Psyllid ID: psy7519

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MGLYMIFPVGLFHYFNQPEYFENFVINYNKEKYIDKNNVVLMKNTIKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLMTLGFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLPDTTGLADNLHQLENDVPIQTPLVSTPIKRRKLNLWRKPYA
cccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccHHHHHcccccccccc
ccEEEEEcccHEEccccccHHHEEEEEccccEEEccccEEEEHcHHHHHHHHcHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHEEEEEEEEccHcHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHcccccHHHHHHHcccccccccccccHcccccHcccccc
mglymifpvglfhyfnqpeyfENFVINYNkekyidknNVVLMKNTIKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLmtlgfapgsfITISLAMVGKFaisssnviipiytaelfptkmrnlgvgassvpAGVALILIPYlwhmqsinihfpmGLLGVVGVLGGLsvlllpdttgladnlhqlendvpiqtplvstpikrrklnlwrkpya
MGLYMIFPVGLFHYFNQPEYFENFVINYNKEkyidknnvVLMKNTIKEMREKSDKEYLEKleknsngwQVCNIFIKRHLMTLGFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLPDTTGLADNLHQlendvpiqtplvstpikrrklnlwrkpya
MGLYMIFPVGLFHYFNQPEYFENFVINYNKEKYIDKNNVVLMKNTIKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLMTLGFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMgllgvvgvlgglsvlllPDTTGLADNLHQLENDVPIQTPLVSTPIKRRKLNLWRKPYA
**LYMIFPVGLFHYFNQPEYFENFVINYNKEKYIDKNNVVLMKNTI****************KNSNGWQVCNIFIKRHLMTLGFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLPDTTGLADNLHQLENDVPIQTPLVSTPIKRRKLNLW*****
*GLYMIFPVGLFHYFNQPEYFENFVINYNKEKYIDKNNVVLMKNTIKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLMTLGFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLPDTTGLADNLHQ*****************************
MGLYMIFPVGLFHYFNQPEYFENFVINYNKEKYIDKNNVVLMKNTIKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLMTLGFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLPDTTGLADNLHQLENDVPIQTPLVSTPIKRRKLNLWRKPYA
*GLYMIFPVGLFHYFNQPEYFENFVINYNKEKYIDKNNVVLMKNTIKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLMTLGFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLPDTTGLADNLHQLEND*************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLYMIFPVGLFHYFNQPEYFENFVINYNKEKYIDKNNVVLMKNTIKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLMTLGFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLPDTTGLADNLHQLENDVPIQTPLVSTPIKRRKLNLWRKPYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query213 2.2.26 [Sep-21-2011]
Q9Z306553 Solute carrier family 22 yes N/A 0.464 0.179 0.376 1e-12
Q9R141553 Solute carrier family 22 no N/A 0.464 0.179 0.366 2e-12
Q9WTN6564 Solute carrier family 22 no N/A 0.427 0.161 0.362 2e-12
Q9Z0E8557 Solute carrier family 22 no N/A 0.455 0.174 0.363 5e-12
O70594557 Solute carrier family 22 no N/A 0.455 0.174 0.363 5e-12
A9CB25551 Solute carrier family 22 N/A N/A 0.464 0.179 0.356 7e-12
Q9H015551 Solute carrier family 22 yes N/A 0.464 0.179 0.356 1e-11
Q66KG0566 Solute carrier family 22 N/A N/A 0.427 0.160 0.362 2e-11
O76082557 Solute carrier family 22 no N/A 0.455 0.174 0.353 3e-11
Q86VW1577 Solute carrier family 22 no N/A 0.389 0.143 0.445 5e-11
>sp|Q9Z306|S22A4_MOUSE Solute carrier family 22 member 4 OS=Mus musculus GN=Slc22a4 PE=1 SV=1 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 65/101 (64%), Gaps = 2/101 (1%)

Query: 89  FITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALILIPYLWHMQS 148
           F++I L M+GKF I+S+  ++ ++TAEL+PT +RN+ VG +S+ + V  I+ PY  ++ +
Sbjct: 426 FVSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGITSMASRVGSIIAPYFVYLGA 485

Query: 149 INIHFPMGLLGVVGVLGGLSVLLLPDTTG--LADNLHQLEN 187
            N   P  L+G + VL G+  L  P++ G  L +NL Q++ 
Sbjct: 486 YNRLLPYILMGSLTVLIGIITLFFPESFGVTLPENLEQMQK 526
Sodium-ion dependent, low affinity carnitine transporter. Probably transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 1.78.
Mus musculus (taxid: 10090)
>sp|Q9R141|S22A4_RAT Solute carrier family 22 member 4 OS=Rattus norvegicus GN=Slc22a4 PE=1 SV=1 Back     alignment and function description
>sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z0E8|S22A5_MOUSE Solute carrier family 22 member 5 OS=Mus musculus GN=Slc22a5 PE=1 SV=1 Back     alignment and function description
>sp|O70594|S22A5_RAT Solute carrier family 22 member 5 OS=Rattus norvegicus GN=Slc22a5 PE=1 SV=1 Back     alignment and function description
>sp|A9CB25|S22A4_PAPAN Solute carrier family 22 member 4 OS=Papio anubis GN=SLC22A4 PE=3 SV=1 Back     alignment and function description
>sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 Back     alignment and function description
>sp|Q66KG0|S22AG_XENLA Solute carrier family 22 member 16 OS=Xenopus laevis GN=slc22a16 PE=2 SV=2 Back     alignment and function description
>sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1 Back     alignment and function description
>sp|Q86VW1|S22AG_HUMAN Solute carrier family 22 member 16 OS=Homo sapiens GN=SLC22A16 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
242006464 549 organic cation transporter, putative [Pe 0.544 0.211 0.541 3e-26
328723345 599 PREDICTED: organic cation transporter pr 0.474 0.168 0.558 6e-26
328723349 609 PREDICTED: organic cation transporter pr 0.474 0.165 0.558 7e-26
91077168 532 PREDICTED: similar to CG6006 CG6006-PC [ 0.474 0.189 0.485 7e-22
347969114 696 AGAP003038-PA [Anopheles gambiae str. PE 0.446 0.136 0.432 4e-17
157106176 676 organic cation transporter [Aedes aegypt 0.403 0.127 0.476 5e-17
312371997 1255 hypothetical protein AND_20724 [Anophele 0.446 0.075 0.422 7e-17
194901220 564 GG16983 [Drosophila erecta] gi|190651853 0.450 0.170 0.5 8e-17
161078338 603 CG6006, isoform C [Drosophila melanogast 0.450 0.159 0.5 8e-17
195570452 564 GD19077 [Drosophila simulans] gi|1941991 0.450 0.170 0.5 9e-17
>gi|242006464|ref|XP_002424070.1| organic cation transporter, putative [Pediculus humanus corporis] gi|212507376|gb|EEB11332.1| organic cation transporter, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (71%), Gaps = 4/120 (3%)

Query: 61  LEKNSNGWQVCNIFIK---RHLMTLGFAPG-SFITISLAMVGKFAISSSNVIIPIYTAEL 116
           L K    W +C  F+      LMTL F      +TI+LAM GKF+I+SSN I P+YTAEL
Sbjct: 416 LLKMGRRWPLCLTFLGGGIACLMTLFFGEDRETVTITLAMFGKFSIASSNAIAPVYTAEL 475

Query: 117 FPTKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLPDTT 176
           FPT +RNLGVG+S+V AG+AL+L+PYLW++ SI+   PM LLGV G++GG+SVL L +T+
Sbjct: 476 FPTVIRNLGVGSSNVAAGLALVLVPYLWNLASIDFRLPMTLLGVFGIVGGVSVLFLEETS 535

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328723345|ref|XP_003247821.1| PREDICTED: organic cation transporter protein-like isoform 2 [Acyrthosiphon pisum] gi|328723347|ref|XP_001944418.2| PREDICTED: organic cation transporter protein-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328723349|ref|XP_003247822.1| PREDICTED: organic cation transporter protein-like isoform 3 [Acyrthosiphon pisum] gi|328723351|ref|XP_003247823.1| PREDICTED: organic cation transporter protein-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91077168|ref|XP_972002.1| PREDICTED: similar to CG6006 CG6006-PC [Tribolium castaneum] gi|270001712|gb|EEZ98159.1| hypothetical protein TcasGA2_TC000585 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|347969114|ref|XP_311838.5| AGAP003038-PA [Anopheles gambiae str. PEST] gi|333467692|gb|EAA07911.5| AGAP003038-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157106176|ref|XP_001649202.1| organic cation transporter [Aedes aegypti] gi|108879896|gb|EAT44121.1| AAEL004464-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312371997|gb|EFR20050.1| hypothetical protein AND_20724 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|194901220|ref|XP_001980150.1| GG16983 [Drosophila erecta] gi|190651853|gb|EDV49108.1| GG16983 [Drosophila erecta] Back     alignment and taxonomy information
>gi|161078338|ref|NP_001097812.1| CG6006, isoform C [Drosophila melanogaster] gi|124248420|gb|ABM92830.1| IP17430p [Drosophila melanogaster] gi|158030279|gb|ABW08686.1| CG6006, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195570452|ref|XP_002103221.1| GD19077 [Drosophila simulans] gi|194199148|gb|EDX12724.1| GD19077 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
FB|FBgn0063649603 CG6006 [Drosophila melanogaste 0.356 0.126 0.513 7.2e-14
ZFIN|ZDB-GENE-091012-1549 slc22a5 "solute carrier family 0.507 0.196 0.339 5e-11
FB|FBgn0038404670 CG8925 [Drosophila melanogaste 0.300 0.095 0.453 1.4e-10
MGI|MGI:2143107551 Slc22a13 "solute carrier famil 0.610 0.235 0.316 5.9e-10
UNIPROTKB|E1BEU0553 SLC22A4 "Uncharacterized prote 0.507 0.195 0.294 9.8e-10
MGI|MGI:1353479553 Slc22a4 "solute carrier family 0.464 0.179 0.316 9.8e-10
RGD|1306840551 Slc22a13 "solute carrier famil 0.610 0.235 0.316 1.3e-09
RGD|621149553 Slc22a4 "solute carrier family 0.464 0.179 0.306 1.3e-09
UNIPROTKB|F1NXX1557 F1NXX1 "Uncharacterized protei 0.450 0.172 0.336 1.3e-09
MGI|MGI:1329012557 Slc22a5 "solute carrier family 0.455 0.174 0.323 1.3e-09
FB|FBgn0063649 CG6006 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 7.2e-14, P = 7.2e-14
 Identities = 39/76 (51%), Positives = 53/76 (69%)

Query:    80 MTLGFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVALIL 139
             +T G A   ++ I+  M+GKF IS+ N I+P+YTAEL+PT +RN+GVGA +V AG+ALIL
Sbjct:   486 ITEGHADLLWLKITFLMMGKFTISAGNTIMPVYTAELYPTPIRNVGVGACNVAAGLALIL 545

Query:   140 IPYLWHMQSINIHFPM 155
              PYL  +  I  H  M
Sbjct:   546 TPYLSLLNKIEGHLLM 561
GO:0015226 "carnitine transmembrane transporter activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
ZFIN|ZDB-GENE-091012-1 slc22a5 "solute carrier family 22 (organic cation/carnitine transporter), member 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0038404 CG8925 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:2143107 Slc22a13 "solute carrier family 22 (organic cation transporter), member 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEU0 SLC22A4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1353479 Slc22a4 "solute carrier family 22 (organic cation transporter), member 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306840 Slc22a13 "solute carrier family 22 (organic anion transporter), member 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|621149 Slc22a4 "solute carrier family 22 (organic cation transporter), member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXX1 F1NXX1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1329012 Slc22a5 "solute carrier family 22 (organic cation transporter), member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
TIGR00898505 TIGR00898, 2A0119, cation transport protein 4e-18
pfam0980380 pfam09803, DUF2346, Uncharacterized conserved prot 7e-15
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 3e-05
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information 
 Score = 81.6 bits (202), Expect = 4e-18
 Identities = 41/101 (40%), Positives = 63/101 (62%), Gaps = 2/101 (1%)

Query: 79  LMTLGFAPG--SFITISLAMVGKFAISSSNVIIPIYTAELFPTKMRNLGVGASSVPAGVA 136
           L+ L F P    F+  +LA++GKF I+S+  ++ +YTAEL+PT +RNLGVG  S  A V 
Sbjct: 399 LLLLLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVG 458

Query: 137 LILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLPDTTG 177
            I+ P+L ++    +  P+ L G + +L G+  L LP+T G
Sbjct: 459 SIISPFLVYLGEKWLFLPLVLFGGLALLAGILTLFLPETKG 499

[Transport and binding proteins, Cations and iron carrying compounds]. Length = 505
>gnl|CDD|150467 pfam09803, DUF2346, Uncharacterized conserved protein (DUF2346) Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
KOG0253|consensus528 99.75
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.65
KOG0569|consensus485 99.57
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.56
TIGR00898505 2A0119 cation transport protein. 99.53
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.5
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.48
TIGR00893 399 2A0114 d-galactonate transporter. 99.48
TIGR00898 505 2A0119 cation transport protein. 99.47
KOG0569|consensus 485 99.47
KOG0255|consensus 521 99.46
PRK10642490 proline/glycine betaine transporter; Provisional 99.41
PRK10642 490 proline/glycine betaine transporter; Provisional 99.41
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.39
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.37
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.36
KOG0254|consensus 513 99.36
TIGR00891 405 2A0112 putative sialic acid transporter. 99.35
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.35
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.35
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.33
PRK09952 438 shikimate transporter; Provisional 99.33
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.33
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.32
PRK11663 434 regulatory protein UhpC; Provisional 99.32
TIGR00895 398 2A0115 benzoate transport. 99.31
KOG0252|consensus538 99.31
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.31
PRK03545 390 putative arabinose transporter; Provisional 99.3
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.3
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.3
KOG0254|consensus513 99.29
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.29
TIGR00900 365 2A0121 H+ Antiporter protein. 99.28
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.27
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.27
PRK12307 426 putative sialic acid transporter; Provisional 99.27
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.26
KOG2615|consensus 451 99.26
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.25
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.24
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.24
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.23
KOG0255|consensus521 99.23
PRK10091 382 MFS transport protein AraJ; Provisional 99.22
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.2
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.2
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.2
PRK10054 395 putative transporter; Provisional 99.2
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.2
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.18
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.17
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.17
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.17
PRK03699 394 putative transporter; Provisional 99.16
PRK15075 434 citrate-proton symporter; Provisional 99.16
PLN00028 476 nitrate transmembrane transporter; Provisional 99.15
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.15
KOG2532|consensus 466 99.14
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.14
PRK03893 496 putative sialic acid transporter; Provisional 99.14
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.11
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.11
KOG1330|consensus 493 99.11
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.11
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.11
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.09
PRK10504 471 putative transporter; Provisional 99.09
PRK09705 393 cynX putative cyanate transporter; Provisional 99.08
PRK11043 401 putative transporter; Provisional 99.08
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.07
PRK09952438 shikimate transporter; Provisional 99.07
PRK09874 408 drug efflux system protein MdtG; Provisional 99.06
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.05
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.04
PTZ00207 591 hypothetical protein; Provisional 99.01
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.01
PRK03893496 putative sialic acid transporter; Provisional 99.0
PRK10489 417 enterobactin exporter EntS; Provisional 98.99
PRK12382 392 putative transporter; Provisional 98.99
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 98.99
PRK05122 399 major facilitator superfamily transporter; Provisi 98.98
PRK05122399 major facilitator superfamily transporter; Provisi 98.98
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 98.96
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.96
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.95
PRK10489417 enterobactin exporter EntS; Provisional 98.95
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 98.94
PRK15011393 sugar efflux transporter B; Provisional 98.93
KOG3764|consensus 464 98.92
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 98.92
KOG0252|consensus 538 98.9
TIGR00805 633 oat sodium-independent organic anion transporter. 98.9
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 98.9
TIGR00901 356 2A0125 AmpG-related permease. 98.9
PRK15462 493 dipeptide/tripeptide permease D; Provisional 98.9
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.89
PRK10207 489 dipeptide/tripeptide permease B; Provisional 98.89
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.88
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 98.87
PRK10406432 alpha-ketoglutarate transporter; Provisional 98.85
PRK09528420 lacY galactoside permease; Reviewed 98.83
KOG2533|consensus 495 98.83
TIGR00896 355 CynX cyanate transporter. This family of proteins 98.83
KOG0253|consensus 528 98.82
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 98.81
PRK11010 491 ampG muropeptide transporter; Validated 98.8
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.8
PRK03633 381 putative MFS family transporter protein; Provision 98.8
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.8
PRK12382392 putative transporter; Provisional 98.79
PRK10133 438 L-fucose transporter; Provisional 98.78
PLN00028476 nitrate transmembrane transporter; Provisional 98.76
TIGR00897 402 2A0118 polyol permease family. This family of prot 98.75
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.74
PRK12307426 putative sialic acid transporter; Provisional 98.73
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.73
PRK11902 402 ampG muropeptide transporter; Reviewed 98.72
PRK09705393 cynX putative cyanate transporter; Provisional 98.7
PRK15011 393 sugar efflux transporter B; Provisional 98.7
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.69
TIGR00893399 2A0114 d-galactonate transporter. 98.66
PRK09874408 drug efflux system protein MdtG; Provisional 98.65
PRK09584 500 tppB putative tripeptide transporter permease; Rev 98.62
PRK15075434 citrate-proton symporter; Provisional 98.62
PRK11010491 ampG muropeptide transporter; Validated 98.61
PRK10504471 putative transporter; Provisional 98.59
TIGR00891405 2A0112 putative sialic acid transporter. 98.58
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.57
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 98.55
PRK09528 420 lacY galactoside permease; Reviewed 98.53
TIGR00892455 2A0113 monocarboxylate transporter 1. 98.52
PRK03699394 putative transporter; Provisional 98.52
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 98.51
PRK11663434 regulatory protein UhpC; Provisional 98.5
KOG2504|consensus 509 98.5
PRK03545390 putative arabinose transporter; Provisional 98.48
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 98.46
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 98.46
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 98.46
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 98.44
PRK03633381 putative MFS family transporter protein; Provision 98.42
TIGR00895398 2A0115 benzoate transport. 98.42
TIGR00897402 2A0118 polyol permease family. This family of prot 98.41
KOG2816|consensus 463 98.38
COG2270438 Permeases of the major facilitator superfamily [Ge 98.36
TIGR00902382 2A0127 phenyl proprionate permease family protein. 98.33
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 98.3
TIGR00900365 2A0121 H+ Antiporter protein. 98.28
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.28
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 98.26
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 98.24
PRK09848448 glucuronide transporter; Provisional 98.24
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 98.23
PRK10429473 melibiose:sodium symporter; Provisional 98.21
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.2
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 98.18
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.17
PRK09669444 putative symporter YagG; Provisional 98.16
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.14
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.09
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.09
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.06
COG2211467 MelB Na+/melibiose symporter and related transport 98.04
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.03
PRK11902402 ampG muropeptide transporter; Reviewed 98.02
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.02
TIGR00788468 fbt folate/biopterin transporter. The only functio 98.01
KOG3762|consensus618 97.99
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 97.98
TIGR00788 468 fbt folate/biopterin transporter. The only functio 97.98
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 97.98
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.97
TIGR01272310 gluP glucose/galactose transporter. Disruption of 97.97
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 97.95
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 97.94
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 97.94
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.93
TIGR00901356 2A0125 AmpG-related permease. 97.93
PF13347428 MFS_2: MFS/sugar transport protein 97.91
TIGR00881379 2A0104 phosphoglycerate transporter family protein 97.9
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.88
PRK11646400 multidrug resistance protein MdtH; Provisional 97.87
KOG2504|consensus509 97.84
PRK11462460 putative transporter; Provisional 97.83
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 97.83
PRK10054395 putative transporter; Provisional 97.83
PRK11043401 putative transporter; Provisional 97.78
PRK14995495 methyl viologen resistance protein SmvA; Provision 97.78
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 97.77
PF13347 428 MFS_2: MFS/sugar transport protein 97.75
KOG4686|consensus459 97.74
PRK10473392 multidrug efflux system protein MdtL; Provisional 97.74
PRK15402406 multidrug efflux system translocase MdfA; Provisio 97.72
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 97.7
PRK10429 473 melibiose:sodium symporter; Provisional 97.69
PRK10091382 MFS transport protein AraJ; Provisional 97.68
PRK11195393 lysophospholipid transporter LplT; Provisional 97.67
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 97.63
PRK10133438 L-fucose transporter; Provisional 97.61
PRK09669 444 putative symporter YagG; Provisional 97.58
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.54
PRK09584500 tppB putative tripeptide transporter permease; Rev 97.54
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 97.5
PRK11462 460 putative transporter; Provisional 97.42
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 97.41
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 97.39
TIGR00896355 CynX cyanate transporter. This family of proteins 97.39
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 97.36
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.33
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.28
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.25
PRK10213394 nepI ribonucleoside transporter; Reviewed 97.23
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 97.19
KOG2563|consensus 480 97.14
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 97.12
PRK10207489 dipeptide/tripeptide permease B; Provisional 97.06
PRK11652394 emrD multidrug resistance protein D; Provisional 96.96
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 96.94
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 96.91
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 96.85
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 96.78
KOG2325|consensus 488 96.74
KOG4702|consensus77 96.7
COG0477 338 ProP Permeases of the major facilitator superfamil 96.61
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 96.55
PRK09848 448 glucuronide transporter; Provisional 96.24
COG2807395 CynX Cyanate permease [Inorganic ion transport and 96.23
COG2211 467 MelB Na+/melibiose symporter and related transport 96.16
KOG2532|consensus466 96.08
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 96.03
PTZ00207591 hypothetical protein; Provisional 96.0
KOG2533|consensus495 95.85
COG0738422 FucP Fucose permease [Carbohydrate transport and m 95.33
PF0980380 DUF2346: Uncharacterized conserved protein (DUF234 95.21
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 94.49
KOG2816|consensus463 94.47
KOG3098|consensus 461 94.41
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 93.65
KOG3098|consensus461 93.44
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 93.29
COG2270 438 Permeases of the major facilitator superfamily [Ge 92.36
KOG3764|consensus464 92.3
KOG2563|consensus480 92.26
KOG3626|consensus 735 92.04
KOG4332|consensus 454 91.98
KOG0637|consensus 498 91.74
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 91.48
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 91.42
PRK15462493 dipeptide/tripeptide permease D; Provisional 91.23
PRK15403413 multidrug efflux system protein MdtM; Provisional 91.03
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 90.63
PF1283277 MFS_1_like: MFS_1 like family 89.57
KOG1330|consensus493 87.04
KOG2615|consensus451 87.02
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 85.06
KOG3810|consensus 433 83.63
KOG3574|consensus 510 80.64
>KOG0253|consensus Back     alignment and domain information 
Probab=99.75  E-value=8.4e-18  Score=133.14  Aligned_cols=135  Identities=21%  Similarity=0.291  Sum_probs=118.0

Q ss_pred             HHHHHHHHhhhHHHHHHHHHHhhcCChhHHHHHHHHHHHHhh--cccCChhHHHHHHHHHHHHhhhcccccceeeccccC
Q psy7519          41 LMKNTIKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLMTL--GFAPGSFITISLAMVGKFAISSSNVIIPIYTAELFP  118 (213)
Q Consensus        41 ~~~~~i~~~~~~~~~~~~~l~dr~GRr~~l~~~~~~~~i~~~--~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~E~~p  118 (213)
                      .++.+..++++.+++++  ++||+|||+.+..+.++++++.+  ....+......+.+...++..+.+.+.|.|+.|++|
T Consensus       387 llitslaefPGlLIt~~--iverlGRKkTMal~l~~f~iflfll~~c~~rn~~tvllf~arafisg~fqvaYvYtPEVyP  464 (528)
T KOG0253|consen  387 LLITSLAEFPGLLITGV--IVERLGRKKTMALSLILFGIFLFLLTTCKTRNAYTVLLFTARAFISGAFQVAYVYTPEVYP  464 (528)
T ss_pred             HHHHHHhhCCchhHHHH--HHHHhcchhHHHHHHHHHHHHHHHHHHhcCcchhHHHHHHHHHHHhchheEEEEecCcccc
Confidence            46677888999999997  99999999999999999999988  334445555667788889999999999999999999


Q ss_pred             cchhhHHHHHHHHHHHHHHHHHHHHHHHhhhcchhhHHHHHHHHHHHHHHHHHcc-CCCC
Q psy7519         119 TKMRNLGVGASSVPAGVALILIPYLWHMQSINIHFPMGLLGVVGVLGGLSVLLLP-DTTG  177 (213)
Q Consensus       119 ~~~R~~~~~~~~~~~~~g~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~lp-et~~  177 (213)
                      +..|++++|.+..++++|+++.|++....+.....+..+++.+++++.++..|+| ||++
T Consensus       465 TavRatgvGtcSsmaRIggI~~p~iA~~~e~s~sl~i~vy~~~~ilagIavcffPiEtkG  524 (528)
T KOG0253|consen  465 TAVRATGVGTCSSMARIGGIFSPVIAMRAELSTSLPIFVYGALFILAGIAVCFFPIETKG  524 (528)
T ss_pred             hhhhhcchhhhhhHHhhhhhhhhHHHHHhccceeehHHHHHHHHHHHHHHheeeeeccCC
Confidence            9999999999999999999999999964455567888999999999999999986 8876

>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>KOG4702|consensus Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF09803 DUF2346: Uncharacterized conserved protein (DUF2346); InterPro: IPR018625 Members of this family of proteins have no known function Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.68
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.48
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.47
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.31
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.27
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.26
2cfq_A417 Lactose permease; transport, transport mechanism, 99.24
2xut_A 524 Proton/peptide symporter family protein; transport 99.12
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.01
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.98
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 98.82
2cfq_A 417 Lactose permease; transport, transport mechanism, 98.21
2xut_A524 Proton/peptide symporter family protein; transport 98.16
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 97.47
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.68  E-value=6e-16  Score=129.15  Aligned_cols=139  Identities=15%  Similarity=0.148  Sum_probs=95.7

Q ss_pred             HHHhhhHHHHHHHHHHhhcCChhHHHHHHHHHHHHhh----cccCChhH--HHH-HHHHHHHHhhhcccccceeeccccC
Q psy7519          46 IKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLMTL----GFAPGSFI--TIS-LAMVGKFAISSSNVIIPIYTAELFP  118 (213)
Q Consensus        46 i~~~~~~~~~~~~~l~dr~GRr~~l~~~~~~~~i~~~----~~~~~~~~--~~~-~~~l~~~~~~~~~~~~~~~~~E~~p  118 (213)
                      +..+++.+.+.  +++||+|||+.++.+...+.++.+    ........  .+. ..+....+..+..++.+.+.+|++|
T Consensus       323 ~~~~~~~~~~~--~l~dr~Grr~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~fP  400 (491)
T 4gc0_A          323 VINLTFTVLAI--MTVDKFGRKPLQIIGALGMAIGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFP  400 (491)
T ss_dssp             HHHHHHHHHHH--HHHHHHCSHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHTTTTHHHHHHHHHSSC
T ss_pred             HHHHHHHHHHH--HHHHhhcCcchhccchHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHhHHHHHHHHHHHHhCC
Confidence            33444444444  599999999999998888777665    12222222  222 2223333344455678899999999


Q ss_pred             cchhhHHHHHHHHHHHHHHHHHHHHHHH-h-------hhcchhhHHHHHHHHHHHHHHHHH-ccCCCCCCcchhhhhhc
Q psy7519         119 TKMRNLGVGASSVPAGVALILIPYLWHM-Q-------SINIHFPMGLLGVVGVLGGLSVLL-LPDTTGLADNLHQLEND  188 (213)
Q Consensus       119 ~~~R~~~~~~~~~~~~~g~~~~~~i~~~-~-------~~~~~~~~~~~~~~~~~~~~~~~~-lpet~~~~~~~~~~~~~  188 (213)
                      ++.|+++.|+....+++++.+++.+.+. .       ..+....+++++++++++.++.++ +|||+++  ..||.++.
T Consensus       401 t~~R~~~~g~~~~~~~~~~~i~~~~~p~l~~~~~~~~~~~~~~~~~i~~~~~~~~~i~~~~~~PETkg~--tLeei~~~  477 (491)
T 4gc0_A          401 NAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGK--TLEELEAL  477 (491)
T ss_dssp             TTTHHHHHHHHHHHHHHHHHHHHTHHHHHCHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHCCCCTTC--CHHHHGGG
T ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHheecCCCCC--CHHHHHHH
Confidence            9999999999999999999999988773 1       223445678888888888887765 6999983  24444443
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.46
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.15
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.9
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 98.63
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]

Probab=99.46  E-value=1.8e-13  Score=110.21  Aligned_cols=132  Identities=14%  Similarity=0.024  Sum_probs=98.9

Q ss_pred             HHHHHhhhHHHHHHHHHHhhcCChhHHHHHHHHHHHHhh--ccc----CChhHHHHHHHHHHHHhhhcccccceeecccc
Q psy7519          44 NTIKEMREKSDKEYLEKLEKNSNGWQVCNIFIKRHLMTL--GFA----PGSFITISLAMVGKFAISSSNVIIPIYTAELF  117 (213)
Q Consensus        44 ~~i~~~~~~~~~~~~~l~dr~GRr~~l~~~~~~~~i~~~--~~~----~~~~~~~~~~~l~~~~~~~~~~~~~~~~~E~~  117 (213)
                      ..+...++.+..+  +++||+|||+++.++.++..++.+  ...    .+.......+++.+++.+..++....+++|.+
T Consensus        68 ~~~~~~~~~~~~G--~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~  145 (447)
T d1pw4a_          68 ISIAYGFSKFIMG--SVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWW  145 (447)
T ss_dssp             HHHHHHHHHHHHH--HHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHH--HHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHH
Confidence            3344444444555  499999999999999988887766  222    24445556888888888888888999999999


Q ss_pred             CcchhhHHHHHHHHHHHHHHHHHHHHHHH---hhhcchhhHHHHHHHHHHHHHHHHH-ccCCCC
Q psy7519         118 PTKMRNLGVGASSVPAGVALILIPYLWHM---QSINIHFPMGLLGVVGVLGGLSVLL-LPDTTG  177 (213)
Q Consensus       118 p~~~R~~~~~~~~~~~~~g~~~~~~i~~~---~~~~~~~~~~~~~~~~~~~~~~~~~-lpet~~  177 (213)
                      |++.|++..++.+....+|..++|.+...   ...+|+..+.+.+.+.++..+..++ ++|++.
T Consensus       146 ~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~  209 (447)
T d1pw4a_         146 SQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQ  209 (447)
T ss_dssp             TTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSST
T ss_pred             HhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcccchh
Confidence            99999999999999999999999887762   2346677777777776666665554 455544
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure