Psyllid ID: psy7483

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MQLTNSVQVPSTPASPFAKFKQLERQNSAPKAKGTSETSSAVTTTNGNVTKTEVHKRVLSQTASTHRLTKGTSETSSAVTTTNGNVTKTEVHKRVLSQTASTHRLTKANSVQVPSTPASPFAKFKQLERQNSAPNARSESPLFKITEPNLARSASSIKDRMLSWNVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLMPLLDVEDIH
ccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccccccc
cccccccccccccccEEEEHHHHEccccccccccEcccccHcccccccccEEEEEEEEEEcccccEEEcccEcccccccccccccHHHHHHHHHccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccEEEEEEEEEcccccccHHHHHHHHcccccccccHHHcccHHHHHHHHHHcHHHccHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHc
mqltnsvqvpstpaspfakfkqlerqnsapkakgtsetssavtttngnvtkTEVHKRVLSQTasthrltkgtsetssavtttngnvtkTEVHKRVLSQTasthrltkansvqvpstpaspfakfkqlerqnsapnarsesplfkitepnlarsaSSIKDRMLSWNVQidnfstswNDGMAFCALIHhfyphafdfdklspqqrRHNFELAFRVAeeeadlmplldvedih
mqltnsvqvpstpaspfakfKQLErqnsapkakgtsetssavtttngnvtktevhkrvlsqtasthrltkgtsetssavtttngnvtktevHKRVLSqtasthrltkansvqvpstpaSPFAKFKQLERQnsapnarsesplfkitepnlARSASSIKDRMLSWNVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFrvaeeeadlmplldvedih
MQLTNSVQVPSTPASPFAKFKQLERQNSAPKAKGTSETSSAVTTTNGNVTKTEVHKRVLSQTASTHRLTKGTSETSSAVTTTNGNVTKTEVHKRVLSQTASTHRLTKANSVQVPSTPASPFAKFKQLERQNSAPNARSESPLFKITEPNLARSASSIKDRMLSWNVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLMPLLDVEDIH
**************************************************************************************************************************************************************DRMLSWNVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVA****************
****************************************************************************************************************************************************************MLSWNVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLMPLLDVEDI*
*************ASPFAKFKQLE********************TNGNVTKTEVHKR***********************TTNGNVTKTEVHKRVLSQ*******************ASPFAKFKQLE**********ESPLFKITEPNLARSASSIKDRMLSWNVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLMPLLDVEDIH
***************PFAK***LER************************TKTEVHKRVLSQTASTHRLTKGT*************VT**E****VLSQTASTHRLTKANSVQVPSTPASPFAKFKQLERQNSAPNARSESPLFKITEPNLARSASSIKDRMLSWNVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLMPLLD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLTNSVQVPSTPASPFAKFKQLERQNSAPKAKGTSETSSAVTTTNGNVTKTEVHKRVLSQTASTHRLTKGTSETSSAVTTTNGNVTKTEVHKRVLSQTASTHRLTKANSVQVPSTPASPFAKFKQLERQNSAPNARSESPLFKITEPNLARSASSIKDRMLSWNVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLMPLLDVEDIH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
Q921U8923 Smoothelin OS=Mus musculu yes N/A 0.547 0.136 0.421 2e-23
P53814917 Smoothelin OS=Homo sapien yes N/A 0.539 0.135 0.422 5e-23
Q2KI85458 Smoothelin-like protein 2 no N/A 0.334 0.168 0.546 9e-22
Q2TAL5461 Smoothelin-like protein 2 no N/A 0.595 0.297 0.384 2e-21
A8MU46457 Smoothelin-like protein 1 no N/A 0.513 0.258 0.414 2e-21
Q99LM3459 Smoothelin-like protein 1 no N/A 0.513 0.257 0.414 3e-21
Q8CI12456 Smoothelin-like protein 2 no N/A 0.334 0.168 0.534 4e-21
P11277 2137 Spectrin beta chain, eryt no N/A 0.343 0.036 0.454 9e-15
P15508 2128 Spectrin beta chain, eryt no N/A 0.343 0.037 0.454 1e-14
Q01082 2364 Spectrin beta chain, non- no N/A 0.356 0.034 0.462 3e-13
>sp|Q921U8|SMTN_MOUSE Smoothelin OS=Mus musculus GN=Smtn PE=2 SV=2 Back     alignment and function desciption
 Score =  109 bits (272), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 84/147 (57%), Gaps = 21/147 (14%)

Query: 98  QTASTHRLTKANSVQVPSTPASPFAKFKQLERQNSAPN------ARSESPLFKITEPNLA 151
           Q      L KA S+   S   +  A  ++LE++ SA        A   S  F +  PN  
Sbjct: 748 QAEKKKELMKAQSLPKTSASQARKAMIEKLEKEGSAGGPGTPRTAVQRSTSFGV--PN-- 803

Query: 152 RSASSIKDRMLSW---------NVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQ 202
             A+SIK  +L W         +V I NFS+SW+DGMAFCAL+H+F+P AFD+ +LSPQ 
Sbjct: 804 --ANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQN 861

Query: 203 RRHNFELAFRVAEEEADLMPLLDVEDI 229
           RR NFE+AF  AE   D +PL++VED+
Sbjct: 862 RRQNFEMAFSSAEMLVDCVPLVEVEDM 888
Structural protein of the cytoskeleton.
Mus musculus (taxid: 10090)
>sp|P53814|SMTN_HUMAN Smoothelin OS=Homo sapiens GN=SMTN PE=1 SV=7 Back     alignment and function description
>sp|Q2KI85|SMTL2_BOVIN Smoothelin-like protein 2 OS=Bos taurus GN=SMTNL2 PE=2 SV=1 Back     alignment and function description
>sp|Q2TAL5|SMTL2_HUMAN Smoothelin-like protein 2 OS=Homo sapiens GN=SMTNL2 PE=2 SV=1 Back     alignment and function description
>sp|A8MU46|SMTL1_HUMAN Smoothelin-like protein 1 OS=Homo sapiens GN=SMTNL1 PE=1 SV=1 Back     alignment and function description
>sp|Q99LM3|SMTL1_MOUSE Smoothelin-like protein 1 OS=Mus musculus GN=Smtnl1 PE=1 SV=1 Back     alignment and function description
>sp|Q8CI12|SMTL2_MOUSE Smoothelin-like protein 2 OS=Mus musculus GN=Smtnl2 PE=1 SV=1 Back     alignment and function description
>sp|P11277|SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5 Back     alignment and function description
>sp|P15508|SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus GN=Sptb PE=1 SV=4 Back     alignment and function description
>sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
270011248 3903 hypothetical protein TcasGA2_TC002172 [T 0.543 0.032 0.567 5e-39
242013489201 conserved hypothetical protein [Pediculu 0.491 0.562 0.595 9e-37
157132439262 hypothetical protein AaeL_AAEL012429 [Ae 0.504 0.442 0.521 1e-36
347964721271 AGAP000906-PA [Anopheles gambiae str. PE 0.491 0.416 0.546 2e-36
357625425 4424 hypothetical protein KGM_06150 [Danaus p 0.621 0.032 0.466 9e-34
307189968198 Smoothelin-like protein 2 [Camponotus fl 0.504 0.585 0.548 3e-33
332028342260 Smoothelin-like protein 2 [Acromyrmex ec 0.495 0.438 0.548 1e-32
383861344203 PREDICTED: smoothelin-like [Megachile ro 0.482 0.546 0.553 5e-32
124248474 419 IP18653p [Drosophila melanogaster] 0.482 0.264 0.514 5e-31
320541794 3329 CG34417, isoform K [Drosophila melanogas 0.482 0.033 0.514 9e-31
>gi|270011248|gb|EFA07696.1| hypothetical protein TcasGA2_TC002172 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/141 (56%), Positives = 101/141 (71%), Gaps = 16/141 (11%)

Query: 104  RLTKANSVQVPSTPASPFAKFKQLERQNS-----APNARSES-PLFKITEPNLARSASSI 157
            R+T    +Q    P SPFAKF+QL++QNS      P   S S PLFK T+P +++SAS+I
Sbjct: 3738 RVTSTQQIQS-KKPISPFAKFRQLDKQNSLNSPSTPKTPSGSGPLFKFTDPAVSQSASTI 3796

Query: 158  KDRMLSW---------NVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFE 208
            KDR+L W         N+Q+DNFSTSW DG+AFCALIHHF P AFD+  LSP+ RRHNF 
Sbjct: 3797 KDRLLFWCRMKTKEYENIQLDNFSTSWADGLAFCALIHHFLPDAFDYHALSPKNRRHNFT 3856

Query: 209  LAFRVAEEEADLMPLLDVEDI 229
            LAFRVA+E+AD+ PLLDV+D+
Sbjct: 3857 LAFRVADEKADIAPLLDVDDM 3877

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242013489|ref|XP_002427437.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511823|gb|EEB14699.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157132439|ref|XP_001662563.1| hypothetical protein AaeL_AAEL012429 [Aedes aegypti] gi|108871170|gb|EAT35395.1| AAEL012429-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|347964721|ref|XP_316883.5| AGAP000906-PA [Anopheles gambiae str. PEST] gi|333469478|gb|EAA12124.6| AGAP000906-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|357625425|gb|EHJ75880.1| hypothetical protein KGM_06150 [Danaus plexippus] Back     alignment and taxonomy information
>gi|307189968|gb|EFN74204.1| Smoothelin-like protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332028342|gb|EGI68389.1| Smoothelin-like protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383861344|ref|XP_003706146.1| PREDICTED: smoothelin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|124248474|gb|ABM92857.1| IP18653p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|320541794|ref|NP_001188548.1| CG34417, isoform K [Drosophila melanogaster] gi|318069324|gb|ADV37632.1| CG34417, isoform K [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
UNIPROTKB|P53814917 SMTN "Smoothelin" [Homo sapien 0.9 0.225 0.330 3.8e-22
MGI|MGI:1354727923 Smtn "smoothelin" [Mus musculu 0.786 0.196 0.350 1e-21
WB|WBGene00020530432 T15B12.1a [Caenorhabditis eleg 0.734 0.391 0.380 1.4e-21
ZFIN|ZDB-GENE-050306-23401 smtnl1 "smoothelin-like 1" [Da 0.756 0.433 0.343 5.7e-21
UNIPROTKB|A8MU46457 SMTNL1 "Smoothelin-like protei 0.734 0.369 0.345 1.1e-19
UNIPROTKB|E9PPJ3494 SMTNL1 "Smoothelin-like protei 0.734 0.342 0.345 1.4e-19
MGI|MGI:2442764456 Smtnl2 "smoothelin-like 2" [Mu 0.839 0.423 0.331 1.4e-19
UNIPROTKB|C9J621512 SMTNL1 "Smoothelin-like protei 0.734 0.330 0.345 1.5e-19
MGI|MGI:1915928459 Smtnl1 "smoothelin-like 1" [Mu 0.513 0.257 0.414 1.8e-19
UNIPROTKB|E2R238482 SMTNL1 "Uncharacterized protei 0.513 0.244 0.414 5.8e-19
UNIPROTKB|P53814 SMTN "Smoothelin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 269 (99.8 bits), Expect = 3.8e-22, P = 3.8e-22
 Identities = 75/227 (33%), Positives = 117/227 (51%)

Query:    15 SPFAKFKQLERQNSAPK-AKGTSETSSAVTTTNGNVTKTEVHKRVLSQTASTHRLTKGTS 73
             S   K ++L   N   + A+ T+  SS V  +      T +  +  S ++S+ ++     
Sbjct:   664 STVTKTERLVHSNDGTRTARTTTVESSFVRRSENGSGSTMMQTKTFSSSSSSKKMGSIFD 723

Query:    74 ETSSAVTTTNGNVTKTEVHKRVLSQTASTHRLTKANSVQVPSTPASPFAK--FKQLERQN 131
                 A +   G++   E  KR   Q      L KA S+  P T AS   K   ++LE++ 
Sbjct:   724 REDQA-SPRAGSLAALE--KR---QAEKKKELMKAQSL--PKTSASQARKAMIEKLEKEG 775

Query:   132 SAPNARSESPLFKITEPNLARSASSIKDRMLSW---------NVQIDNFSTSWNDGMAFC 182
             +A +        + +      +A+SIK  +L W         +V I NFS+SW+DGMAFC
Sbjct:   776 AAGSPGGPRAAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFC 835

Query:   183 ALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLMPLLDVEDI 229
             AL+H+F+P AFD+ +LSPQ RR NFE+AF  AE   D +PL++V+D+
Sbjct:   836 ALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDM 882
GO:0005737 "cytoplasm" evidence=IEA
GO:0007517 "muscle organ development" evidence=TAS
GO:0003779 "actin binding" evidence=TAS
GO:0005856 "cytoskeleton" evidence=TAS
GO:0006939 "smooth muscle contraction" evidence=TAS
GO:0008307 "structural constituent of muscle" evidence=TAS
GO:0015629 "actin cytoskeleton" evidence=TAS
MGI|MGI:1354727 Smtn "smoothelin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00020530 T15B12.1a [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050306-23 smtnl1 "smoothelin-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A8MU46 SMTNL1 "Smoothelin-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PPJ3 SMTNL1 "Smoothelin-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2442764 Smtnl2 "smoothelin-like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|C9J621 SMTNL1 "Smoothelin-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1915928 Smtnl1 "smoothelin-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R238 SMTNL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 3e-17
smart00033101 smart00033, CH, Calponin homology domain 3e-13
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 2e-12
pfam1197185 pfam11971, CAMSAP_CH, CAMSAP CH domain 3e-09
COG5069 612 COG5069, SAC6, Ca2+-binding actin-bundling protein 3e-09
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information 
 Score = 74.2 bits (183), Expect = 3e-17
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 11/83 (13%)

Query: 158 KDRMLSW---------NVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQ--QRRHN 206
           +  +L W          + + NF     DG+A CAL++   P   D  K++     +  N
Sbjct: 1   EKALLRWINEVLGEYGGLPVTNFFEDLRDGLALCALLNKLRPGLIDLKKVNKNRFDKLEN 60

Query: 207 FELAFRVAEEEADLMPLLDVEDI 229
             LA   AE++  +  +L+ ED+
Sbjct: 61  LNLALEFAEKKLGVPKVLEPEDL 83

The CH domain is found in both cytoskeletal proteins and signal transduction proteins. The CH domain is involved in actin binding in some members of the family. However in calponins there is evidence that the CH domain is not involved in its actin binding activity. Most member proteins have from two to four copies of the CH domain, however some proteins such as calponin have only a single copy. Length = 104
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|221350 pfam11971, CAMSAP_CH, CAMSAP CH domain Back     alignment and domain information
>gnl|CDD|227401 COG5069, SAC6, Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
KOG0517|consensus 2473 99.84
KOG0035|consensus 890 99.61
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.4
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 99.38
cd00014107 CH Calponin homology domain; actin-binding domain 99.27
smart00033103 CH Calponin homology domain. Actin binding domains 99.25
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 99.07
KOG0046|consensus 627 96.8
KOG0035|consensus 890 95.88
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 94.25
KOG0046|consensus627 92.52
KOG0518|consensus 1113 87.21
KOG2046|consensus193 83.63
KOG3631|consensus365 81.33
>KOG0517|consensus Back     alignment and domain information 
Probab=99.84  E-value=5.2e-22  Score=209.27  Aligned_cols=79  Identities=51%  Similarity=0.805  Sum_probs=76.6

Q ss_pred             cCCccchhHhhhcC---------cccccCCCCCCccchhhhHHHHhhCCCCCCcCccCccCHHHHHHHHHHHHHHhCCCC
Q psy7483         151 ARSASSIKDRMLSW---------NVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLM  221 (230)
Q Consensus       151 ~r~~~saK~aLL~W---------~v~ItNFSsSWrDG~ALCALIH~~rPdLIDydsL~~~~~~eNlelAFdvAE~eLGIp  221 (230)
                      .+...++|++||.|         +|+|+|||+||+||+||.||||++|||||||++|.+.++.+|++.||++||++|||+
T Consensus       162 n~E~rSAKDALLLWCQmKTAGYpnVNI~nFTtSWRdGLaFNALIHkHRPDLvDf~~L~k~na~~NL~~AFdvAE~~LGia  241 (2473)
T KOG0517|consen  162 NRETRSAKDALLLWCQMKTAGYPNVNITNFTTSWRDGLAFNALIHKHRPDLVDFDKLKKSNALYNLQHAFDVAEQELGIA  241 (2473)
T ss_pred             chhhhhHHHHHHHHHHhhccCCCCcccccCccchhcchhHHHHHHhcCcchhhhcccCCCchhhHHHHHHHHHHHHcCch
Confidence            44678999999999         899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCC
Q psy7483         222 PLLDVEDI  229 (230)
Q Consensus       222 ~LLdpEDm  229 (230)
                      +|||||||
T Consensus       242 ~LLDpEDV  249 (2473)
T KOG0517|consen  242 KLLDPEDV  249 (2473)
T ss_pred             hcCCHhhc
Confidence            99999997

>KOG0035|consensus Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0518|consensus Back     alignment and domain information
>KOG2046|consensus Back     alignment and domain information
>KOG3631|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2d87_A128 Solution Structure Of The Ch Domain From Human Smoo 6e-22
2jv9_A119 The Solution Structure Of Calponin Homology Domain 2e-19
1bkr_A109 Calponin Homology (Ch) Domain From Human Beta-Spect 2e-13
1aa2_A108 Calponin Homology (Ch) Domain From Human Beta-Spect 2e-13
1wyq_A127 Solution Structure Of The Second Ch Domain Of Human 3e-12
2eyi_A234 Crystal Structure Of The Actin-Binding Domain Of Hu 3e-12
1tjt_A250 X-Ray Structure Of The Human Alpha-Actinin Isoform 7e-12
1wku_A254 High Resolution Structure Of The Human Alpha-Actini 8e-12
1sjj_A 863 Cryo-Em Structure Of Chicken Gizzard Smooth Muscle 5e-11
2r0o_A237 Crystal Structure Of The Actin-Binding Domain Of Hu 1e-10
2d88_A121 Solution Structure Of The Ch Domain From Human Mica 4e-10
1sh5_A245 Crystal Structure Of Actin-Binding Domain Of Mouse 6e-09
2d89_A119 Solution Structure Of The Ch Domain From Human Eh D 1e-08
3f7p_A296 Crystal Structure Of A Complex Between Integrin Bet 1e-08
2e9k_A121 Solution Structure Of The Ch Domain From Human Mica 2e-08
1mb8_A243 Crystal Structure Of The Actin Binding Domain Of Pl 2e-08
1dxx_A246 N-Terminal Actin-Binding Domain Of Human Dystrophin 1e-07
1qag_A226 Actin Binding Region Of The Dystrophin Homologue Ut 7e-07
1bhd_A118 Second Calponin Homology Domain From Utrophin Lengt 9e-07
1wyl_A116 Solution Structure Of The Ch Domain Of Human Nedd9 1e-05
2dk9_A118 Solution Structure Of Calponin Homology Domain Of H 7e-05
>pdb|2D87|A Chain A, Solution Structure Of The Ch Domain From Human Smoothelin Splice Isoform L2 Length = 128 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (249), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 9/86 (10%)
Query: 153 SASSIKDRMLSW---------NVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQR 203
            +S IK  +L W         +V I NFS+SW+DGMAFCAL+H+F+P AFD+ +LSPQ R
Sbjct: 4   GSSGIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNR 63
Query: 204 RHNFELAFRVAEEEADLMPLLDVEDI 229
           R NFE+AF  AE  AD   LLD ED+
Sbjct: 64  RQNFEVAFSSAETHADCPQLLDTEDM 89
>pdb|2JV9|A Chain A, The Solution Structure Of Calponin Homology Domain From Smoothelin-Like 1 Length = 119 Back     alignment and structure
>pdb|1BKR|A Chain A, Calponin Homology (Ch) Domain From Human Beta-Spectrin At 1.1 Angstrom Resolution Length = 109 Back     alignment and structure
>pdb|1AA2|A Chain A, Calponin Homology (Ch) Domain From Human Beta-Spectrin Length = 108 Back     alignment and structure
>pdb|1WYQ|A Chain A, Solution Structure Of The Second Ch Domain Of Human Spectrin Beta Chain, Brain 2 Length = 127 Back     alignment and structure
>pdb|2EYI|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin 1 At 1.7 Angstrom Resolution Length = 234 Back     alignment and structure
>pdb|1TJT|A Chain A, X-Ray Structure Of The Human Alpha-Actinin Isoform 3 At 2.2a Resolution Length = 250 Back     alignment and structure
>pdb|1WKU|A Chain A, High Resolution Structure Of The Human Alpha-Actinin Isoform 3 Length = 254 Back     alignment and structure
>pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 Back     alignment and structure
>pdb|2R0O|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin-4 Mutant(K255e) Length = 237 Back     alignment and structure
>pdb|2D88|A Chain A, Solution Structure Of The Ch Domain From Human Mical-3 Protein Length = 121 Back     alignment and structure
>pdb|1SH5|A Chain A, Crystal Structure Of Actin-Binding Domain Of Mouse Plectin Length = 245 Back     alignment and structure
>pdb|2D89|A Chain A, Solution Structure Of The Ch Domain From Human Eh Domain Binding Protein 1 Length = 119 Back     alignment and structure
>pdb|3F7P|A Chain A, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 296 Back     alignment and structure
>pdb|2E9K|A Chain A, Solution Structure Of The Ch Domain From Human Mical-2 Length = 121 Back     alignment and structure
>pdb|1MB8|A Chain A, Crystal Structure Of The Actin Binding Domain Of Plectin Length = 243 Back     alignment and structure
>pdb|1DXX|A Chain A, N-Terminal Actin-Binding Domain Of Human Dystrophin Length = 246 Back     alignment and structure
>pdb|1QAG|A Chain A, Actin Binding Region Of The Dystrophin Homologue Utrophin Length = 226 Back     alignment and structure
>pdb|1BHD|A Chain A, Second Calponin Homology Domain From Utrophin Length = 118 Back     alignment and structure
>pdb|1WYL|A Chain A, Solution Structure Of The Ch Domain Of Human Nedd9 Interacting Protein With Calponin Homology And Lim Domains Length = 116 Back     alignment and structure
>pdb|2DK9|A Chain A, Solution Structure Of Calponin Homology Domain Of Human Mical-1 Length = 118 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2d88_A121 Protein mical-3; all alpha, calponin homology doma 5e-36
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 9e-36
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 2e-35
1wyl_A116 NEDD9 interacting protein with calponin homology a 2e-35
1bhd_A118 Utrophin; calponin homology, actin binding, struct 3e-35
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 6e-35
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 8e-33
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 6e-28
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 1e-24
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 2e-23
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 6e-23
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 3e-20
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 2e-19
3hoc_A272 Filamin-A; calponin homology domain, actin binding 5e-19
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 6e-19
1pxy_A506 Fimbrin-like protein; calponin homology, F-actin-b 3e-14
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 3e-18
1rt8_A513 Fimbrin; filamentous actin binding domain (ABD), c 1e-15
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 5e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Length = 121 Back     alignment and structure
 Score =  122 bits (309), Expect = 5e-36
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 9/86 (10%)

Query: 153 SASSIKDRMLSW---------NVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQR 203
           S  +   ++L W          V + + + SW  G+A CA+IH + P   DFD L  Q  
Sbjct: 6   SGVARSSKLLGWCQRQTDGYAGVNVTDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNV 65

Query: 204 RHNFELAFRVAEEEADLMPLLDVEDI 229
             N +LAF +AE+E  + P++  +++
Sbjct: 66  EKNNQLAFDIAEKELGISPIMTGKEM 91
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Length = 109 Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Length = 128 Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Length = 116 Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Length = 118 Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Length = 254 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Length = 245 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Length = 296 Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Length = 246 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 99.93
1wyl_A116 NEDD9 interacting protein with calponin homology a 99.93
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 99.93
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 99.92
2d88_A121 Protein mical-3; all alpha, calponin homology doma 99.92
1bhd_A118 Utrophin; calponin homology, actin binding, struct 99.92
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 99.9
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 99.83
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 99.83
3hoc_A272 Filamin-A; calponin homology domain, actin binding 99.83
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 99.83
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 99.81
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 99.8
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 99.78
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 99.72
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 99.7
1rt8_A513 Fimbrin; filamentous actin binding domain (ABD), c 99.67
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.66
1pxy_A506 Fimbrin-like protein; calponin homology, F-actin-b 99.65
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 99.63
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.62
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 97.62
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 97.0
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 96.79
1wku_A 254 Alpha-actinin 3; calponin homology domain, actin b 96.76
3hoc_A 272 Filamin-A; calponin homology domain, actin binding 96.65
2wa7_A 245 Filamin-B; disease mutation, skeletal dysplasia, s 96.62
3f7p_A 296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 96.62
2qjz_A123 Microtubule-associated protein RP/EB family member 96.54
1ujo_A144 Transgelin; CH domain, actin binding, structural g 96.19
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 96.08
1aoa_A 275 T-fimbrin; actin-binding protein, calcium-binding, 96.05
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 95.96
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 95.95
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 95.68
1dxx_A 246 Dystrophin; structural protein, muscular dystrophy 95.67
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 95.65
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 95.48
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 95.47
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 95.38
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 95.29
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 95.15
1sh5_A 245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 94.99
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 94.73
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 94.69
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 94.28
2r8u_A 268 Microtubule-associated protein RP/EB family member 93.01
2bry_A497 NEDD9 interacting protein with calponin homology a 92.96
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 90.13
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 90.02
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 89.05
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
Probab=99.93  E-value=2.8e-27  Score=185.36  Aligned_cols=76  Identities=53%  Similarity=0.825  Sum_probs=73.0

Q ss_pred             cchhHhhhcC---------cccccCCCCCCccchhhhHHHHhhCCCCCCcCccCccCHHHHHHHHHHHHHHhCCCCCCCC
Q psy7483         155 SSIKDRMLSW---------NVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLMPLLD  225 (230)
Q Consensus       155 ~saK~aLL~W---------~v~ItNFSsSWrDG~ALCALIH~~rPdLIDydsL~~~~~~eNlelAFdvAE~eLGIp~LLd  225 (230)
                      .+++++||+|         +++|+||++||+||+|||||||+|+|++|||+.|.+.++.+|+++||++||++||||++|+
T Consensus         2 ~s~k~~LL~W~q~~~~~y~~v~v~nFs~sw~dG~af~aLih~~~P~lid~~~l~~~~~~~n~~~af~~Ae~~lgi~~ll~   81 (109)
T 1bkr_A            2 KSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLD   81 (109)
T ss_dssp             CHHHHHHHHHHHHHTTTCTTCCCSSSSGGGTTSHHHHHHHHHHCGGGCCGGGCCTTCHHHHHHHHHHHHHHHHCCCCCCC
T ss_pred             CCHHHHHHHHHHHHHccCCCCCCCCCcccccccHHHHHHHHHHCcCCCCHHHcCcCCHHHHHHHHHHHHHHHcCCCccCC
Confidence            4689999999         6899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCC
Q psy7483         226 VEDIH  230 (230)
Q Consensus       226 pEDmv  230 (230)
                      ||||+
T Consensus        82 ~eDv~   86 (109)
T 1bkr_A           82 PEDIS   86 (109)
T ss_dssp             HHHHS
T ss_pred             HHHcc
Confidence            99974
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d1bhda_108 a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxI 9e-26
d1sh5a2110 a.40.1.1 (A:128-237) Actin binding domain of plect 2e-23
d1bkra_108 a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) 6e-23
d1dxxa2127 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapie 3e-21
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-17
d1pxya_500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 1e-15
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 7e-17
d1rt8a_505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 7e-17
d1aoaa2116 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros 9e-11
d1wjoa_124 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 9e-10
d1sh5a1120 a.40.1.1 (A:8-127) Actin binding domain of plectin 4e-05
d1dxxa1111 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens 6e-04
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Utrophin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 94.5 bits (235), Expect = 9e-26
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 155 SSIKDRMLSW---------NVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRH 205
           ++ +  +LSW          V + NF+TSW DG+AF A++H   P  F +DK+       
Sbjct: 4   TNSEKILLSWVRQTTRPYSQVNVLNFTTSWTDGLAFNAVLHRHKPDLFSWDKVVKMSPIE 63

Query: 206 NFELAFRVAEEEADLMPLLDVEDI 229
             E AF  A+    +  LLD ED+
Sbjct: 64  RLEHAFSKAQTYLGIEKLLDPEDV 87
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 99.92
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 99.63
d1rt8a_505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 99.63
d1pxya_500 Fimbrin (Plastin), actin-crosslinking domain {Thal 99.55
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 99.54
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.53
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.51
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 98.08
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 97.82
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 96.86
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 96.73
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 96.44
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 96.27
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Actin binding domain of plectin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.92  E-value=4.8e-27  Score=182.65  Aligned_cols=78  Identities=38%  Similarity=0.689  Sum_probs=74.7

Q ss_pred             CccchhHhhhcC---------cccccCCCCCCccchhhhHHHHhhCCCCCCcCccCccCHHHHHHHHHHHHHHhCCCCCC
Q psy7483         153 SASSIKDRMLSW---------NVQIDNFSTSWNDGMAFCALIHHFYPHAFDFDKLSPQQRRHNFELAFRVAEEEADLMPL  223 (230)
Q Consensus       153 ~~~saK~aLL~W---------~v~ItNFSsSWrDG~ALCALIH~~rPdLIDydsL~~~~~~eNlelAFdvAE~eLGIp~L  223 (230)
                      +..++|++||.|         +++|+||++||+||+|||||||+|+|++|||+.+++.++.+|+++||++||++||||++
T Consensus         3 e~~s~k~~LL~W~~~~~~~y~~v~v~nFs~sw~DG~afcaLih~~~P~~id~~~l~~~~~~~~~~~a~~~Ae~~lgip~l   82 (110)
T d1sh5a2           3 EDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRL   82 (110)
T ss_dssp             SSCCHHHHHHHHHHHHTTTSTTCCCCCSSGGGTTSHHHHHHHHTTCTTTCCHHHHHHSCHHHHHHHHHHHHHHHHCCCCC
T ss_pred             cccCHHHHHHHHHHHHcCCCCCeeccCCcccccCcHHHHHHHHHHCcccCChhhcCccCHHHHHHHHHHHHHHcCCCCCC
Confidence            457899999999         78999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCC
Q psy7483         224 LDVEDIH  230 (230)
Q Consensus       224 LdpEDmv  230 (230)
                      |+|+||+
T Consensus        83 l~~eD~~   89 (110)
T d1sh5a2          83 LDPEDVD   89 (110)
T ss_dssp             CCHHHHS
T ss_pred             CCHHHHc
Confidence            9999974
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure