Psyllid ID: psy7530


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60
MAAFINISQMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG
ccccccccccEEEEEEEEEEcccccccHHHHHHHHHHHccHHHHHccccEEEEEEccccc
ccEEEcccHHHHcccEEEEccccccccHHHHHHHHHHcccEEEEccccEEEEEccccccc
MAAFINISQMVTRTKKIfvgglsapttlEDVKNYFEqfgpvyytacdrfifgispvknfg
maafinisqmvtrtkKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG
MAAFINISQMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG
***FINISQMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISP*****
*******SQMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNF*
MAAFINISQMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG
*AAFINISQMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNF*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAFINISQMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query60 2.2.26 [Sep-21-2011]
Q9VVE5 369 RNA-binding protein Musas no N/A 0.55 0.089 0.909 5e-11
Q61474 362 RNA-binding protein Musas yes N/A 0.55 0.091 0.818 6e-08
Q8K3P4 362 RNA-binding protein Musas yes N/A 0.55 0.091 0.818 6e-08
O43347 362 RNA-binding protein Musas no N/A 0.55 0.091 0.818 9e-08
Q920Q6 346 RNA-binding protein Musas no N/A 0.55 0.095 0.818 9e-08
Q96DH6 328 RNA-binding protein Musas no N/A 0.55 0.100 0.818 9e-08
>sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 Back     alignment and function desciption
 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/33 (90%), Positives = 33/33 (100%)

Query: 9   QMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
           +MVTRTKKIFVGGLSAPTTLEDVK+YFEQFGP+
Sbjct: 112 KMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPI 144




RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system.
Drosophila melanogaster (taxid: 7227)
>sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 Back     alignment and function description
>sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 Back     alignment and function description
>sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 Back     alignment and function description
>sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 Back     alignment and function description
>sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
357618776121 hypothetical protein KGM_05192 [Danaus p 0.55 0.272 0.969 1e-10
322803072 162 hypothetical protein SINV_04183 [Solenop 0.533 0.197 0.968 3e-10
161084519 499 RNA-binding protein 6, isoform B [Drosop 0.55 0.066 0.909 4e-10
30720021975 RNA-binding protein Musashi-like protein 0.55 0.44 0.969 4e-10
345494041 367 PREDICTED: RNA-binding protein Musashi h 0.55 0.089 0.939 4e-10
380014686 410 PREDICTED: RNA-binding protein Musashi h 0.55 0.080 0.939 4e-10
328783731 486 PREDICTED: RNA-binding protein Musashi h 0.55 0.067 0.939 4e-10
350398654 410 PREDICTED: RNA-binding protein Musashi h 0.55 0.080 0.939 4e-10
195375642 247 GJ12977 [Drosophila virilis] gi|19415376 0.533 0.129 0.937 4e-10
19517598270 GL13180 [Drosophila persimilis] gi|19410 0.533 0.457 0.968 5e-10
>gi|357618776|gb|EHJ71628.1| hypothetical protein KGM_05192 [Danaus plexippus] Back     alignment and taxonomy information
 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/33 (96%), Positives = 32/33 (96%)

Query: 10 MVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVY 42
          MVTRTKKIFVGGLSAPTTLEDVKNYFEQFGP Y
Sbjct: 1  MVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPTY 33




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322803072|gb|EFZ23160.1| hypothetical protein SINV_04183 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|161084519|ref|NP_001097631.1| RNA-binding protein 6, isoform B [Drosophila melanogaster] gi|158028569|gb|ABW08559.1| RNA-binding protein 6, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|307200219|gb|EFN80513.1| RNA-binding protein Musashi-like protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345494041|ref|XP_001606007.2| PREDICTED: RNA-binding protein Musashi homolog Rbp6-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380014686|ref|XP_003691353.1| PREDICTED: RNA-binding protein Musashi homolog Rbp6-like [Apis florea] Back     alignment and taxonomy information
>gi|328783731|ref|XP_623522.3| PREDICTED: RNA-binding protein Musashi homolog Rbp6-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|350398654|ref|XP_003485263.1| PREDICTED: RNA-binding protein Musashi homolog Rbp6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195375642|ref|XP_002046609.1| GJ12977 [Drosophila virilis] gi|194153767|gb|EDW68951.1| GJ12977 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195175982|ref|XP_002028657.1| GL13180 [Drosophila persimilis] gi|194108435|gb|EDW30478.1| GL13180 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
FB|FBgn0260943 369 Rbp6 "RNA-binding protein 6" [ 0.55 0.089 0.909 3.7e-11
UNIPROTKB|B4DM51 267 MSI2 "RNA-binding protein Musa 0.6 0.134 0.777 1.5e-09
UNIPROTKB|J3KTC1141 MSI2 "RNA-binding protein Musa 0.55 0.234 0.818 3.6e-09
UNIPROTKB|H0YHB7 233 MSI1 "RNA-binding protein Musa 0.55 0.141 0.818 4.1e-09
UNIPROTKB|F1NSZ7 262 MSI1 "Uncharacterized protein" 0.55 0.125 0.818 6.6e-09
UNIPROTKB|F1N9H6 273 MSI1 "Uncharacterized protein" 0.55 0.120 0.818 7.5e-09
UNIPROTKB|F1LRH1 329 Msi1 "RNA-binding protein Musa 0.55 0.100 0.818 9.6e-09
MGI|MGI:107376 362 Msi1 "musashi RNA-binding prot 0.55 0.091 0.818 1.2e-08
RGD|628778 362 Msi1 "musashi RNA-binding prot 0.55 0.091 0.818 1.2e-08
UNIPROTKB|Q8K3P4 362 Msi1 "RNA-binding protein Musa 0.55 0.091 0.818 1.2e-08
FB|FBgn0260943 Rbp6 "RNA-binding protein 6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 160 (61.4 bits), Expect = 3.7e-11, P = 3.7e-11
 Identities = 30/33 (90%), Positives = 33/33 (100%)

Query:     9 QMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
             +MVTRTKKIFVGGLSAPTTLEDVK+YFEQFGP+
Sbjct:   112 KMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPI 144




GO:0003729 "mRNA binding" evidence=NAS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|B4DM51 MSI2 "RNA-binding protein Musashi homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KTC1 MSI2 "RNA-binding protein Musashi homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YHB7 MSI1 "RNA-binding protein Musashi homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSZ7 MSI1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9H6 MSI1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRH1 Msi1 "RNA-binding protein Musashi homolog 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:107376 Msi1 "musashi RNA-binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|628778 Msi1 "musashi RNA-binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8K3P4 Msi1 "RNA-binding protein Musashi homolog 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q61474MSI1H_MOUSENo assigned EC number0.81810.550.0911yesN/A
Q8K3P4MSI1H_RATNo assigned EC number0.81810.550.0911yesN/A
Q9VVE5MSIR6_DROMENo assigned EC number0.90900.550.0894noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 2e-11
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 2e-10
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 5e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 5e-07
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 2e-06
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 3e-06
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 3e-06
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 3e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 5e-06
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 8e-06
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 8e-06
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 2e-05
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 2e-05
smart0036073 smart00360, RRM, RNA recognition motif 2e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 4e-05
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-05
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 5e-05
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 8e-05
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 1e-04
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 1e-04
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 1e-04
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 2e-04
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-04
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 3e-04
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 4e-04
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 4e-04
pfam0007670 pfam00076, RRM_1, RNA recognition motif 6e-04
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 6e-04
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 7e-04
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 8e-04
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 0.001
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 0.001
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 0.001
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.001
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 0.002
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 0.003
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 0.003
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 0.003
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 0.003
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
 Score = 52.8 bits (127), Expect = 2e-11
 Identities = 20/26 (76%), Positives = 21/26 (80%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KIFVGGLSA TT +DVK YF QFG V
Sbjct: 1  KIFVGGLSANTTEDDVKKYFSQFGKV 26


This subfamily corresponds to the RRM2.in Musashi-1 (also termed Msi1), a neural RNA-binding protein putatively expressed in central nervous system (CNS) stem cells and neural progenitor cells, and associated with asymmetric divisions in neural progenitor cells. It is evolutionarily conserved from invertebrates to vertebrates. Musashi-1 is a homolog of Drosophila Musashi and Xenopus laevis nervous system-specific RNP protein-1 (Nrp-1). It has been implicated in the maintenance of the stem-cell state, differentiation, and tumorigenesis. It translationally regulates the expression of a mammalian numb gene by binding to the 3'-untranslated region of mRNA of Numb, encoding a membrane-associated inhibitor of Notch signaling, and further influences neural development. Moreover, Musashi-1 represses translation by interacting with the poly(A)-binding protein and competes for binding of the eukaryotic initiation factor-4G (eIF-4G). Musashi-2 (also termed Msi2) has been identified as a regulator of the hematopoietic stem cell (HSC) compartment and of leukemic stem cells after transplantation of cells with loss and gain of function of the gene. It influences proliferation and differentiation of HSCs and myeloid progenitors, and further modulates normal hematopoiesis and promotes aggressive myeloid leukemia. Both, Musashi-1 and Musashi-2, contain two conserved N-terminal tandem RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), along with other domains of unknown function. . Length = 74

>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 60
KOG0149|consensus 247 99.55
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.23
KOG0125|consensus 376 99.23
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.16
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.16
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.15
KOG4205|consensus 311 99.14
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.07
PLN03213 759 repressor of silencing 3; Provisional 99.03
PLN03120 260 nucleic acid binding protein; Provisional 98.96
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.95
KOG0126|consensus 219 98.92
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 98.9
KOG0107|consensus 195 98.9
KOG0109|consensus 346 98.89
PLN03121 243 nucleic acid binding protein; Provisional 98.86
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.86
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.86
COG0724 306 RNA-binding proteins (RRM domain) [General functio 98.84
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 98.84
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.83
KOG0144|consensus 510 98.83
KOG4205|consensus 311 98.82
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.82
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 98.82
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 98.78
KOG0148|consensus 321 98.77
KOG0113|consensus 335 98.77
KOG0148|consensus 321 98.76
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.76
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 98.75
smart0036272 RRM_2 RNA recognition motif. 98.67
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.57
KOG0144|consensus 510 98.53
smart0036071 RRM RNA recognition motif. 98.52
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.49
KOG0127|consensus 678 98.49
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.48
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.47
KOG0105|consensus 241 98.42
KOG0122|consensus270 98.39
KOG0109|consensus 346 98.32
KOG0114|consensus124 98.29
KOG0127|consensus 678 98.27
KOG0146|consensus 371 98.26
KOG0123|consensus 369 98.24
KOG0132|consensus 894 98.22
KOG0147|consensus 549 98.21
KOG4207|consensus 256 98.17
KOG0153|consensus 377 98.15
KOG0121|consensus153 98.14
KOG0130|consensus170 98.11
KOG0117|consensus 506 98.11
KOG0124|consensus 544 98.02
KOG0145|consensus360 98.01
KOG0108|consensus 435 98.01
KOG0124|consensus 544 97.97
KOG0117|consensus 506 97.87
KOG0131|consensus 203 97.82
KOG0145|consensus 360 97.78
KOG0129|consensus 520 97.68
KOG0110|consensus725 97.68
KOG4206|consensus 221 97.52
KOG0111|consensus 298 97.52
KOG0116|consensus419 97.51
KOG0106|consensus 216 97.42
KOG0533|consensus 243 97.42
KOG0151|consensus 877 97.37
KOG0415|consensus 479 97.36
KOG0123|consensus369 97.32
KOG4660|consensus 549 97.29
KOG0131|consensus203 97.18
KOG4661|consensus 940 97.04
KOG0110|consensus 725 96.9
KOG3152|consensus 278 96.86
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.64
smart0036170 RRM_1 RNA recognition motif. 96.64
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 96.62
KOG4210|consensus285 96.48
KOG4454|consensus 267 96.41
KOG4208|consensus 214 96.38
KOG1190|consensus 492 96.33
KOG4209|consensus231 96.1
KOG1548|consensus 382 95.96
KOG0146|consensus371 95.55
KOG1457|consensus284 95.46
KOG0115|consensus 275 95.44
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 95.4
KOG0129|consensus 520 95.4
KOG4212|consensus608 95.06
KOG4212|consensus 608 94.78
KOG0120|consensus 500 94.67
KOG0112|consensus 975 94.23
KOG0226|consensus290 93.87
KOG1855|consensus 484 93.77
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.84
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 92.71
KOG1457|consensus 284 92.33
KOG4211|consensus 510 91.87
PF1551362 DUF4651: Domain of unknown function (DUF4651) 90.87
KOG1190|consensus492 90.18
KOG0147|consensus 549 89.77
KOG2891|consensus 445 88.76
KOG4206|consensus221 85.6
KOG4849|consensus 498 84.99
KOG0106|consensus216 84.67
KOG4676|consensus 479 83.36
KOG0128|consensus881 81.72
PF03467 176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 81.28
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 80.09
>KOG0149|consensus Back     alignment and domain information
Probab=99.55  E-value=5.8e-15  Score=94.01  Aligned_cols=50  Identities=36%  Similarity=0.473  Sum_probs=45.1

Q ss_pred             ccCCcceEEEeCCCCCCCHHHHHHHHhcCCceeEEEEeeeecCCCCccccC
Q psy7530          10 MVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG   60 (60)
Q Consensus        10 ~~~~~~klfVg~L~~~~~e~~l~~~F~~fG~V~~v~i~~~~~g~~~~k~fg   60 (60)
                      .+....|+|||||+|+++.|+||++|+|||+|.++.|+. +.-..++||||
T Consensus         8 ~DT~~TKifVggL~w~T~~~~l~~yFeqfGeI~eavvit-d~~t~rskGyG   57 (247)
T KOG0149|consen    8 GDTTFTKIFVGGLAWETHKETLRRYFEQFGEIVEAVVIT-DKNTGRSKGYG   57 (247)
T ss_pred             CCceEEEEEEcCcccccchHHHHHHHHHhCceEEEEEEe-ccCCcccccee
Confidence            345678999999999999999999999999999998887 77888899987



>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF15513 DUF4651: Domain of unknown function (DUF4651) Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG2891|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
2mss_A75 Musashi1 Rbd2, Nmr Length = 75 1e-05
>pdb|2MSS|A Chain A, Musashi1 Rbd2, Nmr Length = 75 Back     alignment and structure

Iteration: 1

Score = 45.1 bits (105), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 20/25 (80%), Positives = 22/25 (88%) Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41 IFVGGLS TT+EDVK+YFEQFG V Sbjct: 2 IFVGGLSVNTTVEDVKHYFEQFGKV 26

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-11
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-11
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-10
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-10
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-10
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 5e-10
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 6e-10
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 6e-10
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 8e-10
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-09
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-09
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-09
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-09
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 4e-09
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 5e-09
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 8e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 4e-08
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-07
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 5e-07
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-06
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-06
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-06
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-06
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-06
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-06
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-06
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 3e-06
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 4e-06
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 4e-06
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-06
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 5e-06
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 5e-06
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 5e-06
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 7e-06
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 7e-06
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 8e-06
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 8e-06
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-05
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-05
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-05
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-05
3nmr_A 175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-05
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-05
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-05
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-05
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-05
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-05
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-05
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 2e-05
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-05
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 3e-05
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-05
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 3e-05
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-05
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-05
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-05
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-05
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-05
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-05
2g4b_A 172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-04
3n9u_C156 Cleavage and polyadenylation specificity factor S; 4e-05
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 4e-05
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 5e-05
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 5e-05
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-05
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 6e-05
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 7e-05
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-05
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 8e-05
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 8e-05
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 2e-04
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 9e-05
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 9e-05
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 9e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 9e-05
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 1e-04
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-04
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-04
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-04
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-04
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-04
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-04
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-04
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-04
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-04
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-04
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-04
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-04
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-04
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-04
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 3e-04
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-04
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-04
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-04
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-04
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-04
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 4e-04
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 5e-04
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 5e-04
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 6e-04
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 7e-04
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 7e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 7e-04
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 7e-04
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 7e-04
3p5t_L90 Cleavage and polyadenylation specificity factor S; 8e-04
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 9e-04
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
 Score = 53.8 bits (130), Expect = 1e-11
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 8  SQMVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          S M +   K+F+GGLS  TT E ++ YF QFG V
Sbjct: 19 SHMGSSGCKMFIGGLSWQTTQEGLREYFGQFGEV 52


>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.51
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.5
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.5
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.49
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.47
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.46
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.46
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.45
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.44
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.44
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.43
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.42
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.42
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.4
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.4
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.39
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.39
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.39
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.38
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.38
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.38
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.38
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.38
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.38
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.38
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.38
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.38
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.37
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.37
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.37
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.37
2div_A99 TRNA selenocysteine associated protein; structural 99.37
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.36
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.36
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.36
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.36
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.36
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.36
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.36
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.36
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.36
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.35
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.35
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.35
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.35
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.35
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.34
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.34
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.34
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.34
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.34
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.34
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.34
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.33
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.33
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.33
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.33
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.33
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.33
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.33
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.33
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.32
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.32
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.32
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.32
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.32
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.32
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.31
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.31
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.31
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.31
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.3
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.3
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.3
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.3
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.3
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.3
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.3
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.3
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.3
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.29
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.29
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.29
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.29
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.28
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.28
2dis_A109 Unnamed protein product; structural genomics, RRM 99.28
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.28
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.28
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.28
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.28
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.28
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.28
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.27
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.27
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.27
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.27
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.27
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.27
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.27
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.26
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.26
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.26
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.26
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.26
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.26
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.26
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.26
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.26
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.25
3nmr_A 175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.25
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.25
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.24
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.24
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.24
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.23
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.23
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.23
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.23
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.22
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 99.22
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.22
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.22
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.21
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.21
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.21
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.21
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.21
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.21
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.2
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.2
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.2
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.2
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.19
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.18
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.18
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.18
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.17
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.17
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.17
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.17
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.17
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.16
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.16
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.15
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.15
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.14
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.13
3md3_A 166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.13
1x5p_A97 Negative elongation factor E; structure genomics, 99.13
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.13
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.13
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.11
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.11
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.71
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.1
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 99.1
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.1
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.1
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.09
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.09
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.08
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.08
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.08
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.07
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.07
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.07
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.06
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.04
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.03
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.03
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.03
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.01
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.01
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.01
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.01
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.99
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.98
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 98.96
2g4b_A 172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.96
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.95
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.94
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.92
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.92
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.9
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.89
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.88
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.87
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.86
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.83
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.79
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.79
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.78
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.7
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.51
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.5
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.48
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.47
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.21
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.21
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 97.89
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 97.89
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 97.12
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 96.02
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.02
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.92
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 95.63
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 94.95
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 93.92
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 93.75
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 93.42
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 92.14
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 88.18
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 85.51
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
Probab=99.51  E-value=1.3e-14  Score=81.95  Aligned_cols=43  Identities=21%  Similarity=0.093  Sum_probs=38.6

Q ss_pred             cCCcceEEEeCCCCCCCHHHHHHHHhcCCceeEEEEeeeecCCCCccccC
Q psy7530          11 VTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG   60 (60)
Q Consensus        11 ~~~~~klfVg~L~~~~~e~~l~~~F~~fG~V~~v~i~~~~~g~~~~k~fg   60 (60)
                      +...++|||+|||++++|++|+++|++||+|.+|.|++       +||||
T Consensus        13 ~~~~~~LfV~nLp~~vte~dL~~lF~~fG~V~~v~i~~-------~kGfa   55 (105)
T 1sjq_A           13 GVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLK-------GKNQA   55 (105)
T ss_dssp             CCCCCEEEECSCCTTSCHHHHHHHHHHHCCEEEEEEET-------TTTEE
T ss_pred             CCCCCEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEc-------CCCEE
Confidence            45678999999999999999999999999999999998       56664



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 60
d1u1qa_ 183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-06
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 8e-06
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-05
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-05
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-05
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-05
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-05
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-05
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-05
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-05
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 8e-05
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 9e-05
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 9e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 9e-05
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-04
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-04
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-04
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 2e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-04
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-04
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-04
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-04
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-04
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-04
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 4e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 4e-04
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-04
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-04
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-04
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-04
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 6e-04
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 7e-04
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 7e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 8e-04
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 0.001
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 0.001
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 0.001
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 0.001
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 0.002
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 0.002
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 0.002
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.6 bits (91), Expect = 3e-06
 Identities = 13/27 (48%), Positives = 22/27 (81%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +K+F+GGLS  TT E ++++FEQ+G +
Sbjct: 7  RKLFIGGLSFETTDESLRSHFEQWGTL 33


>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.6
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.58
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.57
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.57
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.56
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.54
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.54
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.51
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.5
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.5
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.48
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.48
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.47
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.46
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.46
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.46
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.46
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.46
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.46
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.46
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.45
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.45
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.45
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.45
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.43
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.42
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.42
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.41
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.41
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.41
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.4
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.39
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.39
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.39
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.39
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.39
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.38
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.38
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.38
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.36
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.36
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.35
d1u1qa_ 183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.35
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.35
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.34
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.33
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.33
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.32
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.31
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.29
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.29
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.29
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.29
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.28
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.28
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.27
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.27
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.27
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.25
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.25
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.24
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.23
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.22
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.21
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.2
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.19
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.19
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.18
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.13
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.13
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.13
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.09
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.06
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.06
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.06
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.06
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.02
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.02
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.0
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.93
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.93
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.78
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.76
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 97.98
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 97.5
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 96.83
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 94.8
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.46
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: TAR DNA-binding protein 43, TDP-43
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=8.7e-16  Score=82.85  Aligned_cols=50  Identities=34%  Similarity=0.527  Sum_probs=42.5

Q ss_pred             ccCCcceEEEeCCCCCCCHHHHHHHHhcCCceeEEEEeeeecCCCCccccC
Q psy7530          10 MVTRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG   60 (60)
Q Consensus        10 ~~~~~~klfVg~L~~~~~e~~l~~~F~~fG~V~~v~i~~~~~g~~~~k~fg   60 (60)
                      ..+...+|||+|||+++|+++|+++|++||+|.+|.|++ +....++||||
T Consensus         4 ~~~~~~~lfV~nLp~~~te~~l~~~F~~~G~i~~v~i~~-d~~tg~srG~a   53 (90)
T d2cqga1           4 AVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKK-DLKTGHSKGFG   53 (90)
T ss_dssp             CCCCCCCEEEESCCSSCCHHHHHHHHGGGSCEEEEEEEE-CSSSCSEEEEE
T ss_pred             CCcCCCeEEEECCCCCCCHHHHHHHHHhhcccceeeecc-CCCCcccCCEE
Confidence            345678899999999999999999999999999999998 34455677775



>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure