Psyllid ID: psy7618
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 560 | ||||||
| 124505007 | 1619 | kinesin-like protein, putative [Plasmodi | 0.787 | 0.272 | 0.321 | 9e-50 | |
| 307192948 | 729 | Kinesin-like protein KIF3B [Harpegnathos | 0.410 | 0.315 | 0.483 | 1e-48 | |
| 332025181 | 726 | Kinesin-like protein KIF3B [Acromyrmex e | 0.401 | 0.309 | 0.484 | 3e-48 | |
| 156383556 | 734 | predicted protein [Nematostella vectensi | 0.362 | 0.276 | 0.519 | 3e-48 | |
| 48115199 | 725 | PREDICTED: kinesin 2A [Apis mellifera] | 0.410 | 0.317 | 0.474 | 5e-48 | |
| 345481744 | 724 | PREDICTED: kinesin-like protein KIF3B is | 0.391 | 0.302 | 0.495 | 6e-48 | |
| 380021407 | 725 | PREDICTED: kinesin-like protein KIF3B is | 0.410 | 0.317 | 0.474 | 8e-48 | |
| 322785855 | 726 | hypothetical protein SINV_09599 [Solenop | 0.410 | 0.316 | 0.474 | 1e-47 | |
| 367001767 | 1232 | hypothetical protein TPHA_0E00890 [Tetra | 0.798 | 0.362 | 0.323 | 1e-47 | |
| 221055491 | 1419 | kinesin-related protein [Plasmodium know | 0.785 | 0.310 | 0.331 | 1e-47 |
| >gi|124505007|ref|XP_001351245.1| kinesin-like protein, putative [Plasmodium falciparum 3D7] gi|3758853|emb|CAB11138.1| kinesin-like protein, putative [Plasmodium falciparum 3D7] | Back alignment and taxonomy information |
|---|
Score = 204 bits (519), Expect = 9e-50, Method: Compositional matrix adjust.
Identities = 160/498 (32%), Positives = 255/498 (51%), Gaps = 57/498 (11%)
Query: 31 NIKVVVRCRPMNVPERK-AHVENVIKIDTTKKCLSIQYSTDRLKPRQPGKARRFTFDAVY 89
NIKV+VRCRP+N E+ + E V++I+ + L+I + + + ++++FD
Sbjct: 15 NIKVIVRCRPLNEKEKNDINNEEVVRINNNEVILTINRNNEIYE-------KKYSFDYAC 67
Query: 90 GMQATQTEIYENSVRPMVNHMLHGYNVTIFAYGQTGTGKTFTMEGSQMERGIMQNAFRQI 149
Q ++ N + +V+ +L G+N T+F YGQTGTGKT+TMEG +E +Q
Sbjct: 68 DKDVDQKTLFNNYIYQIVDEVLQGFNCTLFCYGQTGTGKTYTMEGKILEH------LKQ- 120
Query: 150 FDFKQKEKRHKCI---VECCYLELYQGKIRDLLNVSRPTLFDT-----KAKLNIYHGRQS 201
+D +K ++ I + CY EL + + L+ +FD + K+ + G+++
Sbjct: 121 YDNNKKVDLNESINSDISYCY-ELCENEDTGLIFRVTKRIFDILNKRKEEKIRHFKGKKN 179
Query: 202 NGTQIFDFKQKEKRHKCIVE--------CCYLELYQGKIRDLLNVSRPTLFDTKAKLTLP 253
IFD +K+ H ++ Y + + +N+ + +++ P
Sbjct: 180 ----IFD--EKDNEHINVINKETNGNNNNIINNNYNNLLCNKINIDKNDIYNNLKINKEP 233
Query: 254 CKGL-----RSVTCQSVEE--IENCRKKGYKSRKTAKKRHKCIVECCYLELYQGKIRDLL 306
L R +TC V++ ++ R K + ++ YLE+Y ++ DLL
Sbjct: 234 NNLLVNEKSRDITCDVVQKCSVDKNRNNDMYQTFDDKNMYDFNIKISYLEIYNEELCDLL 293
Query: 307 NVSRPTL-------FDTKAKLTLPCKGLRSVTCQSVEEIENCRKKGYKSRKTASTYFNDY 359
+ + + + K+K L L + S EEI K R+TA T +N
Sbjct: 294 SSTNENMKLRIYEDSNNKSK-GLNVDKLEEKSINSFEEIYYIICSAIKKRRTAETAYNKK 352
Query: 360 SSRSHAIFIVTLKVLN-SKTGKALIH-SKLNLVDLAGSECLQKSN--ATDIRLKECCEIN 415
SSRSH+IF +TL + + + G+++ KLNLVDLAGSE KS+ + IR +E C IN
Sbjct: 353 SSRSHSIFTITLIIKDINNVGESITKIGKLNLVDLAGSENALKSSYGSLKIRQQESCNIN 412
Query: 416 LSLLAVNKVISSTVAGKTYIPYRDSLLTQLLQDSFGGNAKTLMIANIGPAASTYKETLVT 475
SLL + +VI+S + +YIPYRDS LT+LLQDS GG KT ++A I P++ ETL T
Sbjct: 413 QSLLTLGRVINSLIENSSYIPYRDSKLTRLLQDSLGGKTKTFIVATISPSSLCIDETLST 472
Query: 476 LEYANRAKKIKNAPNINF 493
L+Y RAK IKN P IN
Sbjct: 473 LDYVFRAKNIKNRPEINI 490
|
Source: Plasmodium falciparum 3D7 Species: Plasmodium falciparum Genus: Plasmodium Family: Order: Haemosporida Class: Aconoidasida Phylum: Apicomplexa Superkingdom: Eukaryota |
| >gi|307192948|gb|EFN75964.1| Kinesin-like protein KIF3B [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332025181|gb|EGI65361.1| Kinesin-like protein KIF3B [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|156383556|ref|XP_001632899.1| predicted protein [Nematostella vectensis] gi|156219962|gb|EDO40836.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|48115199|ref|XP_393174.1| PREDICTED: kinesin 2A [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|345481744|ref|XP_003424442.1| PREDICTED: kinesin-like protein KIF3B isoform 1 [Nasonia vitripennis] gi|345481746|ref|XP_003424443.1| PREDICTED: kinesin-like protein KIF3B isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|380021407|ref|XP_003694557.1| PREDICTED: kinesin-like protein KIF3B isoform 1 [Apis florea] gi|380021409|ref|XP_003694558.1| PREDICTED: kinesin-like protein KIF3B isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|322785855|gb|EFZ12474.1| hypothetical protein SINV_09599 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|367001767|ref|XP_003685618.1| hypothetical protein TPHA_0E00890 [Tetrapisispora phaffii CBS 4417] gi|357523917|emb|CCE63184.1| hypothetical protein TPHA_0E00890 [Tetrapisispora phaffii CBS 4417] | Back alignment and taxonomy information |
|---|
| >gi|221055491|ref|XP_002258884.1| kinesin-related protein [Plasmodium knowlesi strain H] gi|193808954|emb|CAQ39657.1| kinesin-related protein, putative [Plasmodium knowlesi strain H] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 560 | ||||||
| UNIPROTKB|Q5F423 | 739 | KIF3B "Uncharacterized protein | 0.364 | 0.276 | 0.511 | 6.6e-80 | |
| UNIPROTKB|F1N020 | 743 | KIF3B "Uncharacterized protein | 0.364 | 0.274 | 0.507 | 4.2e-76 | |
| UNIPROTKB|E2QUS2 | 747 | KIF3B "Uncharacterized protein | 0.364 | 0.273 | 0.507 | 4.5e-76 | |
| MGI|MGI:107688 | 747 | Kif3b "kinesin family member 3 | 0.364 | 0.273 | 0.507 | 4.5e-76 | |
| UNIPROTKB|O15066 | 747 | KIF3B "Kinesin-like protein KI | 0.364 | 0.273 | 0.507 | 5.7e-76 | |
| UNIPROTKB|F1S519 | 757 | KIF3B "Uncharacterized protein | 0.364 | 0.269 | 0.507 | 6.8e-76 | |
| ZFIN|ZDB-GENE-050119-3 | 775 | kif3b "kinesin family member 3 | 0.410 | 0.296 | 0.469 | 1.5e-75 | |
| UNIPROTKB|F1NIP3 | 707 | KIF3A "Uncharacterized protein | 0.403 | 0.319 | 0.440 | 1.5e-74 | |
| UNIPROTKB|P46872 | 699 | KRP85 "Kinesin-II 85 kDa subun | 0.403 | 0.323 | 0.444 | 4e-74 | |
| UNIPROTKB|F1PQE6 | 451 | KIF3A "Uncharacterized protein | 0.403 | 0.501 | 0.440 | 3.2e-73 |
| UNIPROTKB|Q5F423 KIF3B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 470 (170.5 bits), Expect = 6.6e-80, Sum P(3) = 6.6e-80
Identities = 107/209 (51%), Positives = 139/209 (66%)
Query: 289 IVECCYLELYQGKIRDLLNVSRPTLFDTKAK--LTLPCKGLRSVTCQSVEEIENCRKKGY 346
+V YLE+YQ +IRDLL+ + + K + + K L S +SV+EIE+ G
Sbjct: 139 LVRASYLEIYQEEIRDLLSKDQSKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGN 198
Query: 347 KSRKTASTYFNDYSSRSHAIFIVTLKVLN-SKTGKALIH-SKLNLVDLAGSECLQKSNAT 404
++R +T N++SSRSHAIF++T++ G+ I KLNLVDLAGSE K+ A
Sbjct: 199 QNRSVGATNMNEHSSRSHAIFVITIECSELGLDGENHIRVGKLNLVDLAGSERQAKTGAQ 258
Query: 405 DIRLKECCEINLSLLAVNKVISSTVAGK-TYIPYRDSLLTQLLQDSFGGNAKTLMIANIG 463
RLKE +INLSL A+ VIS+ V GK T+IPYRDS LT+LLQDS GGNAKT+M+ANIG
Sbjct: 259 GERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANIG 318
Query: 464 PAASTYKETLVTLEYANRAKKIKNAPNIN 492
PA+ +ETL TL YANRAK IKN P +N
Sbjct: 319 PASYNVEETLTTLRYANRAKNIKNKPRVN 347
|
|
| UNIPROTKB|F1N020 KIF3B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUS2 KIF3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107688 Kif3b "kinesin family member 3B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O15066 KIF3B "Kinesin-like protein KIF3B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S519 KIF3B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050119-3 kif3b "kinesin family member 3B" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NIP3 KIF3A "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P46872 KRP85 "Kinesin-II 85 kDa subunit" [Strongylocentrotus purpuratus (taxid:7668)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PQE6 KIF3A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 560 | |||
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 9e-73 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 1e-71 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 8e-66 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 2e-61 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 7e-61 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 9e-61 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 2e-60 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 4e-59 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 1e-52 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 2e-51 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 2e-48 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 1e-47 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 1e-46 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 2e-44 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 5e-43 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 3e-41 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 5e-41 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 9e-41 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 4e-39 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 2e-38 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 5e-36 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 2e-35 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 2e-34 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 6e-34 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 2e-33 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 6e-33 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 2e-32 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 8e-32 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 5e-31 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 8e-30 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 1e-29 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 6e-26 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 5e-25 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 8e-24 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 2e-22 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 3e-21 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 7e-18 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 1e-13 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 2e-04 |
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
Score = 235 bits (601), Expect = 9e-73
Identities = 99/216 (45%), Positives = 131/216 (60%), Gaps = 9/216 (4%)
Query: 277 KSRKTAKKRHKCIVECCYLELYQGKIRDLLNV--SRPTLF---DTKAKLTLPCKGLRSVT 331
+ + +++ V YLE+Y KI DLL+ + L D K + + KGL V
Sbjct: 113 RIEERKERKWSFSVRVSYLEIYNEKIYDLLSPSSKKKKLRIREDPKKGVYV--KGLTEVE 170
Query: 332 CQSVEEIENCRKKGYKSRKTASTYFNDYSSRSHAIFIVTLKVLNSKTGKALIHSKLNLVD 391
S EE+ + G K+R AST N+ SSRSHAIF +T++ N T ++ KLNLVD
Sbjct: 171 VTSAEEVLELLELGNKNRTVASTNMNEESSRSHAIFTITVEQRNRDTDGSVKTGKLNLVD 230
Query: 392 LAGSECLQKSN-ATDIRLKECCEINLSLLAVNKVISSTVAGK-TYIPYRDSLLTQLLQDS 449
LAGSE K+ A RLKE IN SL A+ VI++ + ++IPYRDS LT+LLQDS
Sbjct: 231 LAGSERASKTGAAGGRRLKEAANINKSLSALGNVINALAENQSSHIPYRDSKLTRLLQDS 290
Query: 450 FGGNAKTLMIANIGPAASTYKETLVTLEYANRAKKI 485
GGN+KTLMIANI P+ S Y+ETL TL +A+RAK I
Sbjct: 291 LGGNSKTLMIANISPSDSNYEETLSTLRFASRAKNI 326
|
Length = 326 |
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 560 | |||
| KOG0243|consensus | 1041 | 100.0 | ||
| KOG4280|consensus | 574 | 100.0 | ||
| KOG0245|consensus | 1221 | 100.0 | ||
| KOG0241|consensus | 1714 | 100.0 | ||
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| KOG0242|consensus | 675 | 100.0 | ||
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| KOG0240|consensus | 607 | 100.0 | ||
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| KOG0239|consensus | 670 | 100.0 | ||
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| KOG0247|consensus | 809 | 100.0 | ||
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| KOG0246|consensus | 676 | 100.0 | ||
| KOG0244|consensus | 913 | 100.0 | ||
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 100.0 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 98.2 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 94.62 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 94.03 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 92.66 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 92.45 | |
| PRK06620 | 214 | hypothetical protein; Validated | 92.16 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 92.0 | |
| PRK12377 | 248 | putative replication protein; Provisional | 91.77 | |
| PRK08116 | 268 | hypothetical protein; Validated | 90.03 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 90.0 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 89.86 | |
| PRK09087 | 226 | hypothetical protein; Validated | 89.85 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 89.62 | |
| PRK06526 | 254 | transposase; Provisional | 89.13 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 89.08 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 89.01 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 88.98 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 88.16 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 87.85 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 87.8 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 87.74 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 86.93 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 86.86 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 86.7 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 86.65 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 86.31 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 85.96 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 85.94 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 85.72 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 85.14 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 84.97 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 84.97 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 84.82 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 84.55 | |
| PRK08727 | 233 | hypothetical protein; Validated | 84.48 | |
| PRK08181 | 269 | transposase; Validated | 84.2 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 84.11 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 84.07 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 83.72 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 83.67 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 83.56 | |
| KOG0243|consensus | 1041 | 83.52 | ||
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 83.42 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 83.18 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 82.81 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 82.39 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 82.34 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 81.95 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 80.89 | |
| KOG0239|consensus | 670 | 80.7 | ||
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 80.29 |
| >KOG0243|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.5e-91 Score=771.31 Aligned_cols=369 Identities=41% Similarity=0.627 Sum_probs=318.1
Q ss_pred CCCCCCeEEEEEeCCCCcchhccCCccEEEEcCCCceeEeecCCCCCCCCCCCCceeeeCCccccCCCcchhhhhccchH
Q psy7618 26 HHQDENIKVVVRCRPMNVPERKAHVENVIKIDTTKKCLSIQYSTDRLKPRQPGKARRFTFDAVYGMQATQTEIYENSVRP 105 (560)
Q Consensus 26 ~~~~~~ikV~vRvRP~~~~e~~~~~~~~v~~~~~~~~v~i~~~~~~~~~~~~~~~~~F~FD~VF~~~a~Q~~vf~~~~~p 105 (560)
.+...||+|+|||||++..|....+..+|.+++....|.+...-. ...-.++|+||+||+|++.|++||+.+|.|
T Consensus 45 ~e~~~NIqVivRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~~-----sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p 119 (1041)
T KOG0243|consen 45 KEKEVNIQVIVRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTIA-----SKQIDKTFTFDKVFGPESQQEDLYDQAVSP 119 (1041)
T ss_pred CCCCCceEEEEEeCCCCchhhhcCCCeEEecCCCcceEEEecccc-----cccccceeecceeeCcchhHHHHHHHHHHH
Confidence 345679999999999999999999999999988766677754311 111468899999999999999999999999
Q ss_pred HHHHHhcCCcEEEEEEcccCCCceEEecc--------CCCCcChHHHHHHHHHHHHhhhccCcEEEEeehhhhhhhhhhh
Q psy7618 106 MVNHMLHGYNVTIFAYGQTGTGKTFTMEG--------SQMERGIMQNAFRQIFDFKQKEKRHKCIVECCYLELYQGKIRD 177 (560)
Q Consensus 106 lv~~~l~G~N~~i~aYG~TgSGKTyTm~G--------~~~~~Giipr~l~~lF~~~~~~~~~~~~v~~s~~e~~~~~~~d 177 (560)
+|+.|+.|||||||||||||+||||||.| .+.++|||||++.+||+.+.... ..|.|+
T Consensus 120 ~i~eVl~GyNCTIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPRal~~IFd~Le~~~-~EYsvK------------- 185 (1041)
T KOG0243|consen 120 IIKEVLEGYNCTIFAYGQTGTGKTYTMEGGERKKNGELPSEAGIIPRALRQIFDTLEAQG-AEYSVK------------- 185 (1041)
T ss_pred HHHHHhccCCceEEEecCCCCCceeeeecCcccccCCCCccCCcchHHHHHHHHHHHhcC-CeEEEE-------------
Confidence 99999999999999999999999999999 56789999999999999887754 566666
Q ss_pred ccccCCCcccchhhhhhcccCCCCCCcccchhhhhhcccccceeeeeeeeehhhhhhhhcCCCCCcccccccccCCCCCC
Q psy7618 178 LLNVSRPTLFDTKAKLNIYHGRQSNGTQIFDFKQKEKRHKCIVECCYLELYQGKIRDLLNVSRPTLFDTKAKLTLPCKGL 257 (560)
Q Consensus 178 ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~~~~~~~~~~~~~~ 257 (560)
|||+|+|||+++|||++..... ..
T Consensus 186 --------------------------------------------VSfLELYNEEl~DLLa~~~~~~----~~-------- 209 (1041)
T KOG0243|consen 186 --------------------------------------------VSFLELYNEELTDLLASEDTSD----KK-------- 209 (1041)
T ss_pred --------------------------------------------EEehhhhhHHHHHhcCCccccc----cc--------
Confidence 7777778888888887664210 00
Q ss_pred cccccchhHHHHHhhhccccccccccccccccccceeeEeecchhhcccccCCCcccccCCcccceecCCeEEEcCCHHH
Q psy7618 258 RSVTCQSVEEIENCRKKGYKSRKTAKKRHKCIVECCYLELYQGKIRDLLNVSRPTLFDTKAKLTLPCKGLRSVTCQSVEE 337 (560)
Q Consensus 258 ~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~v~~s~lei~~~~~~dll~~~~~~~~~~~~~~~~~v~gL~~~~v~s~ee 337 (560)
+++.. .++.. +.++|++|+||.++.|+++.|
T Consensus 210 -------------------------------------~~~k~----------~~~~~--~~kggV~vkGlEEi~V~~A~e 240 (1041)
T KOG0243|consen 210 -------------------------------------LRIKD----------DSTIV--DGKGGVIVKGLEEIIVTNADE 240 (1041)
T ss_pred -------------------------------------ccccc----------CCccc--CCcCcEEEecceeeeecchhH
Confidence 11111 11111 567899999999999999999
Q ss_pred HHHHHHHHHhhcccccccCCCCCCCcEEEEEEEEEEEe--CCCCceeEeeeeeeeeccCCcccccccCcchhhHHHhHhh
Q psy7618 338 IENCRKKGYKSRKTASTYFNDYSSRSHAIFIVTLKVLN--SKTGKALIHSKLNLVDLAGSECLQKSNATDIRLKECCEIN 415 (560)
Q Consensus 338 ~~~ll~~g~~~R~~~~t~~N~~SSRSH~If~i~l~~~~--~~~~~~~~~s~L~~VDLAGSEr~~~s~~~g~r~~E~~~IN 415 (560)
++.+|.+|...|++|+|.||+.|||||+||+|+|.... ..+.+.++.|+|+||||||||.++++|+.+.|.+|++.||
T Consensus 241 i~klLekGs~kRrtAaTl~N~~SSRSHsIFsItvhike~t~~geelvK~GKLNLVDLAGSENI~RSGA~~~RArEAG~IN 320 (1041)
T KOG0243|consen 241 IYKLLEKGSKKRRTAATLMNDQSSRSHSIFSITVHIKENTPEGEELVKIGKLNLVDLAGSENISRSGARNGRAREAGEIN 320 (1041)
T ss_pred HHHHHHhhhhHhHHHHHHhhhhccccceEEEEEEEEecCCCcchhhHhhcccceeeccccccccccccccchhHHhhhhh
Confidence 99999999999999999999999999999999997763 3344567889999999999999999999999999999999
Q ss_pred hhHHHHHHHHHhhhCCCCCcCCCCCchhhhhccccCCCceEEEEEeeCCCcccHHHHHHHHHHHHHhcccccccccccc-
Q psy7618 416 LSLLAVNKVISSTVAGKTYIPYRDSLLTQLLQDSFGGNAKTLMIANIGPAASTYKETLVTLEYANRAKKIKNAPNINFY- 494 (560)
Q Consensus 416 ~SL~aL~~vI~al~~~~~~iPyRdSkLT~lLqdsLgGnskt~mI~~vsP~~~~~~ETl~TL~fa~rak~Ikn~p~~n~~- 494 (560)
+||++||+||+||..+..|||||+|||||||||||||.+||+|||||||+..+++||++||.||.|||+|+|+|.+|..
T Consensus 321 qSLLTLGRVInALVe~s~HIPYRESKLTRLLQDSLGGkTKT~iIATiSPa~~~lEETlSTLEYA~RAKnIkNKPevNQkl 400 (1041)
T KOG0243|consen 321 QSLLTLGRVINALVEHSGHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKHNLEETLSTLEYAHRAKNIKNKPEVNQKL 400 (1041)
T ss_pred HHHHHHHHHHHHHHccCCCCCchHHHHHHHHHHHhCCCceeEEEEEeCCCcccHHHHHHHHHHHHHhhhccCCCccchHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999999975
Q ss_pred cchhhhcHHH-HHHHHHHHHHHHHh
Q psy7618 495 REDRCHNEEK-MREKYKKALEDLAQ 518 (560)
Q Consensus 495 ~~~~~~~~~~-~~~~l~~~l~~l~~ 518 (560)
.++.+++.+- +|++||..|...+.
T Consensus 401 ~K~~llKd~~~EIerLK~dl~AaRe 425 (1041)
T KOG0243|consen 401 MKKTLLKDLYEEIERLKRDLAAARE 425 (1041)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHhHh
Confidence 3455555555 99999998866533
|
|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 560 | ||||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-47 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 1e-43 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 9e-40 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-39 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 2e-39 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 2e-39 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 2e-39 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 2e-39 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 2e-39 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 2e-39 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 2e-39 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 3e-38 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 3e-37 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 5e-36 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 4e-35 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 7e-34 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 8e-34 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 2e-33 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 2e-33 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 4e-33 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 2e-32 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 2e-32 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-32 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-32 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 4e-32 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 6e-32 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 1e-30 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 4e-30 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 1e-29 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-29 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 2e-29 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 1e-27 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 1e-27 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 9e-27 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 1e-26 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-26 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 7e-26 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 9e-26 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 9e-26 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 1e-25 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 1e-25 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 1e-25 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 5e-25 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 8e-25 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 3e-24 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 6e-24 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 1e-23 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 2e-20 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 6e-20 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 1e-18 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 1e-18 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 1e-18 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 1e-18 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 8e-18 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-17 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 3e-15 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 3e-13 | ||
| 3kin_B | 117 | Kinesin (Dimeric) From Rattus Norvegicus Length = 1 | 1e-11 | ||
| 2kin_B | 100 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 4e-11 |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
|
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 | Back alignment and structure |
| >pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 560 | |||
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 1e-86 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 8e-54 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 1e-09 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 2e-85 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 2e-50 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 4e-10 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 4e-85 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 1e-57 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 3e-08 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 5e-85 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 2e-59 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 5e-85 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 4e-58 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 6e-84 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 2e-54 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 2e-09 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 2e-83 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 1e-57 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 1e-10 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 2e-82 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 1e-57 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 1e-81 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 4e-53 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 2e-09 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 1e-79 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 4e-51 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 3e-79 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 5e-54 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 6e-09 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 3e-79 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 1e-52 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 1e-09 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 1e-78 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 3e-50 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 2e-77 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 2e-53 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 5e-77 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 8e-53 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 7e-09 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 6e-77 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 1e-52 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 2e-76 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 4e-55 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 3e-76 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 7e-56 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 1e-75 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 4e-52 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 1e-75 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 2e-51 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 2e-75 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 7e-56 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 7e-75 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 2e-53 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 2e-07 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 4e-74 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 4e-50 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 7e-74 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 3e-50 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 3e-73 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 6e-51 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 7e-71 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 1e-50 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 4e-35 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 7e-35 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-17 |
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
Score = 272 bits (697), Expect = 1e-86
Identities = 90/244 (36%), Positives = 136/244 (55%), Gaps = 10/244 (4%)
Query: 280 KTAKKRHKCIVECCYLELYQGKIRDLLNVSRPTL--FDTKAKLTLPCKGLRSVTCQSVEE 337
+ + ++ Y E+Y KIRDLL+VS+ L + K ++ KG S E+
Sbjct: 127 YAMEVNLEFHIKVSYYEIYMDKIRDLLDVSKVNLSVHEDKNRVPY-VKGATERFVSSPED 185
Query: 338 IENCRKKGYKSRKTASTYFNDYSSRSHAIFIVTLKVLNSKTGKALIHSKLNLVDLAGSEC 397
+ ++G +R A T N++SSRSH++F++ +K N + K + KL LVDLAGSE
Sbjct: 186 VFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLENQK-KLSGKLYLVDLAGSEK 244
Query: 398 LQKSNATDIRLKECCEINLSLLAVNKVISSTVAGK-TYIPYRDSLLTQLLQDSFGGNAKT 456
+ K+ A L E IN SL A+ VIS+ G T+IPYRDS LT++LQ+S GGNA+T
Sbjct: 245 VSKTGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNART 304
Query: 457 LMIANIGPAASTYKETLVTLEYANRAKKIKNAPNINFYREDRCHNEEKMREKYKKALEDL 516
++ PA+ ET TL++ RAK +KN +N E+ E+ + +Y+K E
Sbjct: 305 TIVICCSPASFNESETKSTLDFGRRAKTVKNVVCVN---EE--LTAEEWKRRYEKEKEKN 359
Query: 517 AQCK 520
A+ K
Sbjct: 360 ARLK 363
|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 560 | |||
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 99.97 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 99.96 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.92 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.61 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.35 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 91.76 | |
| 4etp_B | 333 | Spindle POLE BODY-associated protein VIK1; kinesin | 91.67 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 86.45 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 86.11 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 85.06 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 84.62 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 84.62 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 83.99 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 82.28 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 82.1 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 81.66 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 81.41 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 81.38 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 80.54 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 80.04 |
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
Probab=100.00 E-value=8.7e-92 Score=726.16 Aligned_cols=343 Identities=44% Similarity=0.668 Sum_probs=272.6
Q ss_pred CCCeEEEEEeCCCCcchhccCCccEEEEcCCCceeEeecCCCCCC-CCCCCCceeeeCCccccCCCcchhhhhccchHHH
Q psy7618 29 DENIKVVVRCRPMNVPERKAHVENVIKIDTTKKCLSIQYSTDRLK-PRQPGKARRFTFDAVYGMQATQTEIYENSVRPMV 107 (560)
Q Consensus 29 ~~~ikV~vRvRP~~~~e~~~~~~~~v~~~~~~~~v~i~~~~~~~~-~~~~~~~~~F~FD~VF~~~a~Q~~vf~~~~~plv 107 (560)
.++|+|+|||||++..|...+...++.+++....+.+..+..... .......+.|.||+||+++++|++||+.+++|+|
T Consensus 3 ~~~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~~v~v~~~~~~~~~~~~~~~~~~f~FD~Vf~~~~~Q~~Vy~~~~~plv 82 (350)
T 2vvg_A 3 SDNIKVIVRCRPLNARETRENALNIIRMDEASAQVIVDPPEQEKSATQAKKVPRTFTFDAVYDQTSCNYGIFQASFKPLI 82 (350)
T ss_dssp -CBCEEEEEECCCCHHHHHTTCCBCEEEEGGGTEEEECC--------------EEEECSEEECTTCCHHHHHHHTTHHHH
T ss_pred CCCeEEEEEeCCCChhhhccCCceEEEEcCCCCEEEEeeccccccccccCCCceEeeCCEEECCCcchhHHHHHHHHHHH
Confidence 578999999999999998888888888887777777765543111 1123457899999999999999999999999999
Q ss_pred HHHhcCCcEEEEEEcccCCCceEEeccCCCCcChHHHHHHHHHHHHhhhc-cCcEEEEeehhhhhhhhhhhccccCCCcc
Q psy7618 108 NHMLHGYNVTIFAYGQTGTGKTFTMEGSQMERGIMQNAFRQIFDFKQKEK-RHKCIVECCYLELYQGKIRDLLNVSRPTL 186 (560)
Q Consensus 108 ~~~l~G~N~~i~aYG~TgSGKTyTm~G~~~~~Giipr~l~~lF~~~~~~~-~~~~~v~~s~~e~~~~~~~dll~~~~~~~ 186 (560)
+++++|||+||||||||||||||||+|++.++|||||++++||+.++... ...|.
T Consensus 83 ~~~l~G~n~tifAYGqTGSGKTyTm~G~~~~~Giipr~~~~lF~~i~~~~~~~~~~------------------------ 138 (350)
T 2vvg_A 83 DAVLEGFNSTIFAYGQTGAGKTWTMGGNKEEPGAIPNSFKHLFDAINSSSSNQNFL------------------------ 138 (350)
T ss_dssp HHHHTTCCEEEEEECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHTCCTTEEEE------------------------
T ss_pred HHHhCCCceeEEeecCCCCCCCEEeecCCccCchHHHHHHHHHHHHHhhccCCcEE------------------------
Confidence 99999999999999999999999999999999999999999999887432 33444
Q ss_pred cchhhhhhcccCCCCCCcccchhhhhhcccccceeeeeeeeehhhhhhhhcCCCCCcccccccccCCCCCCcccccchhH
Q psy7618 187 FDTKAKLNIYHGRQSNGTQIFDFKQKEKRHKCIVECCYLELYQGKIRDLLNVSRPTLFDTKAKLTLPCKGLRSVTCQSVE 266 (560)
Q Consensus 187 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~ 266 (560)
|.+||+|||||+|+|||++.. .
T Consensus 139 ---------------------------------v~vS~~EIYnE~i~DLL~~~~--------~----------------- 160 (350)
T 2vvg_A 139 ---------------------------------VIGSYLELYNEEIRDLIKNNT--------K----------------- 160 (350)
T ss_dssp ---------------------------------EEEEEEEEETTEEEETTTTEE--------E-----------------
T ss_pred ---------------------------------EEEEEEEEeCCEEEEcccCCc--------C-----------------
Confidence 448899999999999986221 0
Q ss_pred HHHHhhhccccccccccccccccccceeeEeecchhhcccccCCCcccccCCcccceecCCeEEEcCCHHHHHHHHHHHH
Q psy7618 267 EIENCRKKGYKSRKTAKKRHKCIVECCYLELYQGKIRDLLNVSRPTLFDTKAKLTLPCKGLRSVTCQSVEEIENCRKKGY 346 (560)
Q Consensus 267 ~~~~~~~~~~~~~~~~~~~~~~~v~~s~lei~~~~~~dll~~~~~~~~~~~~~~~~~v~gL~~~~v~s~ee~~~ll~~g~ 346 (560)
++|.+ +..++++|.||+++.|.|++|++.+|..|.
T Consensus 161 ----------------------------l~i~e-----------------~~~~~~~v~gl~~~~v~s~~e~~~ll~~g~ 195 (350)
T 2vvg_A 161 ----------------------------LPLKE-----------------DKTRGIYVDGLSMHRVTTAAELSALMDKGF 195 (350)
T ss_dssp ----------------------------ECEEE-----------------ETTTEEEETTCCCEEESSHHHHHHHHHHHH
T ss_pred ----------------------------ceeeE-----------------cCCCCEEecCCEEEEcCCHHHHHHHHHHHH
Confidence 33433 344589999999999999999999999999
Q ss_pred hhcccccccCCCCCCCcEEEEEEEEEEEeCCCC-ceeEeeeeeeeeccCCcccccccCcchhhHHHhHhhhhHHHHHHHH
Q psy7618 347 KSRKTASTYFNDYSSRSHAIFIVTLKVLNSKTG-KALIHSKLNLVDLAGSECLQKSNATDIRLKECCEINLSLLAVNKVI 425 (560)
Q Consensus 347 ~~R~~~~t~~N~~SSRSH~If~i~l~~~~~~~~-~~~~~s~L~~VDLAGSEr~~~s~~~g~r~~E~~~IN~SL~aL~~vI 425 (560)
++|++++|.+|+.|||||+||+|+++......+ .....|+|+|||||||||..++++.|.|++|+.+||+||++||+||
T Consensus 196 ~~R~~~~T~~N~~SSRSH~if~i~v~~~~~~~~~~~~~~skl~lVDLAGSEr~~~t~~~g~rl~E~~~IN~SL~aLg~vI 275 (350)
T 2vvg_A 196 ANRHVAATQMNDTSSRSHSIFMVRIECSEVIENKEVIRVGKLNLVDLAGSERQSKTGATGETLVEGAKINLSLSALGLVI 275 (350)
T ss_dssp HHC----------CTTCEEEEEEEEEEEEC----CEEEEEEEEEEECCCCCC---------------CTTHHHHHHHHHH
T ss_pred hccccccccCCCCCCcceEEEEEEEEEeeccCCCccEEEEEEEEEeCCCCCccccccccHHHHHHHHHHhHHHHHHHHHH
Confidence 999999999999999999999999988754433 3456899999999999999999999999999999999999999999
Q ss_pred HhhhCCCCCcCCCCCchhhhhccccCCCceEEEEEeeCCCcccHHHHHHHHHHHHHhcccccccccccccchh
Q psy7618 426 SSTVAGKTYIPYRDSLLTQLLQDSFGGNAKTLMIANIGPAASTYKETLVTLEYANRAKKIKNAPNINFYREDR 498 (560)
Q Consensus 426 ~al~~~~~~iPyRdSkLT~lLqdsLgGnskt~mI~~vsP~~~~~~ETl~TL~fa~rak~Ikn~p~~n~~~~~~ 498 (560)
.+|..++.||||||||||+||||+|||||+|+||+||||+..+++||++||+||+|||+|+|+|.+|+++.+.
T Consensus 276 ~aL~~~~~hvPyRdSkLT~lLqdsLgGnskt~mI~~isP~~~~~~ETl~TL~fA~rak~i~n~~~~n~~~~~~ 348 (350)
T 2vvg_A 276 SKLVEGATHIPYRDSKLTRLLQDSLGGNSKTLMCANISPASTNYDETMSTLRYADRAKQIKNKPRINEDPKDA 348 (350)
T ss_dssp HHHHHTCSSCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCBCCCCCCBSCTTC
T ss_pred HHHHcCCCCCCccccHHHHHHHHhcCCCccEEEEEEeCCccccHHHHHHHHHHHHHHhhccccceecCCchhc
Confidence 9999999999999999999999999999999999999999999999999999999999999999999987654
|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 560 | ||||
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 6e-44 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 2e-25 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-43 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 2e-24 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 1e-42 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 7e-28 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 5e-42 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 1e-27 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 6e-42 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 3e-24 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 1e-40 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 1e-25 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 3e-39 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 2e-22 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 3e-36 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-24 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 8e-35 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 3e-21 |
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Human (Homo sapiens) [TaxId: 9606]
Score = 156 bits (396), Expect = 6e-44
Identities = 80/204 (39%), Positives = 115/204 (56%), Gaps = 2/204 (0%)
Query: 283 KKRHKCIVECCYLELYQGKIRDLLNVSRPTL-FDTKAKLTLPCKGLRSVTCQSVEEIENC 341
+ + ++ Y E+Y KIRDLL+VS+ L KG S +E+ +
Sbjct: 121 DENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDT 180
Query: 342 RKKGYKSRKTASTYFNDYSSRSHAIFIVTLKVLNSKTGKALIHSKLNLVDLAGSECLQKS 401
+G +R A T N++SSRSH+IF++ +K N++T + L KL LVDLAGSE + K+
Sbjct: 181 IDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKL-SGKLYLVDLAGSEKVSKT 239
Query: 402 NATDIRLKECCEINLSLLAVNKVISSTVAGKTYIPYRDSLLTQLLQDSFGGNAKTLMIAN 461
A L E IN SL A+ VIS+ G TY+PYRDS +T++LQDS GGN +T ++
Sbjct: 240 GAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVIC 299
Query: 462 IGPAASTYKETLVTLEYANRAKKI 485
P++ ET TL + RAK I
Sbjct: 300 CSPSSYNESETKSTLLFGQRAKTI 323
|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 560 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 94.8 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 91.77 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 90.42 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 89.03 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 87.59 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 87.43 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 87.26 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 83.05 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 82.27 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 82.02 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 80.51 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00 E-value=7e-83 Score=666.69 Aligned_cols=344 Identities=36% Similarity=0.544 Sum_probs=287.9
Q ss_pred CeEEEEEeCCCCcchhccCCccEEEEcCCCceeEeecCCCCCCCCCCCCceeeeCCccccCCCcchhhhhccchHHHHHH
Q psy7618 31 NIKVVVRCRPMNVPERKAHVENVIKIDTTKKCLSIQYSTDRLKPRQPGKARRFTFDAVYGMQATQTEIYENSVRPMVNHM 110 (560)
Q Consensus 31 ~ikV~vRvRP~~~~e~~~~~~~~v~~~~~~~~v~i~~~~~~~~~~~~~~~~~F~FD~VF~~~a~Q~~vf~~~~~plv~~~ 110 (560)
+|+|+|||||+.+.|...+...++.+.+... +.... .....+.|.||+||+++++|++||+. +.|+|+++
T Consensus 1 rIkV~vRvRP~~~~E~~~~~~~~v~~~~~~~-~~~~~--------~~~~~~~f~FD~vf~~~~~q~~vy~~-v~~lv~~~ 70 (364)
T d1sdma_ 1 KIRVYCRLRPLCEKEIIAKERNAIRSVDEFT-VEHLW--------KDDKAKQHMYDRVFDGNATQDDVFED-TKYLVQSA 70 (364)
T ss_dssp CCEEEEEECCCCHHHHHTTCCBCEEECSTTE-EEEEC--------SSSSEEEEECSEEECTTCCHHHHHHT-TTHHHHHH
T ss_pred CeEEEEEcCCCChhhcccCCCCeEEeCCCCe-EEecC--------CCCCceEEECCeecCCCCCHHHHHHH-HHHHHHHH
Confidence 4899999999999998777777776654433 32221 12356899999999999999999997 58999999
Q ss_pred hcCCcEEEEEEcccCCCceEEeccCCCCcChHHHHHHHHHHHHhhhc-cCcEEEEeehhhhhhhhhhhccccCCCcccch
Q psy7618 111 LHGYNVTIFAYGQTGTGKTFTMEGSQMERGIMQNAFRQIFDFKQKEK-RHKCIVECCYLELYQGKIRDLLNVSRPTLFDT 189 (560)
Q Consensus 111 l~G~N~~i~aYG~TgSGKTyTm~G~~~~~Giipr~l~~lF~~~~~~~-~~~~~v~~s~~e~~~~~~~dll~~~~~~~~~~ 189 (560)
++|+|+||||||||||||||||+|+..++||+||++++||+.+.... ...|.
T Consensus 71 l~G~n~~i~aYGqTGSGKTyTm~G~~~~~Giipr~~~~lf~~i~~~~~~~~~~--------------------------- 123 (364)
T d1sdma_ 71 VDGYNVCIFAYGQTGSGKTFTIYGADSNPGLTPRAMSELFRIMKKDSNKFSFS--------------------------- 123 (364)
T ss_dssp HTTCEEEEEEECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHHGGGTEEEE---------------------------
T ss_pred hcCCceeeeccccCCCCcccccccCccccchhHHHHHHHHhhhhhccccccce---------------------------
Confidence 99999999999999999999999999999999999999999887654 23333
Q ss_pred hhhhhcccCCCCCCcccchhhhhhcccccceeeeeeeeehhhhhhhhcCCCCCcccccccccCCCCCCcccccchhHHHH
Q psy7618 190 KAKLNIYHGRQSNGTQIFDFKQKEKRHKCIVECCYLELYQGKIRDLLNVSRPTLFDTKAKLTLPCKGLRSVTCQSVEEIE 269 (560)
Q Consensus 190 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~ 269 (560)
|.+||+|||+|.++|||.+...... .
T Consensus 124 ------------------------------v~~S~~EIyne~i~DLL~~~~~~~~----~-------------------- 149 (364)
T d1sdma_ 124 ------------------------------LKAYMVELYQDTLVDLLLPKQAKRL----K-------------------- 149 (364)
T ss_dssp ------------------------------EEEEEEEESSSCEEETTSCTTSCCC----C--------------------
T ss_pred ------------------------------EEEEEEEEeccccccccCccccccc----c--------------------
Confidence 4489999999999999976532100 0
Q ss_pred HhhhccccccccccccccccccceeeEeecchhhcccccCCCcccccCCcccceecCCeEEEcCCHHHHHHHHHHHHhhc
Q psy7618 270 NCRKKGYKSRKTAKKRHKCIVECCYLELYQGKIRDLLNVSRPTLFDTKAKLTLPCKGLRSVTCQSVEEIENCRKKGYKSR 349 (560)
Q Consensus 270 ~~~~~~~~~~~~~~~~~~~~v~~s~lei~~~~~~dll~~~~~~~~~~~~~~~~~v~gL~~~~v~s~ee~~~ll~~g~~~R 349 (560)
+++ ..+...+++|+|++++.|.|++|++.++..|.++|
T Consensus 150 -------------------------l~~-----------------~~~~~~~~~v~~l~~~~v~s~~~~~~~l~~g~~~R 187 (364)
T d1sdma_ 150 -------------------------LDI-----------------KKDSKGMVSVENVTVVSISTYEELKTIIQRGSEQR 187 (364)
T ss_dssp -------------------------CEE-----------------EECTTSCEEEETCCCEEECSHHHHHHHHHHHHHHH
T ss_pred -------------------------cce-----------------eecccCccccccceeeeeCCHHHHHHHhhccceee
Confidence 222 23445689999999999999999999999999999
Q ss_pred ccccccCCCCCCCcEEEEEEEEEEEeCCCCceeEeeeeeeeeccCCcccccccCcchhhHHHhHhhhhHHHHHHHHHhhh
Q psy7618 350 KTASTYFNDYSSRSHAIFIVTLKVLNSKTGKALIHSKLNLVDLAGSECLQKSNATDIRLKECCEINLSLLAVNKVISSTV 429 (560)
Q Consensus 350 ~~~~t~~N~~SSRSH~If~i~l~~~~~~~~~~~~~s~L~~VDLAGSEr~~~s~~~g~r~~E~~~IN~SL~aL~~vI~al~ 429 (560)
.+++|.+|..|||||+||+|++.+...... ....|+|+|||||||||..++++.|.+++|+.+||+||++|++||.+|+
T Consensus 188 ~~~~t~~n~~ssRsH~i~~i~v~~~~~~~~-~~~~~kl~~vDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~aL~ 266 (364)
T d1sdma_ 188 HTTGTLMNEQSSRSHLIVSVIIESTNLQTQ-AIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVISALS 266 (364)
T ss_dssp CCCSSCTTCHHHHSEEEEEEEEEEEETTTC-CEEEEEEEEEECCCCSCCCC---------CCCTTCHHHHHHHHHHHHHH
T ss_pred ccccccccccccccceEEEEEEEEeccCcc-eeeeEEEEeechhhccccccccccCceeeeccccccchhhHHHHHHHHH
Confidence 999999999999999999999998876654 4568999999999999999999999999999999999999999999999
Q ss_pred CCCCCcCCCCCchhhhhccccCCCceEEEEEeeCCCcccHHHHHHHHHHHHHhcccccccccccccchhhhcHHHHHHHH
Q psy7618 430 AGKTYIPYRDSLLTQLLQDSFGGNAKTLMIANIGPAASTYKETLVTLEYANRAKKIKNAPNINFYREDRCHNEEKMREKY 509 (560)
Q Consensus 430 ~~~~~iPyRdSkLT~lLqdsLgGnskt~mI~~vsP~~~~~~ETl~TL~fa~rak~Ikn~p~~n~~~~~~~~~~~~~~~~l 509 (560)
.++.||||||||||+||+|+|||||+|+|||||||+..+++||++||+||++|++|+|.|.+|.... ++.+|
T Consensus 267 ~~~~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa~~ak~i~n~p~~n~~~~--------~~~~l 338 (364)
T d1sdma_ 267 SGNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKNVSSK--------EVARL 338 (364)
T ss_dssp HTCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCCCCCCCCEECH--------HHHHH
T ss_pred cCCCcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHHHHHhhcccCCcccCCHH--------HHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999997543 34455
Q ss_pred HHHHHHH
Q psy7618 510 KKALEDL 516 (560)
Q Consensus 510 ~~~l~~l 516 (560)
++++..|
T Consensus 339 ~~~i~~l 345 (364)
T d1sdma_ 339 KKLVSYW 345 (364)
T ss_dssp HTTTTCC
T ss_pred HHHHHHH
Confidence 5554444
|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|