHhCCCCCCceEEEECC
Confidence                     0           000                              0                   000000


Q ss_pred             cccCCc----ccccccccCCCCc---ccCCCCCHHHHHHHhHH--hc---C-CChhHHHHHHHHHHHHcCCC-ccccccc
Q psy7365         363 LDMKSA----PQKSYIGYCPQFD---ALNDRLTPREHLEFYSR--VR---N-LPSVLLNTIVNESLNKFALG-HYSDREV  428 (601)
Q Consensus       363 ld~~~~----~~~~~ig~v~Q~~---~l~~~lTv~E~L~~~~~--~~---g-~~~~~~~~~~~~lLe~~~L~-~~~~~~~  428 (601)
                      .++...    ..++.+||+||++   .+++.+|+.||+.+...  ..   + ....+.++.++++++.+++. +..++++
T Consensus       314 ~~i~~~~~~~~~~~~i~~v~q~~~~~~~~~~~tv~e~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~  393 (501)
T PRK10762        314 HEVVTRSPQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYFSRAGGSLKHADEQQAVSDFIRLFNIKTPSMEQAI  393 (501)
T ss_pred             EECCCCCHHHHHHCCCEEecCccccCCCcCCCcHHHHhhhhhhhhhcccccccCHHHHHHHHHHHHHhcCCCCCCccCch
Confidence            011100    1134699999996   57888999999986421  11   1 22233445688999999995 6789999


Q ss_pred             CcCChHHHHHHHHHHHHhCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHhCCcEEEEEccChhHHHhhCCEEEEEeCCEE
Q psy7365         429 RTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNMEECEALCTKLTIMVNGQF  508 (601)
Q Consensus       429 ~~LSgGqkQRl~lA~AL~~~P~lLlLDEPTsGLD~~~~~~i~~lL~~l~~~G~tVllsTHdl~e~~~l~drv~iL~~G~i  508 (601)
                      .+|||||||||+||+||+.+|++|||||||+|||+.+++.++++|++++++|.|||++|||++++..+|||+++|++|++
T Consensus       394 ~~LSgGekqrv~lA~al~~~p~lllLDEPt~~LD~~~~~~l~~~l~~~~~~g~tviivtHd~~~~~~~~d~v~~l~~G~i  473 (501)
T PRK10762        394 GLLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKAEGLSIILVSSEMPEVLGMSDRILVMHEGRI  473 (501)
T ss_pred             hhCCHHHHHHHHHHHHHhhCCCEEEEcCCCCCCCHhHHHHHHHHHHHHHHCCCEEEEEcCCHHHHHhhCCEEEEEECCEE
Confidence            99999999999999999999999999999999999999999999999987899999999999999999999999999999


Q ss_pred             EEecCHHHH
Q psy7365         509 TCLGSATHL  517 (601)
Q Consensus       509 v~~G~~~~L  517 (601)
                      +..|+++++
T Consensus       474 ~~~~~~~~~  482 (501)
T PRK10762        474 SGEFTREQA  482 (501)
T ss_pred             EEEeccccC
Confidence            999887654



>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query601
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 6e-14
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 3e-10
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 1e-09
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 2e-09
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 2e-09
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 3e-09
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 3e-08
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 4e-08
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 4e-08
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 3e-07
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 3e-07
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 3e-07
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 5e-07
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 6e-07
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 7e-07
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 9e-07
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 1e-06
3tui_C366 Inward Facing Conformations Of The Metni Methionine 1e-06
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 2e-06
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 2e-06
1g29_1372 Malk Length = 372 2e-06
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 3e-06
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 3e-06
1yqt_A 538 Rnase-L Inhibitor Length = 538 3e-06
3bk7_A 607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 5e-06
3j15_B 593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 5e-06
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 6e-06
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 7e-06
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 1e-05
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 1e-05
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 3e-05
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 3e-05
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-05
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 5e-05
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 5e-05
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 8e-05
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 8e-05
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 1e-04
3qku_A359 Mre11 Rad50 Binding Domain In Complex With Rad50 An 2e-04
3qkt_A339 Rad50 Abc-Atpase With Adjacent Coiled-Coil Region I 2e-04
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 2e-04
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 2e-04
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 3e-04
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 3e-04
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 3e-04
1ii8_B174 Crystal Structure Of The P. Furiosus Rad50 Atpase D 4e-04
3qkr_B179 Mre11 Rad50 Binding Domain Bound To Rad50 Length = 4e-04
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 4e-04
3ozx_A538 Crystal Structure Of Abce1 Of Sulfolubus Solfataric 4e-04
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 5e-04
1f2t_B148 Crystal Structure Of Atp-free Rad50 Abc-atpase Leng 5e-04
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 8e-04
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 9e-04
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 51/168 (30%), Positives = 79/168 (47%), Gaps = 5/168 (2%) Query: 371 KSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRT 430 + I Y P+ + E+L F + S + +V + LG V T Sbjct: 87 RKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVST 146 Query: 431 LSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNM 490 S G RKL A AL+ N L LDEPTSG+D R + +++A EG ++++SHNM Sbjct: 147 YSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNM 206 Query: 491 EECEALCTKLTIMVNGQFTCLGSATHLKSKYG-----QGYSVKVRCAE 533 E E LC ++ ++ NG G+ LK +Y + + V+C+E Sbjct: 207 LEVEFLCDRIALIHNGTIVETGTVEELKERYKAQNIEEVFEEVVKCSE 254
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|3QKU|A Chain A, Mre11 Rad50 Binding Domain In Complex With Rad50 And Amp-Pnp Length = 359 Back     alignment and structure
>pdb|3QKT|A Chain A, Rad50 Abc-Atpase With Adjacent Coiled-Coil Region In Complex With Amp- Pnp Length = 339 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|1II8|B Chain B, Crystal Structure Of The P. Furiosus Rad50 Atpase Domain Length = 174 Back     alignment and structure
>pdb|3QKR|B Chain B, Mre11 Rad50 Binding Domain Bound To Rad50 Length = 179 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3OZX|A Chain A, Crystal Structure Of Abce1 Of Sulfolubus Solfataricus (-Fes Domain) Length = 538 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|1F2T|B Chain B, Crystal Structure Of Atp-free Rad50 Abc-atpase Length = 148 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query601
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 4e-47
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 6e-22
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 2e-21
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-32
1sgw_A214 Putative ABC transporter; structural genomics, P p 2e-16
1sgw_A214 Putative ABC transporter; structural genomics, P p 9e-15
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-21
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-12
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 3e-08
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 3e-15
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-13
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 4e-15
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 3e-14
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 2e-14
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 2e-08
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 6e-05
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 2e-04
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-14
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-08
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 3e-14
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 6e-11
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 2e-04
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 6e-04
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-13
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 1e-06
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 5e-13
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-11
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-08
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 2e-11
1g6h_A257 High-affinity branched-chain amino acid transport 2e-11
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 2e-10
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 6e-10
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-05
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 2e-08
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 1e-06
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 2e-05
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 8e-05
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 1e-04
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 3e-04
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 9e-04
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score =  165 bits (419), Expect = 4e-47
 Identities = 48/154 (31%), Positives = 72/154 (46%)

Query: 371 KSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRT 430
           +  I Y P+       +   E+L F +      S  +  +V  +     LG      V T
Sbjct: 87  RKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVST 146

Query: 431 LSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVILTSHNM 490
            S G  RKL  A AL+ N  L  LDEPTSG+D    R +   +++A  EG  ++++SHNM
Sbjct: 147 YSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNM 206

Query: 491 EECEALCTKLTIMVNGQFTCLGSATHLKSKYGQG 524
            E E LC ++ ++ NG     G+   LK +Y   
Sbjct: 207 LEVEFLCDRIALIHNGTIVETGTVEELKERYKAQ 240


>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query601
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 100.0
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 100.0
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 100.0
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 100.0
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 100.0
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 100.0
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 100.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 100.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 100.0
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 100.0
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 100.0
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 100.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 100.0
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.98
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.98
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.98
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.97
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.97
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.97
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.97
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.97
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.97
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.97
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.97
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.97
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.97
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.96
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.96
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.96
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.96
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.96
2ghi_A260 Transport protein; multidrug resistance protein, M 99.96
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 99.96
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.95
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.95
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.95
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.95
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.94
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.94
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.94
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.94
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.94
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.93
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.91
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.91
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.91
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.9
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.89
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.88
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.83
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.82
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.8
1e69_A322 Chromosome segregation SMC protein; structural mai 99.8
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.79
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.79
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.77
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.76
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.75
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.74
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.74
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.71
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.7
2og2_A359 Putative signal recognition particle receptor; nuc 99.7
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.66
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.66
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.65
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.64
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.63
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.63
1e69_A322 Chromosome segregation SMC protein; structural mai 99.63
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.62
3kta_B173 Chromosome segregation protein SMC; structural mai 99.61
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.6
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.59
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.56
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.54
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.53
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.53
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.53
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.53
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.51
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.5
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.5
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.5
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.48
3kta_B173 Chromosome segregation protein SMC; structural mai 99.47
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.46
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.46
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.45
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.44
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.43
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.39
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.39
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.37
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.37
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.37
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.35
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.31
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.3
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.27
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.27
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.25
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.24
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.23
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.2
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.2
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.17
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.17
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.16
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.15
2og2_A359 Putative signal recognition particle receptor; nuc 99.14
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.14
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.12
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.09
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 99.09
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.09
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.08
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.08
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.07
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.06
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.05
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.04
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.01
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.01
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 98.98
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.97
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 98.92
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 98.91
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.86
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.86
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.85
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.84
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.84
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.84
2oap_1511 GSPE-2, type II secretion system protein; hexameri 98.84
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.83
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.83
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.83
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 98.83
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.83
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.82
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.78
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.77
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.77
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 98.77
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.76
1p9r_A418 General secretion pathway protein E; bacterial typ 98.71
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.69
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.68
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.68
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.65
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.62
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.62
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.59
2ewv_A372 Twitching motility protein PILT; pilus retraction 98.58
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.56
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.52
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 98.5
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.41
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.39
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.36
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.35
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.32
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.29
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.29
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.24
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.23
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 98.2
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.19
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.18
2eyu_A261 Twitching motility protein PILT; pilus retraction 98.14
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.12
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.11
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.08
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.07
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.02
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.01
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.97
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.97
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 97.87
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.85
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.84
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.81
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.71
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.68
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 97.68
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.66
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 97.6
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.6
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 97.56
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.51
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.51
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.5
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.44
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 97.42
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.25
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.24
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.2
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.12
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.1
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.09
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.06
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 96.99
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 96.96
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.95
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.93
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.93
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.9
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.86
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.72
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.66
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.63
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 96.38
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.32
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.28
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.18
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.11
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.05
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.97
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 95.88
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 95.82
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 95.81
2oap_1511 GSPE-2, type II secretion system protein; hexameri 95.77
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.64
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.59
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.54
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 95.51
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.47
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 95.16
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.1
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 94.97
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 94.9
3kta_A182 Chromosome segregation protein SMC; structural mai 94.82
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.81
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.73
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 94.7
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.65
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 94.53
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 94.39
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.35
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 94.04
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.03
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 94.02
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.86
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 93.64
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 93.48
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 93.35
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 93.34
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 92.08
1vma_A306 Cell division protein FTSY; TM0570, structural gen 91.95
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 91.27
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 91.12
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 91.1
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.86
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 90.81
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 90.11
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 89.96
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 89.85
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 89.75
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 89.33
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 89.18
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 89.1
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 88.4
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 87.57
1p9r_A418 General secretion pathway protein E; bacterial typ 87.39
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 86.81
2z43_A324 DNA repair and recombination protein RADA; archaea 86.78
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 86.74
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 86.68
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 86.51
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 86.26
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 86.19
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 85.88
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 85.19
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 82.91
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 82.45
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 82.14
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 81.91
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 80.99
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 80.54
2www_A349 Methylmalonic aciduria type A protein, mitochondri 80.51
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
Probab=100.00  E-value=1.3e-58  Score=516.83  Aligned_cols=364  Identities=19%  Similarity=0.237  Sum_probs=276.7

Q ss_pred             cccccccccCCCccceeecceEEeec------ccCCCCCCCccccchhhhHHHhccCCCCCCeeEE---------EEccc
Q psy7365          53 ESLSENRDKLGIDSYGISDTSLEEQP------LGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTA---------KIYDH  117 (601)
Q Consensus        53 ~~~~~~~~~~~~~~~~~~~~~~~~~~------~g~~g~~~g~~~~g~~~~~~~~l~Gl~~~~~G~v---------~~~g~  117 (601)
                      +||+|.|++.   ..+++|+| ++.+      +|||||  |||||      .++|+|+++|++|++         .++|.
T Consensus        25 ~~ls~~yg~~---~~~l~~vs-~i~~Ge~~~LvG~NGa--GKSTL------lk~l~Gl~~p~~G~~~~~~~~~~~~~~g~   92 (538)
T 1yqt_A           25 EDCVHRYGVN---AFVLYRLP-VVKEGMVVGIVGPNGT--GKSTA------VKILAGQLIPNLCGDNDSWDGVIRAFRGN   92 (538)
T ss_dssp             CCEEEECSTT---CCEEECCC-CCCTTSEEEEECCTTS--SHHHH------HHHHHTSSCCCTTTTCCSHHHHHHHTTTS
T ss_pred             cCcEEEECCc---cccccCcC-cCCCCCEEEEECCCCC--CHHHH------HHHHhCCCCCCCCccCcchhhhHHhhCCc
Confidence            6899998642   24899999 8877      999999  56665      579999999999995         34565


Q ss_pred             cCCCch---HHhcccEEEEccCCCCCCC---CCHHHHHHHhHhhcCCChHHHHHHHHHHHHHcCCCcccCCccccCChHH
Q psy7365         118 DIRTDM---TTIRRSLGVCPQYNALFDK---LTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGM  191 (601)
Q Consensus       118 ~~~~~~---~~~~~~ig~v~Q~~~~~~~---~tv~e~l~~~~~~~~~~~~~~~~~~~~~l~~~gl~~~~~~~~~~LSgG~  191 (601)
                      ++....   ...+..+++++|+..+++.   .|+.|++...         +..+++.++++.+|+.+..++++.+|||||
T Consensus        93 ~~~~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~v~e~~~~~---------~~~~~~~~~l~~lgl~~~~~~~~~~LSgGe  163 (538)
T 1yqt_A           93 ELQNYFEKLKNGEIRPVVKPQYVDLIPKAVKGKVIELLKKA---------DETGKLEEVVKALELENVLEREIQHLSGGE  163 (538)
T ss_dssp             THHHHHHHHHTTSCCCEEECSCGGGSGGGCCSBHHHHHHHH---------CSSSCHHHHHHHTTCTTTTTSBGGGCCHHH
T ss_pred             cHHHHHHHHHHHhhhhhhhhhhhhhcchhhhccHHHHHhhh---------hHHHHHHHHHHHcCCChhhhCChhhCCHHH
Confidence            542111   1123468999998654332   3898887531         112357889999999999999999999999


Q ss_pred             HhhhhchhhhcchhhHHHHHHHhhhhhhhhHhhcCCCCCCcchhhHHhhcCCcchhhHHHHHHHHhhhcchhHHHHHHHH
Q psy7365         192 QRKLDNVKVWFNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLF  271 (601)
Q Consensus       192 ~qr~~~~~~~~~~~~~~a~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~a~~~~~  271 (601)
                      ||||+|||||                                      +.+                             
T Consensus       164 kQRv~iAraL--------------------------------------~~~-----------------------------  176 (538)
T 1yqt_A          164 LQRVAIAAAL--------------------------------------LRN-----------------------------  176 (538)
T ss_dssp             HHHHHHHHHH--------------------------------------HSC-----------------------------
T ss_pred             HHHHHHHHHH--------------------------------------hcC-----------------------------
Confidence            9999865433                                      233                             


Q ss_pred             hhccCCCcEEEEecCCCCCCHHHHHHHHHHHHHHhhhccccCCcEEEEEecchhHHHhcCCEEEEecCCccccc------
Q psy7365         272 AMSFVPASTVILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCC------  345 (601)
Q Consensus       272 ~~~~~~~~~liLDEPtsgLD~~~~~~l~~~l~~l~~~~~~~~G~TVI~~tHdl~~~~~l~Drv~vL~~GkIv~~------  345 (601)
                            |++|||||||++||+.++..++++|+++.     ..|+|||++|||++++..+|||+++|.+|.....      
T Consensus       177 ------P~lLlLDEPTs~LD~~~~~~l~~~L~~l~-----~~g~tvi~vsHd~~~~~~~~dri~vl~~~~~~~~~~~~~~  245 (538)
T 1yqt_A          177 ------ATFYFFDEPSSYLDIRQRLNAARAIRRLS-----EEGKSVLVVEHDLAVLDYLSDIIHVVYGEPGVYGIFSQPK  245 (538)
T ss_dssp             ------CSEEEEESTTTTCCHHHHHHHHHHHHHHH-----HTTCEEEEECSCHHHHHHHCSEEEEEEEETTTEEEECCCE
T ss_pred             ------CCEEEEECCcccCCHHHHHHHHHHHHHHH-----hcCCEEEEEeCCHHHHHHhCCEEEEEcCcccccccccchh
Confidence                  58999999999999999999999999983     2589999999999999999999999975421100      


Q ss_pred             -----------c-----------C-------c--------ccc--cc---ccc------------cccc---cccccC--
Q psy7365         346 -----------G-----------S-------S--------VFL--KN---SFA------------RGYY---LSLDMK--  366 (601)
Q Consensus       346 -----------G-----------~-------~--------~lL--k~---~~g------------~g~~---igld~~--  366 (601)
                                 +           .       .        ..+  ++   .++            .|..   +|.++.  
T Consensus       246 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~l~~~~~~i~~Ge~~~i~G~NGsGK  325 (538)
T 1yqt_A          246 GTRNGINEFLRGYLKDENVRFRPYEIKFTKTGERVEIERETLVTYPRLVKDYGSFRLEVEPGEIKKGEVIGIVGPNGIGK  325 (538)
T ss_dssp             EHHHHHHHHHHTEETTTTEECSSSCCCCCCSSGGGSSCCCEEEEECCEEEEETTEEEEECCEEEETTCEEEEECCTTSSH
T ss_pred             hHHHHHHHHhhhccchhhhcccccccccccCCcccccCCCeEEEEeeEEEEECCEEEEeCccccCCCCEEEEECCCCCCH
Confidence                       0           0       0        000  00   000            0000   010100  


Q ss_pred             ------------C----cccccccccCCCCcccCCCCCHHHHHHHhHHhcCCChhHHHHHHHHHHHHcCCCcccccccCc
Q psy7365         367 ------------S----APQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYSDREVRT  430 (601)
Q Consensus       367 ------------~----~~~~~~ig~v~Q~~~l~~~lTv~E~L~~~~~~~g~~~~~~~~~~~~lLe~~~L~~~~~~~~~~  430 (601)
                                  .    .....++||+||++..++.+||.|++...... ...   ..+.++++++.+++.+..++++.+
T Consensus       326 STLlk~l~Gl~~p~~G~i~~~~~i~~v~Q~~~~~~~~tv~~~~~~~~~~-~~~---~~~~~~~~l~~~~l~~~~~~~~~~  401 (538)
T 1yqt_A          326 TTFVKMLAGVEEPTEGKIEWDLTVAYKPQYIKADYEGTVYELLSKIDAS-KLN---SNFYKTELLKPLGIIDLYDREVNE  401 (538)
T ss_dssp             HHHHHHHHTSSCCSBCCCCCCCCEEEECSSCCCCCSSBHHHHHHHHHHH-HHT---CHHHHHHTTTTTTCGGGTTSBGGG
T ss_pred             HHHHHHHhCCCCCCCeEEEECceEEEEecCCcCCCCCcHHHHHHhhhcc-CCC---HHHHHHHHHHHcCChhhhcCChhh
Confidence                        0    00134689999998877889998887653111 111   134578899999999899999999


Q ss_pred             CChHHHHHHHHHHHHhCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHh-CCcEEEEEccChhHHHhhCCEEEEEeC--CE
Q psy7365         431 LSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVS-EGRCVILTSHNMEECEALCTKLTIMVN--GQ  507 (601)
Q Consensus       431 LSgGqkQRl~lA~AL~~~P~lLlLDEPTsGLD~~~~~~i~~lL~~l~~-~G~tVllsTHdl~e~~~l~drv~iL~~--G~  507 (601)
                      |||||||||+||+||+.+|++|||||||+|||+.++..++++|+++++ .|+|||++|||++++..+||||++|++  |+
T Consensus       402 LSGGe~qrv~lAraL~~~p~lLlLDEPt~~LD~~~~~~i~~~l~~l~~~~g~tvi~vsHd~~~~~~~~drv~vl~~~~~~  481 (538)
T 1yqt_A          402 LSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRLMVFEGEPGK  481 (538)
T ss_dssp             CCHHHHHHHHHHHHHTSCCSEEEEECTTTTCCHHHHHHHHHHHHHHHHHHTCEEEEECSCHHHHHHHCSEEEEEEEETTT
T ss_pred             CCHHHHHHHHHHHHHHhCCCEEEEeCCcccCCHHHHHHHHHHHHHHHHhCCCEEEEEeCCHHHHHHhCCEEEEEeCCcce
Confidence            999999999999999999999999999999999999999999999864 599999999999999999999999986  78


Q ss_pred             EEEecCHHHHHH
Q psy7365         508 FTCLGSATHLKS  519 (601)
Q Consensus       508 iv~~G~~~~L~~  519 (601)
                      +.+.|+|+++..
T Consensus       482 ~~~~g~~~~~~~  493 (538)
T 1yqt_A          482 YGRALPPMGMRE  493 (538)
T ss_dssp             EEEECCCEEHHH
T ss_pred             EeecCCHHHHHh
Confidence            889999988764



>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 601
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 4e-31
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 2e-13
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 2e-12
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 3e-29
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 8e-15
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 9e-15
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 2e-24
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 9e-15
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 2e-10
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 3e-24
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 3e-11
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 7e-06
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 7e-24
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 4e-12
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 5e-09
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 5e-23
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 2e-09
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 6e-08
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-22
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-12
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 8e-06
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 7e-22
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 6e-10
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 6e-08
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 3e-19
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 4e-10
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 3e-09
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 5e-19
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-11
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-06
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 7e-18
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 6e-09
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 4e-17
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 2e-11
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 3e-05
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 8e-17
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-09
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 6e-08
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 1e-16
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 7e-10
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 3e-15
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 3e-11
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 2e-07
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-12
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-08
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 7e-05
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 2e-12
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-08
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-11
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 3e-06
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 5e-05
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 2e-11
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 1e-07
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 1e-05
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-09
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 7e-07
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 6e-05
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 2e-09
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-05
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 8e-08
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-06
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 3e-04
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 4e-04
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter TM0544
species: Thermotoga maritima [TaxId: 2336]
 Score =  119 bits (299), Expect = 4e-31
 Identities = 48/158 (30%), Positives = 73/158 (46%)

Query: 365 MKSAPQKSYIGYCPQFDALNDRLTPREHLEFYSRVRNLPSVLLNTIVNESLNKFALGHYS 424
            +    +  I Y P+       +   E+L F +      S  +  +V  +     LG   
Sbjct: 68  EEPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKI 127

Query: 425 DREVRTLSGGNKRKLSTAIALLGNTPLIFLDEPTSGMDPGARRFLWTCIERAVSEGRCVI 484
              V T S G  RKL  A AL+ N  L  LDEPTSG+D    R +   +++A  EG  ++
Sbjct: 128 KDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTIL 187

Query: 485 LTSHNMEECEALCTKLTIMVNGQFTCLGSATHLKSKYG 522
           ++SHNM E E LC ++ ++ NG     G+   LK +Y 
Sbjct: 188 VSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERYK 225


>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query601
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.97
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.97
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.97
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.97
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.97
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.97
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.96
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.93
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.58
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.32
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.27
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.06
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.92
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.75
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.53
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.24
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.05
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 97.69
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.94
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.3
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.51
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.25
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.01
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 91.83
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 80.78
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00  E-value=1.2e-51  Score=411.45  Aligned_cols=213  Identities=25%  Similarity=0.310  Sum_probs=182.3

Q ss_pred             hhhhhcccccccccCCCccceeecceEEeec------ccCCCCCCCccccchhhhHHHhccCCCCCCeeEEEEccccCCC
Q psy7365          48 YVSLFESLSENRDKLGIDSYGISDTSLEEQP------LGPSGITLGLHTLGLEFVSRSMLMGMLPVSSGTAKIYDHDIRT  121 (601)
Q Consensus        48 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~g~~g~~~g~~~~g~~~~~~~~l~Gl~~~~~G~v~~~g~~~~~  121 (601)
                      ..+.++||+|.||+    ..||+|+||++.+      +|||||  |||||      .++|+|+++|++|+|.++|+++..
T Consensus         5 ~~I~v~nlsk~yg~----~~al~~vsl~v~~Ge~~~liGpsGa--GKSTL------l~~i~Gl~~p~sG~I~i~g~~i~~   72 (239)
T d1v43a3           5 VEVKLENLTKRFGN----FTAVNKLNLTIKDGEFLVLLGPSGC--GKTTT------LRMIAGLEEPTEGRIYFGDRDVTY   72 (239)
T ss_dssp             CCEEEEEEEEEETT----EEEEEEEEEEECTTCEEEEECCTTS--SHHHH------HHHHHTSSCCSEEEEEETTEECTT
T ss_pred             CeEEEEEEEEEECC----EEEEcceeEEECCCCEEEEECCCCC--hHHHH------HHHHHcCCCCCCCEEEEcceeccc
Confidence            34669999999974    5699999999988      999999  56654      579999999999999999999965


Q ss_pred             chHHhcccEEEEccCCCCCCCCCHHHHHHHhHhhcCCChHHHHHHHHHHHHHcCCCcccCCccccCChHHHhhhhchhhh
Q psy7365         122 DMTTIRRSLGVCPQYNALFDKLTVEEHMWFYSQLKQVPKDLAQLEISNMIGDLGIPHKRTSLANTLSGGMQRKLDNVKVW  201 (601)
Q Consensus       122 ~~~~~~~~ig~v~Q~~~~~~~~tv~e~l~~~~~~~~~~~~~~~~~~~~~l~~~gl~~~~~~~~~~LSgG~~qr~~~~~~~  201 (601)
                      ... .+++||||||++.+|+++||+||++|++..++++++++++++.++++.+||++.+++++++|||||||||+|||||
T Consensus        73 ~~~-~~r~ig~v~Q~~~l~~~ltv~enl~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGq~QRvaiAraL  151 (239)
T d1v43a3          73 LPP-KDRNISMVFQSYAVWPHMTVYENIAFPLKIKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAI  151 (239)
T ss_dssp             SCG-GGGTEEEEEC------CCCHHHHHHTTCC--CCCHHHHHHHHHHHHHHTTCGGGTTSCTTTCCSSCHHHHHHHHHH
T ss_pred             CCc-ccceEEEEeechhhcccchHHHHHHHHHHHcCCCHHHHHHHHHHHHHHcCChhhhcCChhhCCHHHHHHHHHHhhh
Confidence            332 3568999999999999999999999999999999999999999999999999999999999999999999865543


Q ss_pred             cchhhHHHHHHHhhhhhhhhHhhcCCCCCCcchhhHHhhcCCcchhhHHHHHHHHhhhcchhHHHHHHHHhhccCCCcEE
Q psy7365         202 FNNKAWIAAVSFMNAANNVILRASLPSNVSRDDYAIVAINHPMNLTHKQMALETLKKAGTSILVAVTVLFAMSFVPASTV  281 (601)
Q Consensus       202 ~~~~~~~a~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~l  281 (601)
                                                            +++                                   |++|
T Consensus       152 --------------------------------------~~~-----------------------------------P~iL  158 (239)
T d1v43a3         152 --------------------------------------VVE-----------------------------------PDVL  158 (239)
T ss_dssp             --------------------------------------TTC-----------------------------------CSEE
T ss_pred             --------------------------------------ccC-----------------------------------CCce
Confidence                                                  333                                   5899


Q ss_pred             EEecCCCCCCHHHHHHHHHHHHHHhhhccccCCcEEEEEecchhHHHhcCCEEEEecCCccccccCccc
Q psy7365         282 ILDEPTSGVDPYSRRSIWELLIKVYYASHSLSGRTVILTTHYMDEADLLGDRIAIIAAGKLQCCGSSVF  350 (601)
Q Consensus       282 iLDEPtsgLD~~~~~~l~~~l~~l~~~~~~~~G~TVI~~tHdl~~~~~l~Drv~vL~~GkIv~~G~~~l  350 (601)
                      ||||||+||||.+++.++++|++++    +..|+|+|++|||++++.++|||+++|.+|+++..|++..
T Consensus       159 llDEPts~LD~~~~~~i~~ll~~l~----~~~g~tii~vTHd~~~a~~~~dri~vm~~G~iv~~G~~~e  223 (239)
T d1v43a3         159 LMDEPLSNLDAKLRVAMRAEIKKLQ----QKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTE  223 (239)
T ss_dssp             EEESTTTTSCHHHHHHHHHHHHHHH----HHHTCEEEEEESCHHHHHHHCSEEEEEETTEEEEEECHHH
T ss_pred             eecCCcccCCHHHHHHHHHHHHHHH----HhcCCeEEEEeCCHHHHHHhCCEEEEEECCEEEEEcCHHH
Confidence            9999999999999999999999984    2359999999999999999999999999999999987643



>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure