Psyllid ID: psy7399

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLRKGQVLENLMHITDWLPTLYFIAGKEKNIDS
cHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccEEEEEEEcccccccEEEcccEEHHHHHHHHHHHHcccccccc
cHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccccEEEcEEEccccccccccccHHHHHHcHHHHHHHHHcccccccc
MLKSLDESVGRVIQSLEEEGLLGNSLVVFisdnggptvdslhfhgntasnwplrgtkysfheggvRNVAALWSPLLRKGQVLENLMHITDWLPTLYFIAgkeknids
MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLRKGQVLENLMHITDWLPTLYFIAgkeknids
MLKSLDESVGRVIQSleeegllgNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLRKGQVLENLMHITDWLPTLYFIAGKEKNIDS
************I*SLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLRKGQVLENLMHITDWLPTLYFIAG*******
MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLRKGQVLENLMHITDWLPTLYFI**K******
*********GRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLRKGQVLENLMHITDWLPTLYFIAGKEKNIDS
*LKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLRKGQVLENLMHITDWLPTLYFIAGK******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLRKGQVLENLMHITDWLPTLYFIAGKEKNIDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
Q5FYB0 599 Arylsulfatase J OS=Homo s yes N/A 0.897 0.160 0.462 1e-17
Q8BM89 598 Arylsulfatase J OS=Mus mu yes N/A 0.897 0.160 0.462 2e-17
Q5FYB1 569 Arylsulfatase I OS=Homo s no N/A 0.869 0.163 0.475 6e-17
Q32KH7 573 Arylsulfatase I OS=Canis no N/A 0.869 0.162 0.465 1e-16
P50430 528 Arylsulfatase B OS=Rattus no N/A 0.869 0.176 0.465 2e-16
P50429 534 Arylsulfatase B OS=Mus mu no N/A 0.906 0.181 0.447 2e-16
Q32KJ8 573 Arylsulfatase I OS=Rattus no N/A 0.869 0.162 0.455 5e-16
Q32KI9 573 Arylsulfatase I OS=Mus mu no N/A 0.869 0.162 0.455 5e-16
P15848 533 Arylsulfatase B OS=Homo s no N/A 0.906 0.181 0.447 6e-16
P33727 535 Arylsulfatase B OS=Felis N/A N/A 0.859 0.171 0.47 9e-16
>sp|Q5FYB0|ARSJ_HUMAN Arylsulfatase J OS=Homo sapiens GN=ARSJ PE=2 SV=1 Back     alignment and function desciption
 Score = 88.2 bits (217), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 12/108 (11%)

Query: 1   MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGG-PTVDSLHFHGNTASNWPLRGTKYS 59
           ML  LDE++  V  +L+  G   NS++++ SDNGG PT           SNWPLRG+K +
Sbjct: 296 MLSCLDEAINNVTLALKTYGFYNNSIIIYSSDNGGQPTAG--------GSNWPLRGSKGT 347

Query: 60  FHEGGVRNVAALWSPLLR-KGQVLENLMHITDWLPTLYFIAGKEKNID 106
           + EGG+R V  + SPLL+ KG V + L+HITDW PTL  +A  E  ID
Sbjct: 348 YWEGGIRAVGFVHSPLLKNKGTVCKELVHITDWYPTLISLA--EGQID 393

Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 6EC: .EC: -
>sp|Q8BM89|ARSJ_MOUSE Arylsulfatase J OS=Mus musculus GN=Arsj PE=2 SV=1 Back     alignment and function description
>sp|Q5FYB1|ARSI_HUMAN Arylsulfatase I OS=Homo sapiens GN=ARSI PE=1 SV=1 Back     alignment and function description
>sp|Q32KH7|ARSI_CANFA Arylsulfatase I OS=Canis familiaris GN=ARSI PE=2 SV=2 Back     alignment and function description
>sp|P50430|ARSB_RAT Arylsulfatase B OS=Rattus norvegicus GN=Arsb PE=2 SV=2 Back     alignment and function description
>sp|P50429|ARSB_MOUSE Arylsulfatase B OS=Mus musculus GN=Arsb PE=2 SV=3 Back     alignment and function description
>sp|Q32KJ8|ARSI_RAT Arylsulfatase I OS=Rattus norvegicus GN=Arsi PE=2 SV=1 Back     alignment and function description
>sp|Q32KI9|ARSI_MOUSE Arylsulfatase I OS=Mus musculus GN=Arsi PE=2 SV=1 Back     alignment and function description
>sp|P15848|ARSB_HUMAN Arylsulfatase B OS=Homo sapiens GN=ARSB PE=1 SV=1 Back     alignment and function description
>sp|P33727|ARSB_FELCA Arylsulfatase B OS=Felis catus GN=ARSB PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
156547173 578 PREDICTED: arylsulfatase B-like [Nasonia 0.906 0.167 0.594 4e-28
193641058 575 PREDICTED: arylsulfatase B-like [Acyrtho 0.934 0.173 0.643 2e-27
328726458 402 PREDICTED: arylsulfatase B-like [Acyrtho 0.934 0.248 0.633 2e-27
193641124 599 PREDICTED: arylsulfatase B-like [Acyrtho 0.934 0.166 0.603 3e-27
328788250 564 PREDICTED: arylsulfatase B-like isoform 0.906 0.171 0.564 5e-25
383847821 575 PREDICTED: arylsulfatase B-like [Megachi 0.906 0.168 0.554 2e-24
380025784 579 PREDICTED: arylsulfatase B-like [Apis fl 0.906 0.167 0.544 3e-24
307187655 591 Arylsulfatase B [Camponotus floridanus] 0.906 0.164 0.554 5e-24
242008416 532 arylsulfatase B precursor, putative [Ped 0.925 0.186 0.55 1e-23
307215080 593 Arylsulfatase B [Harpegnathos saltator] 0.906 0.163 0.544 3e-23
>gi|156547173|ref|XP_001603910.1| PREDICTED: arylsulfatase B-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 4/101 (3%)

Query: 1   MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSF 60
           M+  LD+S+GR++ SL + G+L NS++VF+SDNGG T+       N ASNWPLRGTKY+ 
Sbjct: 247 MVARLDDSLGRIVSSLGDRGMLKNSVIVFMSDNGGATIGKFR---NWASNWPLRGTKYTL 303

Query: 61  HEGGVRNVAALWSP-LLRKGQVLENLMHITDWLPTLYFIAG 100
            EGGVR+VAA+WSP LL KG+V E L H+TDWLPTL+ +AG
Sbjct: 304 FEGGVRSVAAMWSPKLLSKGRVSEQLFHVTDWLPTLFQVAG 344

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193641058|ref|XP_001942872.1| PREDICTED: arylsulfatase B-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328726458|ref|XP_001949756.2| PREDICTED: arylsulfatase B-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193641124|ref|XP_001950120.1| PREDICTED: arylsulfatase B-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328788250|ref|XP_624148.3| PREDICTED: arylsulfatase B-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|383847821|ref|XP_003699551.1| PREDICTED: arylsulfatase B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380025784|ref|XP_003696648.1| PREDICTED: arylsulfatase B-like [Apis florea] Back     alignment and taxonomy information
>gi|307187655|gb|EFN72627.1| Arylsulfatase B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242008416|ref|XP_002425002.1| arylsulfatase B precursor, putative [Pediculus humanus corporis] gi|212508631|gb|EEB12264.1| arylsulfatase B precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307215080|gb|EFN89887.1| Arylsulfatase B [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
FB|FBgn0033763 562 CG8646 [Drosophila melanogaste 0.906 0.172 0.465 1.4e-18
FB|FBgn0036768 579 CG7402 [Drosophila melanogaste 0.906 0.167 0.455 2.4e-17
FB|FBgn0052191 554 CG32191 [Drosophila melanogast 0.859 0.166 0.447 2.6e-16
UNIPROTKB|F1P098388 ARSB "Uncharacterized protein" 0.906 0.25 0.438 5.9e-16
UNIPROTKB|F1NT29395 ARSB "Uncharacterized protein" 0.906 0.245 0.438 6.3e-16
UNIPROTKB|F1P095407 ARSB "Uncharacterized protein" 0.906 0.238 0.438 6.9e-16
UNIPROTKB|A6QLZ3 533 ARSB "Uncharacterized protein" 0.906 0.181 0.457 8.3e-16
UNIPROTKB|Q32KI4 535 arsb "Arylsulfatase B" [Canis 0.869 0.173 0.475 8.4e-16
UNIPROTKB|F6PKT4 489 ARSJ "Uncharacterized protein" 0.897 0.196 0.444 8.8e-16
UNIPROTKB|F1S147 467 ARSJ "Uncharacterized protein" 0.897 0.205 0.444 1e-15
FB|FBgn0033763 CG8646 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 232 (86.7 bits), Expect = 1.4e-18, P = 1.4e-18
 Identities = 47/101 (46%), Positives = 62/101 (61%)

Query:     1 MLKSLDESVGRVIQSXXXXXXXXNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSF 60
             M+  +D SVG+++          NS+++F SDNGGP      F+ N ASN+PL+G K + 
Sbjct:   251 MVSKMDNSVGQIVDQLRKSNMLENSIIIFSSDNGGPAQG---FNLNFASNYPLKGVKNTL 307

Query:    61 HEGGVRNVAALWSPLLRKGQVLEN-LMHITDWLPTLYFIAG 100
              EGGVR    +WSPLL+K Q + N  MHI DWLPTL   AG
Sbjct:   308 WEGGVRAAGLMWSPLLKKSQRVSNQTMHIIDWLPTLLEAAG 348
GO:0003943 "N-acetylgalactosamine-4-sulfatase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
FB|FBgn0036768 CG7402 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052191 CG32191 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1P098 ARSB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NT29 ARSB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P095 ARSB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLZ3 ARSB "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q32KI4 arsb "Arylsulfatase B" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6PKT4 ARSJ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S147 ARSJ "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
COG3119 475 COG3119, AslA, Arylsulfatase A and related enzymes 2e-18
pfam00884332 pfam00884, Sulfatase, Sulfatase 7e-11
PRK13759 485 PRK13759, PRK13759, arylsulfatase; Provisional 6e-09
TIGR03417 500 TIGR03417, chol_sulfatase, choline-sulfatase 3e-06
COG3083600 COG3083, COG3083, Predicted hydrolase of alkaline 3e-04
pfam01663342 pfam01663, Phosphodiest, Type I phosphodiesterase 5e-04
>gnl|CDD|225661 COG3119, AslA, Arylsulfatase A and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information 
 Score = 78.3 bits (193), Expect = 2e-18
 Identities = 36/102 (35%), Positives = 56/102 (54%), Gaps = 11/102 (10%)

Query: 1   MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSF 60
            ++ LD+ +GR++ +L+E GLL N++VVF SD+G             A   P RG K + 
Sbjct: 265 CVRYLDDQIGRLLDALKELGLLDNTIVVFTSDHGAWL---------GAHGTPFRGYKGTL 315

Query: 61  HEGGVRNVAALWSP--LLRKGQVLENLMHITDWLPTLYFIAG 100
           +EGG R    +  P  +   G+V++ L+ + D LPTL   AG
Sbjct: 316 YEGGTRVPLIIRWPGGIKPGGRVVDALVSLIDLLPTLLDAAG 357

Length = 475
>gnl|CDD|216172 pfam00884, Sulfatase, Sulfatase Back     alignment and domain information
>gnl|CDD|237491 PRK13759, PRK13759, arylsulfatase; Provisional Back     alignment and domain information
>gnl|CDD|234202 TIGR03417, chol_sulfatase, choline-sulfatase Back     alignment and domain information
>gnl|CDD|225625 COG3083, COG3083, Predicted hydrolase of alkaline phosphatase superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|216635 pfam01663, Phosphodiest, Type I phosphodiesterase / nucleotide pyrophosphatase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
COG3119 475 AslA Arylsulfatase A and related enzymes [Inorgani 99.95
TIGR03417 500 chol_sulfatase choline-sulfatase. 99.94
PRK13759 485 arylsulfatase; Provisional 99.93
PF00884308 Sulfatase: Sulfatase; InterPro: IPR000917 Sulphata 99.9
KOG3867|consensus 528 99.89
KOG3731|consensus 541 99.87
PRK11598545 putative metal dependent hydrolase; Provisional 99.82
COG3083600 Predicted hydrolase of alkaline phosphatase superf 99.8
PRK12363 703 phosphoglycerol transferase I; Provisional 99.8
PRK11560558 phosphoethanolamine transferase; Provisional 99.79
PRK03776 762 phosphoglycerol transferase I; Provisional 99.78
PRK09598522 lipid A phosphoethanolamine transferase; Reviewed 99.77
PRK10649577 hypothetical protein; Provisional 99.76
TIGR03397483 acid_phos_Burk acid phosphatase, Burkholderia-type 99.74
TIGR01307501 pgm_bpd_ind 2,3-bisphosphoglycerate-independent ph 99.71
PRK05362394 phosphopentomutase; Provisional 99.7
PRK05434507 phosphoglyceromutase; Provisional 99.7
TIGR01696381 deoB phosphopentomutase. This protein is involved 99.7
PRK12383406 putative mutase; Provisional 99.62
COG1368650 MdoB Phosphoglycerol transferase and related prote 99.58
PLN02538558 2,3-bisphosphoglycerate-independent phosphoglycera 99.49
PF01676252 Metalloenzyme: Metalloenzyme superfamily; InterPro 99.48
KOG2125|consensus 760 99.37
COG0696509 GpmI Phosphoglyceromutase [Carbohydrate transport 99.24
KOG4513|consensus531 99.2
PF02995497 DUF229: Protein of unknown function (DUF229); Inte 99.18
COG1015397 DeoB Phosphopentomutase [Carbohydrate transport an 99.12
KOG2126|consensus 895 98.9
COG2194555 Predicted membrane-associated, metal-dependent hyd 98.86
cd00016384 alkPPc Alkaline phosphatase homologues; alkaline p 98.81
KOG2124|consensus 883 98.79
PF04185376 Phosphoesterase: Phosphoesterase family; InterPro: 98.61
PF01663365 Phosphodiest: Type I phosphodiesterase / nucleotid 98.41
PRK04024412 cofactor-independent phosphoglycerate mutase; Prov 98.28
PRK10518476 alkaline phosphatase; Provisional 98.21
PF07394392 DUF1501: Protein of unknown function (DUF1501); In 98.21
KOG2645|consensus 418 98.12
COG1524450 Uncharacterized proteins of the AP superfamily [Ge 98.09
TIGR00306396 apgM 2,3-bisphosphoglycerate-independent phosphogl 97.8
TIGR03396 690 PC_PLC phospholipase C, phosphocholine-specific, P 97.78
TIGR02535396 hyp_Hser_kinase proposed homoserine kinase. The pr 97.63
PRK04200395 cofactor-independent phosphoglycerate mutase; Prov 97.59
COG3635408 Predicted phosphoglycerate mutase, AP superfamily 97.49
PRK04135395 cofactor-independent phosphoglycerate mutase; Prov 97.44
COG1785482 PhoA Alkaline phosphatase [Inorganic ion transport 97.16
TIGR02335408 hydr_PhnA phosphonoacetate hydrolase. This family 96.85
smart00098419 alkPPc Alkaline phosphatase homologues. 96.55
PF00245421 Alk_phosphatase: Alkaline phosphatase; InterPro: I 96.52
PF11658518 DUF3260: Protein of unknown function (DUF3260); In 95.1
PF08665181 PglZ: PglZ domain; InterPro: IPR013973 This entry 94.97
TIGR03368518 cellulose_yhjU cellulose synthase operon protein Y 94.82
COG3379471 Uncharacterized conserved protein [Function unknow 94.11
COG4102418 Uncharacterized protein conserved in bacteria [Fun 91.1
TIGR02687 844 conserved hypothetical protein TIGR02687. Members 89.99
COG3379 471 Uncharacterized conserved protein [Function unknow 88.69
PF05991166 NYN_YacP: YacP-like NYN domain; InterPro: IPR01029 83.29
KOG4126|consensus529 81.58
>COG3119 AslA Arylsulfatase A and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.95  E-value=4.1e-28  Score=177.78  Aligned_cols=96  Identities=38%  Similarity=0.532  Sum_probs=85.3

Q ss_pred             ChHHHHHHHHHHHHHHHHhCCCCCeEEEEEcCCCCCCCCCCcccCCCCCCCCcccccCCccCCCccccEEEEcCCCC-C-
Q psy7399           1 MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLR-K-   78 (107)
Q Consensus         1 ~i~~~D~~ig~l~~~l~~~g~~~nTlii~tsDHG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vP~ii~~p~~~-~-   78 (107)
                      ||+++|.+||+|+++|++.|++|||+||||||||....         ....++++.|.+.|++++||||||+||+.. + 
T Consensus       265 ~v~~~D~~iGrll~~L~~~g~~DnTivvftsDhG~~~~---------~~~~~~~~~k~~~~egg~~VPliI~~Pg~i~~~  335 (475)
T COG3119         265 CVRYLDDQIGRLLDALKELGLLDNTIVVFTSDHGAWLG---------AHGTPFRGYKGTLYEGGTRVPLIIRWPGGIKPG  335 (475)
T ss_pred             HHHHHHHHHhHHHHHHHHhCCccCcEEEEeCCCCCccc---------CCCCcccccccccccCcccceEEEeccCccCCC
Confidence            58999999999999999999999999999999997542         334667778888999999999999999864 3 


Q ss_pred             CeeeccceehhhHHHHHHHHhCCCCCC
Q psy7399          79 GQVLENLMHITDWLPTLYFIAGKEKNI  105 (107)
Q Consensus        79 ~~~~~~~~~~~Di~pTil~l~gi~~~~  105 (107)
                      +..++.+++.+||+||+|+++|++.|+
T Consensus       336 g~~~~~~v~~~Di~PTll~~aG~~~~~  362 (475)
T COG3119         336 GRVVDALVSLIDLLPTLLDAAGVPPPK  362 (475)
T ss_pred             CccccccchhhHHHHHHHHHcCCCCcc
Confidence            778899999999999999999999886

>TIGR03417 chol_sulfatase choline-sulfatase Back     alignment and domain information
>PRK13759 arylsulfatase; Provisional Back     alignment and domain information
>PF00884 Sulfatase: Sulfatase; InterPro: IPR000917 Sulphatases 3 Back     alignment and domain information
>KOG3867|consensus Back     alignment and domain information
>KOG3731|consensus Back     alignment and domain information
>PRK11598 putative metal dependent hydrolase; Provisional Back     alignment and domain information
>COG3083 Predicted hydrolase of alkaline phosphatase superfamily [General function prediction only] Back     alignment and domain information
>PRK12363 phosphoglycerol transferase I; Provisional Back     alignment and domain information
>PRK11560 phosphoethanolamine transferase; Provisional Back     alignment and domain information
>PRK03776 phosphoglycerol transferase I; Provisional Back     alignment and domain information
>PRK09598 lipid A phosphoethanolamine transferase; Reviewed Back     alignment and domain information
>PRK10649 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03397 acid_phos_Burk acid phosphatase, Burkholderia-type Back     alignment and domain information
>TIGR01307 pgm_bpd_ind 2,3-bisphosphoglycerate-independent phosphoglycerate mutase Back     alignment and domain information
>PRK05362 phosphopentomutase; Provisional Back     alignment and domain information
>PRK05434 phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR01696 deoB phosphopentomutase Back     alignment and domain information
>PRK12383 putative mutase; Provisional Back     alignment and domain information
>COG1368 MdoB Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02538 2,3-bisphosphoglycerate-independent phosphoglycerate mutase Back     alignment and domain information
>PF01676 Metalloenzyme: Metalloenzyme superfamily; InterPro: IPR006124 This domain unites alkaline phosphatase, N-acetylgalactosamine-4-sulphatase, and cerebroside sulphatase, enzymes with known three-dimensional structures, with phosphopentomutase, 2,3-bisphosphoglycerate-independent phosphoglycerate mutase, phosphoglycerol transferase, phosphonate monoesterase, streptomycin-6-phosphate phosphatase, alkaline phosphodiesterase/nucleotide pyrophosphatase PC-1, and several closely related sulphatases Back     alignment and domain information
>KOG2125|consensus Back     alignment and domain information
>COG0696 GpmI Phosphoglyceromutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4513|consensus Back     alignment and domain information
>PF02995 DUF229: Protein of unknown function (DUF229); InterPro: IPR004245 Members of this family are uncharacterised with a long conserved region that may contain several domains Back     alignment and domain information
>COG1015 DeoB Phosphopentomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2126|consensus Back     alignment and domain information
>COG2194 Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>cd00016 alkPPc Alkaline phosphatase homologues; alkaline phosphatases are non-specific phosphomonoesterases that catalyze the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at high pH Back     alignment and domain information
>KOG2124|consensus Back     alignment and domain information
>PF04185 Phosphoesterase: Phosphoesterase family; InterPro: IPR007312 This entry includes both bacterial phospholipase C enzymes (3 Back     alignment and domain information
>PF01663 Phosphodiest: Type I phosphodiesterase / nucleotide pyrophosphatase; InterPro: IPR002591 This family consists of phosphodiesterases, including human plasma-cell membrane glycoprotein PC-1 / alkaline phosphodiesterase I / nucleotide pyrophosphatase (nppase) Back     alignment and domain information
>PRK04024 cofactor-independent phosphoglycerate mutase; Provisional Back     alignment and domain information
>PRK10518 alkaline phosphatase; Provisional Back     alignment and domain information
>PF07394 DUF1501: Protein of unknown function (DUF1501); InterPro: IPR010869 This family contains a number of hypothetical bacterial proteins of unknown function approximately 400 residues long Back     alignment and domain information
>KOG2645|consensus Back     alignment and domain information
>COG1524 Uncharacterized proteins of the AP superfamily [General function prediction only] Back     alignment and domain information
>TIGR00306 apgM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase, archaeal form Back     alignment and domain information
>TIGR03396 PC_PLC phospholipase C, phosphocholine-specific, Pseudomonas-type Back     alignment and domain information
>TIGR02535 hyp_Hser_kinase proposed homoserine kinase Back     alignment and domain information
>PRK04200 cofactor-independent phosphoglycerate mutase; Provisional Back     alignment and domain information
>COG3635 Predicted phosphoglycerate mutase, AP superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04135 cofactor-independent phosphoglycerate mutase; Provisional Back     alignment and domain information
>COG1785 PhoA Alkaline phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02335 hydr_PhnA phosphonoacetate hydrolase Back     alignment and domain information
>smart00098 alkPPc Alkaline phosphatase homologues Back     alignment and domain information
>PF00245 Alk_phosphatase: Alkaline phosphatase; InterPro: IPR001952 This entry represents alkaline phosphatases (3 Back     alignment and domain information
>PF11658 DUF3260: Protein of unknown function (DUF3260); InterPro: IPR017744 This protein was identified by the partial phylogenetic profiling algorithm [] as part of the system for cellulose biosynthesis in bacteria, and in fact is found in cellulose biosynthesis gene regions Back     alignment and domain information
>PF08665 PglZ: PglZ domain; InterPro: IPR013973 This entry is a member of the Alkaline phosphatase clan Back     alignment and domain information
>TIGR03368 cellulose_yhjU cellulose synthase operon protein YhjU Back     alignment and domain information
>COG3379 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4102 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02687 conserved hypothetical protein TIGR02687 Back     alignment and domain information
>COG3379 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05991 NYN_YacP: YacP-like NYN domain; InterPro: IPR010298 This family consists of several hypothetical bacterial proteins as well as some uncharacterised sequences from Arabidopsis thaliana Back     alignment and domain information
>KOG4126|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
1fsu_A 492 4-Sulfatase (Human) Length = 492 1e-14
3ed4_A 502 Crystal Structure Of Putative Arylsulfatase From Es 2e-06
4fdi_A 502 The Molecular Basis Of Mucopolysaccharidosis Iv A L 5e-06
1e2s_P 489 Crystal Structure Of An Arylsulfatase A Mutant C69a 6e-04
1n2k_A 489 Crystal Structure Of A Covalent Intermediate Of End 6e-04
1e33_P 489 Crystal Structure Of An Arylsulfatase A Mutant P426 6e-04
1e1z_P 489 Crystal Structure Of An Arylsulfatase A Mutant C69s 6e-04
1e3c_P 489 Crystal Structure Of An Arylsulfatase A Mutant C69s 6e-04
>pdb|1FSU|A Chain A, 4-Sulfatase (Human) Length = 492 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 60/105 (57%), Gaps = 8/105 (7%)
Query: 1   MLKSLDESVGRVIQSXXXXXXXXNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSF 60
           M+  +DE+VG V  +        N++ +F +DNGG T+          +NWPLRG K+S 
Sbjct: 228 MVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAG-------GNNWPLRGRKWSL 280
Query: 61  HEGGVRNVAALWSPLLR-KGQVLENLMHITDWLPTLYFIAGKEKN 104
            EGGVR V  + SPLL+ KG     L+HI+DWLPTL  +A    N
Sbjct: 281 WEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTN 325
>pdb|3ED4|A Chain A, Crystal Structure Of Putative Arylsulfatase From Escherichia Coli Length = 502 Back     alignment and structure
>pdb|4FDI|A Chain A, The Molecular Basis Of Mucopolysaccharidosis Iv A Length = 502 Back     alignment and structure
>pdb|1E2S|P Chain P, Crystal Structure Of An Arylsulfatase A Mutant C69a Length = 489 Back     alignment and structure
>pdb|1N2K|A Chain A, Crystal Structure Of A Covalent Intermediate Of Endogenous Human Arylsulfatase A Length = 489 Back     alignment and structure
>pdb|1E33|P Chain P, Crystal Structure Of An Arylsulfatase A Mutant P426l Length = 489 Back     alignment and structure
>pdb|1E1Z|P Chain P, Crystal Structure Of An Arylsulfatase A Mutant C69s Length = 489 Back     alignment and structure
>pdb|1E3C|P Chain P, Crystal Structure Of An Arylsulfatase A Mutant C69s Soaked In Synthetic Substrate Length = 489 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
1fsu_A 492 N-acetylgalactosamine-4-sulfatase; glycosaminoglyc 2e-37
3ed4_A 502 Arylsulfatase; structural genomics, PSI-2, protein 1e-29
1auk_A 489 Arylsulfatase A; cerebroside-3-sulfate hydrolysis, 2e-27
1p49_A 562 Steryl-sulfatase; steroid biosynthesis, steroid su 4e-26
1hdh_A 536 Arylsulfatase; hydrolase, formylglycine hydrate; 1 5e-21
2qzu_A 491 Putative sulfatase YIDJ; Q64XZ4_bacfr, arylsulfata 8e-21
3b5q_A 482 Putative sulfatase YIDJ; NP_810509.1, structural g 6e-13
2vqr_A 543 Putative sulfatase; phosphonate monoester hydrolas 2e-12
>1fsu_A N-acetylgalactosamine-4-sulfatase; glycosaminoglycan degradation, hydrolase, glycopr lysosome; HET: ALS NAG; 2.50A {Homo sapiens} SCOP: c.76.1.2 Length = 492 Back     alignment and structure
 Score =  130 bits (329), Expect = 2e-37
 Identities = 48/111 (43%), Positives = 65/111 (58%), Gaps = 12/111 (10%)

Query: 1   MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSF 60
           M+  +DE+VG V  +L+  GL  N++ +F +DNGG T           +NWPLRG K+S 
Sbjct: 228 MVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQT-------LAGGNNWPLRGRKWSL 280

Query: 61  HEGGVRNVAALWSPLL-RKGQVLENLMHITDWLPTLYFIAG----KEKNID 106
            EGGVR V  + SPLL +KG     L+HI+DWLPTL  +A       K +D
Sbjct: 281 WEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLD 331
>3ed4_A Arylsulfatase; structural genomics, PSI-2, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, transferase; 1.70A {Escherichia coli} Length = 502 Back     alignment and structure
>1auk_A Arylsulfatase A; cerebroside-3-sulfate hydrolysis, lysosomal enzyme, hydrolas; HET: NDG NAG; 2.10A {Homo sapiens} SCOP: c.76.1.2 PDB: 1n2k_A* 1n2l_A* 1e1z_P* 1e2s_P* 1e3c_P* 1e33_P* Length = 489 Back     alignment and structure
>1p49_A Steryl-sulfatase; steroid biosynthesis, steroid sulfatase, estrone sulfate, dehydroepiandrosterone sulfate, human placental enzyme; HET: ALS BOG NAG; 2.60A {Homo sapiens} SCOP: c.76.1.2 Length = 562 Back     alignment and structure
>1hdh_A Arylsulfatase; hydrolase, formylglycine hydrate; 1.3A {Pseudomonas aeruginosa} SCOP: c.76.1.2 Length = 536 Back     alignment and structure
>2qzu_A Putative sulfatase YIDJ; Q64XZ4_bacfr, arylsulfatase, BFR123, NESG, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides fragilis} Length = 491 Back     alignment and structure
>3b5q_A Putative sulfatase YIDJ; NP_810509.1, structural genomics, joint center for structural genomics, JCSG; HET: EPE; 2.40A {Bacteroides thetaiotaomicron vpi-5482} Length = 482 Back     alignment and structure
>2vqr_A Putative sulfatase; phosphonate monoester hydrolase, hydrolase, plasmid, formylglycine, phosphodiesterase; 1.42A {Rhizobium leguminosarum BV} PDB: 2w8s_A Length = 543 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
4fdi_A 502 N-acetylgalactosamine-6-sulfatase; glycoprotein, e 99.97
3ed4_A 502 Arylsulfatase; structural genomics, PSI-2, protein 99.96
1fsu_A 492 N-acetylgalactosamine-4-sulfatase; glycosaminoglyc 99.96
1hdh_A 536 Arylsulfatase; hydrolase, formylglycine hydrate; 1 99.96
1auk_A 489 Arylsulfatase A; cerebroside-3-sulfate hydrolysis, 99.95
1p49_A 562 Steryl-sulfatase; steroid biosynthesis, steroid su 99.95
2vqr_A 543 Putative sulfatase; phosphonate monoester hydrolas 99.95
2qzu_A 491 Putative sulfatase YIDJ; Q64XZ4_bacfr, arylsulfata 99.94
3b5q_A 482 Putative sulfatase YIDJ; NP_810509.1, structural g 99.94
2w5q_A424 Processed glycerol phosphate lipoteichoic acid syn 99.94
2w8d_A 436 Processed glycerol phosphate lipoteichoic acid SY; 99.94
3lxq_A450 Uncharacterized protein VP1736; alkaline, phosphat 99.9
2gso_A393 Phosphodiesterase-nucleotide pyrophosphatase; alph 99.9
3m7v_A413 Phosphopentomutase; structural genomics, nysgrc, c 99.89
2w5v_A375 Alkaline phosphatase; psychrophiles, cold adaptati 99.87
3igz_B561 Cofactor-independent phosphoglycerate mutase; glyc 99.86
4gtw_A 823 Ectonucleotide pyrophosphatase/phosphodiesterase m 99.81
1o98_A511 2,3-bisphosphoglycerate-independent phosphoglycera 99.79
3ot9_A399 Phosphopentomutase; alkaline phosphatase like core 99.76
2i09_A403 Phosphopentomutase; structural genomics, target T1 99.73
3q3q_A565 Alkaline phosphatase; hydrolase; 1.95A {Sphingomon 99.6
3nkq_A 831 Ectonucleotide pyrophosphatase/phosphodiesterase m 99.56
2zkt_A412 2,3-bisphosphoglycerate-independent phosphoglycer 99.43
3a52_A400 Cold-active alkaline phosphatase; hydrolase; 2.20A 98.44
3kd8_A399 2,3-bisphosphoglycerate-independent phosphoglycera 98.37
1zed_A484 Alkaline phosphatase; phosphoserine, substrate ana 98.35
1k7h_A476 Alkaline phosphatase; hydrolase, transferase, phos 98.31
3tg0_A449 Apase, alkaline phosphatase; hydrolase; 1.20A {Esc 98.31
2d1g_A498 Acid phosphatase; ACPA, decavanadate vanadate, hyd 98.22
1ei6_A406 Phosphonoacetate hydrolase; zinc,; HET: TLA; 2.10A 97.92
2x98_A431 Alkaline phosphatase; hydrolase; 1.70A {Halobacter 97.54
3szy_A427 Phosphonoacetate hydrolase; alkaline phosphatase s 97.18
2w0y_A473 APH, alkaline phosphatase; hydrolase, halophilic; 96.48
1ei6_A406 Phosphonoacetate hydrolase; zinc,; HET: TLA; 2.10A 95.96
3e2d_A 502 Alkaline phosphatase; cold-adaptation, metalloenzy 95.46
3szy_A427 Phosphonoacetate hydrolase; alkaline phosphatase s 95.3
>4fdi_A N-acetylgalactosamine-6-sulfatase; glycoprotein, enzyme replacement therapy, formylg N-linked glycosylation, lysosomal enzyme, hydrolase; HET: NAG CIT; 2.20A {Homo sapiens} PDB: 4fdj_A* Back     alignment and structure
Probab=99.97  E-value=1.2e-31  Score=195.90  Aligned_cols=103  Identities=31%  Similarity=0.463  Sum_probs=91.8

Q ss_pred             ChHHHHHHHHHHHHHHHHhCCCCCeEEEEEcCCCCCCCCCCcccCCCCCCCCcccccCCccCCCccccEEEEcCCCCC-C
Q psy7399           1 MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLHFHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLRK-G   79 (107)
Q Consensus         1 ~i~~~D~~ig~l~~~l~~~g~~~nTlii~tsDHG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vP~ii~~p~~~~-~   79 (107)
                      ||+++|++||+|+++||+.|++|||+||||||||.....   .....+++.++++.|.+.||+++|||+||+||+..+ +
T Consensus       231 ~v~~~D~~vG~il~~L~~~gl~dnTiViftSDhG~~~~~---~~~~~g~~g~~~~~K~~~~E~g~rVPlii~~Pg~~~~g  307 (502)
T 4fdi_A          231 AVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALIS---APEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAG  307 (502)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCGGGEEEEEEESSCCCTTS---TTTSCCCCTTSSCCTTSSSHHHHBCCEEEECTTTSCTT
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCcCceEEEecCCCccccc---cccccCccCCCCCCCcccccCcccCcccccCCCccCCC
Confidence            588999999999999999999999999999999987633   223346777888999999999999999999999765 8


Q ss_pred             eeeccceehhhHHHHHHHHhCCCCCCC
Q psy7399          80 QVLENLMHITDWLPTLYFIAGKEKNID  106 (107)
Q Consensus        80 ~~~~~~~~~~Di~pTil~l~gi~~~~~  106 (107)
                      .+++++++++||+||||+++|++.|.+
T Consensus       308 ~~~~~~vs~~Di~PTll~laG~~~p~~  334 (502)
T 4fdi_A          308 QVSHQLGSIMDLFTTSLALAGLTPPSD  334 (502)
T ss_dssp             EECCCCEETTHHHHHHHHHHTCCCCSS
T ss_pred             ceeecccccccHHHHHHHHhCCCCCCC
Confidence            899999999999999999999998863
>3ed4_A Arylsulfatase; structural genomics, PSI-2, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, transferase; 1.70A {Escherichia coli} Back     alignment and structure
>1fsu_A N-acetylgalactosamine-4-sulfatase; glycosaminoglycan degradation, hydrolase, glycopr lysosome; HET: ALS NAG; 2.50A {Homo sapiens} SCOP: c.76.1.2 Back     alignment and structure
>1hdh_A Arylsulfatase; hydrolase, formylglycine hydrate; 1.3A {Pseudomonas aeruginosa} SCOP: c.76.1.2 Back     alignment and structure
>1auk_A Arylsulfatase A; cerebroside-3-sulfate hydrolysis, lysosomal enzyme, hydrolas; HET: NDG NAG; 2.10A {Homo sapiens} SCOP: c.76.1.2 PDB: 1n2k_A* 1n2l_A* 1e1z_P* 1e2s_P* 1e3c_P* 1e33_P* Back     alignment and structure
>1p49_A Steryl-sulfatase; steroid biosynthesis, steroid sulfatase, estrone sulfate, dehydroepiandrosterone sulfate, human placental enzyme; HET: ALS BOG NAG; 2.60A {Homo sapiens} SCOP: c.76.1.2 Back     alignment and structure
>2vqr_A Putative sulfatase; phosphonate monoester hydrolase, hydrolase, plasmid, formylglycine, phosphodiesterase; 1.42A {Rhizobium leguminosarum BV} PDB: 2w8s_A Back     alignment and structure
>2qzu_A Putative sulfatase YIDJ; Q64XZ4_bacfr, arylsulfatase, BFR123, NESG, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides fragilis} Back     alignment and structure
>3b5q_A Putative sulfatase YIDJ; NP_810509.1, structural genomics, joint center for structural genomics, JCSG; HET: EPE; 2.40A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2w5q_A Processed glycerol phosphate lipoteichoic acid synthase; transmembrane, cell WALL biogenesis/degradation, LTAS, membrane, secreted; 1.20A {Staphylococcus aureus} PDB: 2w5s_A* 2w5t_A* 2w5r_A* Back     alignment and structure
>2w8d_A Processed glycerol phosphate lipoteichoic acid SY; transferase, phosphatase, cell membrane, transmembrane, LTA, membrane, secreted, cell WALL; HET: TPO PG4; 2.35A {Bacillus subtilis} Back     alignment and structure
>3lxq_A Uncharacterized protein VP1736; alkaline, phosphatase, MDOB, sulfatase, PSI, MCSG, structural genomics; 1.95A {Vibrio parahaemolyticus} Back     alignment and structure
>2gso_A Phosphodiesterase-nucleotide pyrophosphatase; alpha beta, NPP, hydrolase; 1.30A {Xanthomonas axonopodis PV} PDB: 2gsn_A 2gsu_A* 2rh6_A* Back     alignment and structure
>3m7v_A Phosphopentomutase; structural genomics, nysgrc, cytoplasm, isomerase, manganese binding, PSI-2, protein structure initiative; 2.00A {Streptococcus mutans} Back     alignment and structure
>2w5v_A Alkaline phosphatase; psychrophiles, cold adaptation, hydrolase; HET: SEP; 1.78A {Antarctic bacterium TAB5} PDB: 2w5w_A* 2w5x_A* 2iuc_A 2iuc_B Back     alignment and structure
>3igz_B Cofactor-independent phosphoglycerate mutase; glycolysis, cobalt, isomerase; HET: 3PG 2PG; 1.90A {Leishmania mexicana} PDB: 3igy_B* 3nvl_A Back     alignment and structure
>4gtw_A Ectonucleotide pyrophosphatase/phosphodiesterase member 2, alkaline phosphodiesterase...; bone mineralization, hydrolase; HET: NAG BMA MAN AMP; 2.70A {Mus musculus} PDB: 4gtx_A* 4gty_A* 4gtz_A* 4b56_A* Back     alignment and structure
>1o98_A 2,3-bisphosphoglycerate-independent phosphoglycerate mutase; isomerase, alpha/beta-type structure; HET: 2PG; 1.4A {Bacillus stearothermophilus} SCOP: c.105.1.1 c.76.1.3 PDB: 1ejj_A* 1eqj_A* 1o99_A* 2ify_A Back     alignment and structure
>3ot9_A Phosphopentomutase; alkaline phosphatase like core domain, R phosphate, ribose-1-phosphate, glucose-1,6-bisphosphate, PH transfer, isomerase; HET: TPO G16; 1.75A {Bacillus cereus} PDB: 3m8y_A* 3m8w_A* 3m8z_A* 3twz_A* 3tx0_A 3uo0_A* 3un2_A 3un3_A* 3un5_A 3uny_A Back     alignment and structure
>2i09_A Phosphopentomutase; structural genomics, target T1865, NYSGXRC, PSI, protein structure initiative; 2.00A {Streptococcus mutans} PDB: 3m7v_A Back     alignment and structure
>3q3q_A Alkaline phosphatase; hydrolase; 1.95A {Sphingomonas SP} Back     alignment and structure
>3nkq_A Ectonucleotide pyrophosphatase/phosphodiesterase member 2; lysophospholipase D, autotaxin, ENPP2, lysophosphatidic acid hydrolase; HET: NAG BMA MAN NKQ; 1.70A {Mus musculus} PDB: 3nkm_A* 3nkn_A* 3nkp_A* 3nko_A* 3nkr_A* 2xrg_A* 2xr9_A* Back     alignment and structure
>2zkt_A 2,3-bisphosphoglycerate-independent phosphoglycer mutase; phosphonopyruvate decarboxylase, isomerase, structural genom NPPSFA; 2.40A {Pyrococcus horikoshii} Back     alignment and structure
>3a52_A Cold-active alkaline phosphatase; hydrolase; 2.20A {Shewanella} Back     alignment and structure
>3kd8_A 2,3-bisphosphoglycerate-independent phosphoglycerate mutase; structural genomics, PSI-2, protein genomics, MCSG, glycolysis isomerase; 2.60A {Thermoplasma acidophilum} PDB: 3idd_A Back     alignment and structure
>1zed_A Alkaline phosphatase; phosphoserine, substrate analog, hydro; HET: NAG PNP; 1.57A {Homo sapiens} SCOP: c.76.1.1 PDB: 1zeb_A* 1zef_A* 2glq_A* 3mk0_A* 3mk1_A* 3mk2_A* 1ew2_A* Back     alignment and structure
>1k7h_A Alkaline phosphatase; hydrolase, transferase, phosphomonoester, extended beta SHEE triad, metal triad; HET: NAG; 1.92A {Pandalus borealis} SCOP: c.76.1.1 PDB: 1shq_A* 1shn_A* Back     alignment and structure
>3tg0_A Apase, alkaline phosphatase; hydrolase; 1.20A {Escherichia coli} SCOP: c.76.1.1 PDB: 1b8j_A 1ed9_A 1ew8_A 1ew9_A 1ed8_A 1y6v_A 3bdg_B 1elx_A 2g9y_A 2ga3_A* 3bdh_A 3cmr_A 1elz_A 1hjk_A* 1hqa_A 1ely_A 3dyc_A 1ali_A 1alj_A 3bdf_A ... Back     alignment and structure
>2d1g_A Acid phosphatase; ACPA, decavanadate vanadate, hydrolase; HET: DVT ETE PGE; 1.75A {Francisella tularensis subsp} Back     alignment and structure
>1ei6_A Phosphonoacetate hydrolase; zinc,; HET: TLA; 2.10A {Pseudomonas fluorescens} SCOP: c.76.1.4 Back     alignment and structure
>2x98_A Alkaline phosphatase; hydrolase; 1.70A {Halobacterium salinarum} Back     alignment and structure
>3szy_A Phosphonoacetate hydrolase; alkaline phosphatase superfamily; 1.35A {Sinorhizobium meliloti} SCOP: c.76.1.0 PDB: 3szz_A 3t00_A 3t01_A 3t02_A Back     alignment and structure
>1ei6_A Phosphonoacetate hydrolase; zinc,; HET: TLA; 2.10A {Pseudomonas fluorescens} SCOP: c.76.1.4 Back     alignment and structure
>3e2d_A Alkaline phosphatase; cold-adaptation, metalloenzyme, dimer, psychrophilic bacteria, crystallography, hydrolase; 1.40A {Vibrio SP} Back     alignment and structure
>3szy_A Phosphonoacetate hydrolase; alkaline phosphatase superfamily; 1.35A {Sinorhizobium meliloti} SCOP: c.76.1.0 PDB: 3szz_A 3t00_A 3t01_A 3t02_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 107
d1p49a_ 553 c.76.1.2 (A:) Steryl-sulfatase {Human (Homo sapien 7e-07
>d1p49a_ c.76.1.2 (A:) Steryl-sulfatase {Human (Homo sapiens) [TaxId: 9606]} Length = 553 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Alkaline phosphatase-like
superfamily: Alkaline phosphatase-like
family: Arylsulfatase
domain: Steryl-sulfatase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.7 bits (101), Expect = 7e-07
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 2/94 (2%)

Query: 6   DESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVD-SLHFHGNTASNWPLRGTKYSFHEGG 64
           D SVG+++  L+E  L  ++L+ F SD G    + S     +  SN   +G K +  EGG
Sbjct: 294 DWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGG 353

Query: 65  VRNVAALWSPL-LRKGQVLENLMHITDWLPTLYF 97
           +R    L  P  ++ GQ ++      D  PT+  
Sbjct: 354 IRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAK 387

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d1p49a_ 553 Steryl-sulfatase {Human (Homo sapiens) [TaxId: 960 99.97
d1auka_ 485 Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606 99.96
d1fsua_ 492 Arylsulfatase B (4-sulfatase) {Human (Homo sapiens 99.96
d1hdha_ 525 Arylsulfatase B (4-sulfatase) {Pseudomonas aerugin 99.94
d2i09a1283 Phosphopentomutase DeoB {Streptococcus mutans [Tax 99.83
d1o98a2275 2,3-Bisphosphoglycerate-independent phosphoglycera 99.79
d1ei6a_406 Phosphonoacetate hydrolase {Pseudomonas fluorescen 98.69
d1y6va1449 Alkaline phosphatase {Escherichia coli [TaxId: 562 98.36
d1zeda1479 Alkaline phosphatase {Human (Homo sapiens) [TaxId: 97.94
d1k7ha_476 Alkaline phosphatase {Northern shrimp (Pandalus bo 97.77
d1ei6a_406 Phosphonoacetate hydrolase {Pseudomonas fluorescen 91.96
>d1p49a_ c.76.1.2 (A:) Steryl-sulfatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Alkaline phosphatase-like
superfamily: Alkaline phosphatase-like
family: Arylsulfatase
domain: Steryl-sulfatase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=5.8e-31  Score=190.06  Aligned_cols=106  Identities=28%  Similarity=0.348  Sum_probs=90.7

Q ss_pred             ChHHHHHHHHHHHHHHHHhCCCCCeEEEEEcCCCCCCCCCCc-ccCCCCCCCCcccccCCccCCCccccEEEEcCCCC-C
Q psy7399           1 MLKSLDESVGRVIQSLEEEGLLGNSLVVFISDNGGPTVDSLH-FHGNTASNWPLRGTKYSFHEGGVRNVAALWSPLLR-K   78 (107)
Q Consensus         1 ~i~~~D~~ig~l~~~l~~~g~~~nTlii~tsDHG~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~vP~ii~~p~~~-~   78 (107)
                      ||+++|++||+|+++|+++|++|||+||||||||........ .........++++.|.+.||+++||||||++|+.. +
T Consensus       289 ~i~~~D~~iG~ll~~L~~~gl~dnTiIiftSDhG~~lge~~~~~~~~~~~~g~~~~~K~~~yE~~~rVPlii~~P~~~~~  368 (553)
T d1p49a_         289 AVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRWPRVIQA  368 (553)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCGGGEEEEEEESSCCCTTCBCSSSCBCSCCCTTCCCCTTSSSHHHHCCCEEEECTTTSCT
T ss_pred             cccccchhhhhHHHhhhhcCCCccceEEEecCCCcccccccccCccccccccccCCCccccccCCeeeeeeeeecccccC
Confidence            578999999999999999999999999999999998743111 11223445678889999999999999999999965 4


Q ss_pred             CeeeccceehhhHHHHHHHHhCCCCCCC
Q psy7399          79 GQVLENLMHITDWLPTLYFIAGKEKNID  106 (107)
Q Consensus        79 ~~~~~~~~~~~Di~pTil~l~gi~~~~~  106 (107)
                      |++++.+++++||+||||+++|++.|++
T Consensus       369 G~~~~~~vs~iDi~PTildlaG~~~p~~  396 (553)
T d1p49a_         369 GQKIDEPTSNMDIFPTVAKLAGAPLPED  396 (553)
T ss_dssp             TCEECSCEEGGGHHHHHHHHHTCCCCSS
T ss_pred             CceeeeccccccccceeeeccccCCccc
Confidence            8899999999999999999999998863
>d1auka_ c.76.1.2 (A:) Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fsua_ c.76.1.2 (A:) Arylsulfatase B (4-sulfatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdha_ c.76.1.2 (A:) Arylsulfatase B (4-sulfatase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i09a1 c.76.1.5 (A:2-107,A:227-403) Phosphopentomutase DeoB {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1o98a2 c.76.1.3 (A:2-76,A:311-510) 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ei6a_ c.76.1.4 (A:) Phosphonoacetate hydrolase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1y6va1 c.76.1.1 (A:1-449) Alkaline phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zeda1 c.76.1.1 (A:1-479) Alkaline phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ha_ c.76.1.1 (A:) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]} Back     information, alignment and structure
>d1ei6a_ c.76.1.4 (A:) Phosphonoacetate hydrolase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure