Psyllid ID: psy767


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900--
MVKLSSNVSDTATPVGITTEVSEATAEVTTVLGALGAFLVLLVLLFVYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIRRLLAQNGSSLVNGDYLDIIHALAVSGHGEYIDEIISKIQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDENLHPRAFNLAVLIKAHVLKEDYTGAVETFEYCVNQFRATPWKGELLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLMLSFLDAEVLRILQVAEAEFGVGSNTETLRDYVLPVLSPPNQVSGEVFSQLRSVGVTIGSITSAYVVHMLRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSYLRTQDLPSLVTVVRAVCENWEKGEEGEKEEEGEEKTAGQLIDMDRIFAGNVLLDIYKATRQDPNVVSHLEQLLNAFVEHAIPISAFSSDYIQNGLGSALTSDISKALGALTSDDLMPQPLQYVPSMFIPRGQPLRCLDKDPLRRWSCDQLLRHPYFNGYYFEVPDEMQYEEITQVSRLPTKDKNKI
cccccccccccccEEHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEcHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccccccc
ccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEHHHHHHccccHHHHHHHHHHHHHccccEEHHHHHHHHHHcccHHHHHHHccccccHEEHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccHHHHHHHHHccccccccccccEccccEcccccccccccccccccccHHHHccccccccEEEEccccccEHEEEEEccccccccccc
mvklssnvsdtatpvgITTEVSEATAEVTTVLGALGAFLVLLVLLFVYLnskwcsepslgpgnlpcedpfsvhtgeldvpldisHYNALLRVYldnehtfsptdFLAKLesqgiepnrVTYQQLISNSKLISKYCQDGNIEGATKILEFMrdktfpiseGVFNALIYGHSQANDMASAEGILTMMsqaglepsaQTYTKLMCGYakhgdmdsiktkipslkpqselflcFSFQLTNLLILVSSDMASAEGILTMMsqaglepsaQTYTKLMCGYAKHGDMDSVRRLLAQsgsslvngdYLDIIHALAVsghgeyidEVSAIVCFVNICFhwlegpmmsqaglepsaQTYTKLMCGYAKHGDMDSIRRLLAQngsslvngdYLDIIHALAVSGHGEYIDEIISkiqpgvgysadaANHIYHLINKGQIDAAYRIVNTLARsaningeqlpvgGFLVRHMVktnqpgvgysadaANHIYHLINKGQIDAAYRIVNTLARsaningeqlpvgGFLVRHMVKTNQPIDKVLAVCHrltdenlhpRAFNLAVLIKAHVlkedytgavETFEYCVNqfratpwkGELLKRFIQAEDAACLQRITDLstsihgevNSLYDLMLSFLDAEVLRILQVAEAefgvgsntetlrdyvlpvlsppnqvsgeVFSQLRSVGVTIGSITSAYVVHMLRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSylrtqdlpsLVTVVRAVCENwekgeegekeeegeektagqlIDMDRIFAGNVLLDIYKatrqdpnvVSHLEQLLNAFVEhaipisafssDYIQNGLGSALTSDISKALgaltsddlmpqplqyvpsmfiprgqplrcldkdplrrwscdqllrhpyfngyyfevpdemqyeeitqvsrlptkdknki
mvklssnvsdtatpvgiTTEVSEATAEVTTVLGALGAFLVLLVLLFVYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIRRLLAQNGSSLVNGDYLDIIHALAVSGHGEYIDEIISKIQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDENLHPRAFNLAVLIKAHVLKEDYTGAVETFEYCVNQFRATPWKGELLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLMLSFLDAEVLRILQVAEAEFGVGSNTETLRDYVLPVLSPPNQVSGEVFSQLRSVGVTIGSITSAYVVHMLRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSylrtqdlpslvTVVRAVCENwekgeegekeeegeektagqlidMDRIFAGNVLLDIYKATRQDPNVVSHLEQLLNAFVEHAIPISAFSSDYIQNGLGSALTSDISKALGALTSDDLMPQPLQYVPSMFIPRGQPLRCLDKDPLRRWSCDQLLRHPYFNGYYFEVPDEMQYEeitqvsrlptkdknki
MVKLSSNVSDTATPVGIttevseataevttvlgalgaflvllvllfvYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIRRLLAQNGSSLVNGDYLDIIHALAVSGHGEYIDEIISKIQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDENLHPRAFNLAVLIKAHVLKEDYTGAVETFEYCVNQFRATPWKGELLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLMLSFLDAEVLRILQVAEAEFGVGSNTETLRDYVLPVLSPPNQVSGEVFSQLRSVGVTIGSITSAYVVHMLRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSYLRTQDLPSLVTVVRAVCENWekgeegekeeegeekTAGQLIDMDRIFAGNVLLDIYKATRQDPNVVSHLEQLLNAFVEHAIPISAFSSDYIQNGLGSALTSDISKALGALTSDDLMPQPLQYVPSMFIPRGQPLRCLDKDPLRRWSCDQLLRHPYFNGYYFEVPDEMQYEEITQVSRLPTKDKNKI
***************GITTEVSEATAEVTTVLGALGAFLVLLVLLFVYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMA*AEGILTMM********AQTYTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIRRLLAQNGSSLVNGDYLDIIHALAVSGHGEYIDEIISKIQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDENLHPRAFNLAVLIKAHVLKEDYTGAVETFEYCVNQFRATPWKGELLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLMLSFLDAEVLRILQVAEAEFGVGSNTETLRDYVLPVLSPPNQVSGEVFSQLRSVGVTIGSITSAYVVHMLRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSYLRTQDLPSLVTVVRAVCENW******************QLIDMDRIFAGNVLLDIYKATRQDPNVVSHLEQLLNAFVEHAIPISAFSSDYIQNGLGSALTSDISKALGALTSDDLMPQPLQYVPSMFIPRGQPLRCLDKDPLRRWSCDQLLRHPYFNGYYFEVPDEMQYE****************
****SSNVSDTATPVGITTEVSEATAEVTTVLGALGAFLVLLVLLFVYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIRRLLAQNGSSLVNGDYLDIIHALAVSGHGEYIDEIISKIQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDENLHPRAFNLAVLIKAHVLKEDYTGAVETFEYCVNQFRATPWKGELLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLMLSFLDAEVLRILQVAEAEFGVGSNTETLRDYVLPVLSPPNQVSGEVFSQLRSVGVTIGSITSAYVVHMLRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSYLRTQDLPSLVTVVRAVCENWEKGEEGEKEE**********IDMDRIFAGNVLLDIYKATRQDPNVVSHLEQLLNAFVEHAIPISAFSSDYIQNGLGSALTSDISKALGALTSDDLMPQPLQYV******************LRRWSCDQLLRHPYFNGYYFEVPDEMQYEEITQV***********
***********ATPVGITTEVSEATAEVTTVLGALGAFLVLLVLLFVYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIRRLLAQNGSSLVNGDYLDIIHALAVSGHGEYIDEIISKIQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDENLHPRAFNLAVLIKAHVLKEDYTGAVETFEYCVNQFRATPWKGELLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLMLSFLDAEVLRILQVAEAEFGVGSNTETLRDYVLPVLSPPNQVSGEVFSQLRSVGVTIGSITSAYVVHMLRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSYLRTQDLPSLVTVVRAVCENWE***************AGQLIDMDRIFAGNVLLDIYKATRQDPNVVSHLEQLLNAFVEHAIPISAFSSDYIQNGLGSALTSDISKALGALTSDDLMPQPLQYVPSMFIPRGQPLRCLDKDPLRRWSCDQLLRHPYFNGYYFEVPDEMQYEEITQVSRLPTKDKNKI
*VKLSSNVSDTATPVGITTEVSEATAEVTTVLGALGAFLVLLVLLFVYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIRRLLAQNGSSLVNGDYLDIIHALAVSGHGEYIDEIISKIQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDENLHPRAFNLAVLIKAHVLKEDYTGAVETFEYCVNQFRATPWKGELLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLMLSFLDAEVLRILQVAEAEFGVGSNTETLRDYVLPVLSPPNQVSGEVFSQLRSVGVTIGSITSAYVVHMLRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSYLRTQDLPSLVTVVRAVCENWEKGEEGEKEEEGEEKTAGQLIDMDRIFAGNVLLDIYKATRQDPNVVSHLEQLLNAFVEHAIPISAFSSDYIQNGLGSALTSDISKALGALTSDDLMPQPLQYVPSMFIPRGQPLRCLDKDPLRRWSCDQLLRHPYFNGYYFEVPDEMQYEEITQVSRLPTK*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKLSSNVSDTATPVGITTEVSEATAEVTTVLGALGAFLVLLVLLFVYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIRRLLAQNGSSLVNGDYLDIIHALAVSGHGEYIDEIISKIQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAANHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDENLHPRAFNLAVLIKAHVLKEDYTGAVETFEYCVNQFRATPWKGELLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLMLSFLDAEVLRILQVAEAEFGVGSNTETLRDYVLPVLSPPNQVSGEVFSQLRSVGVTIGSITSAYVVHMLRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSYLRTQDLPSLVTVVRAVCENWEKGEEGEKEEEGEEKTAGQLIDMDRIFAGNVLLDIYKATRQDPNVVSHLEQLLNAFVEHAIPISAFSSDYIQNGLGSALTSDISKALGALTSDDLMPQPLQYVPSMFIPRGQPLRCLDKDPLRRWSCDQLLRHPYFNGYYFEVPDEMQYEEITQVSRLPTKDKNKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query902 2.2.26 [Sep-21-2011]
Q28C74 1391 Leucine-rich PPR motif-co yes N/A 0.155 0.100 0.513 1e-40
Q5SGE0 1392 Leucine-rich PPR motif-co yes N/A 0.167 0.108 0.515 2e-40
P42704 1394 Leucine-rich PPR motif-co yes N/A 0.155 0.100 0.544 4e-40
Q6PB66 1392 Leucine-rich PPR motif-co yes N/A 0.167 0.108 0.503 9e-40
Q9FJE6907 Putative pentatricopeptid yes N/A 0.445 0.443 0.220 9e-17
Q0WVK7741 Pentatricopeptide repeat- no N/A 0.268 0.326 0.264 3e-16
Q76C99791 Protein Rf1, mitochondria N/A N/A 0.274 0.313 0.253 7e-16
Q9CAM8629 Pentatricopeptide repeat- no N/A 0.366 0.526 0.234 1e-14
P0C8A0638 Pentatricopeptide repeat- no N/A 0.341 0.482 0.215 4e-14
Q9SXD1630 Pentatricopeptide repeat- no N/A 0.371 0.531 0.227 1e-13
>sp|Q28C74|LPPRC_XENTR Leucine-rich PPR motif-containing protein, mitochondrial OS=Xenopus tropicalis GN=lrpprc PE=2 SV=1 Back     alignment and function desciption
 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 109/146 (74%), Gaps = 6/146 (4%)

Query: 76  ELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYC 135
           EL    D+SHYNALL+VYL NEH FSPT++LAK+E+  ++PNRVTYQ      +LI+ YC
Sbjct: 139 ELGAVFDVSHYNALLKVYLQNEHKFSPTEYLAKMEAANVQPNRVTYQ------RLIAAYC 192

Query: 136 QDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQ 195
            +G+IEGA+KIL FM++K  PI+E VFN L+ GH++A DM +A+ IL++M  AG+EP  +
Sbjct: 193 NEGDIEGASKILGFMKNKDLPITEAVFNTLVTGHARAGDMENAKNILSVMRSAGIEPGPE 252

Query: 196 TYTKLMCGYAKHGDMDSIKTKIPSLK 221
           TY  L+  YA+ GD+++IK  + +++
Sbjct: 253 TYVALLTAYAEKGDINNIKQTLENVE 278




May play a role in RNA metabolism in both nuclei and mitochondria. May bind mature mRNA in the nucleus outer membrane. In mitochondria binds to poly(A) mRNA. May be involved in transcription regulation. Binds single-stranded DNA.
Xenopus tropicalis (taxid: 8364)
>sp|Q5SGE0|LPPRC_RAT Leucine-rich PPR motif-containing protein, mitochondrial OS=Rattus norvegicus GN=Lrpprc PE=1 SV=1 Back     alignment and function description
>sp|P42704|LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3 Back     alignment and function description
>sp|Q6PB66|LPPRC_MOUSE Leucine-rich PPR motif-containing protein, mitochondrial OS=Mus musculus GN=Lrpprc PE=1 SV=2 Back     alignment and function description
>sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 Back     alignment and function description
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAM8|PP100_ARATH Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 Back     alignment and function description
>sp|P0C8A0|PP275_ARATH Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query902
195032542 1407 GH10534 [Drosophila grimshawi] gi|193904 0.240 0.154 0.482 2e-53
195388264 1413 GJ19834 [Drosophila virilis] gi|19414926 0.161 0.103 0.611 2e-52
195115116 1406 GI17203 [Drosophila mojavensis] gi|19391 0.237 0.152 0.476 3e-52
195579884 1412 GD21832 [Drosophila simulans] gi|1941917 0.240 0.153 0.491 3e-52
195344822 1412 GM17088 [Drosophila sechellia] gi|194134 0.240 0.153 0.491 3e-52
158293558 1397 AGAP008770-PA [Anopheles gambiae str. PE 0.160 0.103 0.664 4e-52
24584970 1412 bicoid stability factor [Drosophila mela 0.240 0.153 0.486 4e-52
194880213 1412 GG21707 [Drosophila erecta] gi|190657571 0.239 0.152 0.493 7e-52
13958630 1412 bicoid mRNA stability factor [Drosophila 0.240 0.153 0.482 9e-52
195484148 1412 GE12730 [Drosophila yakuba] gi|194176674 0.160 0.102 0.631 2e-51
>gi|195032542|ref|XP_001988519.1| GH10534 [Drosophila grimshawi] gi|193904519|gb|EDW03386.1| GH10534 [Drosophila grimshawi] Back     alignment and taxonomy information
 Score =  217 bits (553), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 154/228 (67%), Gaps = 11/228 (4%)

Query: 77  LDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQ 136
           L+VP+DISHYNALLRVYL+NEH F+PTDFLA++E++GIEPNRVTYQ LI+      +YCQ
Sbjct: 135 LNVPMDISHYNALLRVYLENEHQFAPTDFLAEIEAKGIEPNRVTYQHLIT------RYCQ 188

Query: 137 DGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQT 196
            G+IEGAT+ILEFMR K+ P++E VFN+LI GHSQAND+ SA+GIL +M QAGLEPSA T
Sbjct: 189 QGDIEGATRILEFMRGKSLPVNENVFNSLILGHSQANDLESAKGILGVMRQAGLEPSADT 248

Query: 197 YTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMS 256
           YT L+C +A+HGD+D+++  +   +P+  + L          + ++      +G+LT + 
Sbjct: 249 YTTLLCAFARHGDIDALQATLAECEPKEIILLDKDLLDIIYTLTINGHGEHVDGLLTKLR 308

Query: 257 -QAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLA-QSGSSLVNGDYLDI 302
             AG     Q    ++     +G  D   +LL     S+ VNG+ +D+
Sbjct: 309 ISAGFN---QDAVNIILRLVNNGYEDVALKLLRLMPRSTRVNGELVDV 353




Source: Drosophila grimshawi

Species: Drosophila grimshawi

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195388264|ref|XP_002052803.1| GJ19834 [Drosophila virilis] gi|194149260|gb|EDW64958.1| GJ19834 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195115116|ref|XP_002002110.1| GI17203 [Drosophila mojavensis] gi|193912685|gb|EDW11552.1| GI17203 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195579884|ref|XP_002079789.1| GD21832 [Drosophila simulans] gi|194191798|gb|EDX05374.1| GD21832 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195344822|ref|XP_002038978.1| GM17088 [Drosophila sechellia] gi|194134108|gb|EDW55624.1| GM17088 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|158293558|ref|XP_557938.3| AGAP008770-PA [Anopheles gambiae str. PEST] gi|157016766|gb|EAL40302.3| AGAP008770-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|24584970|ref|NP_523596.2| bicoid stability factor [Drosophila melanogaster] gi|22946750|gb|AAF53668.2| bicoid stability factor [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194880213|ref|XP_001974384.1| GG21707 [Drosophila erecta] gi|190657571|gb|EDV54784.1| GG21707 [Drosophila erecta] Back     alignment and taxonomy information
>gi|13958630|gb|AAK50882.1|AF327844_1 bicoid mRNA stability factor [Drosophila melanogaster] gi|16186254|gb|AAL14024.1| SD10676p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195484148|ref|XP_002090573.1| GE12730 [Drosophila yakuba] gi|194176674|gb|EDW90285.1| GE12730 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query902
FB|FBgn0032679 1412 bsf "bicoid stability factor" 0.240 0.153 0.482 1.3e-66
UNIPROTKB|B8ZZ38504 LRPPRC "Leucine-rich PPR motif 0.161 0.289 0.529 5.9e-40
RGD|1306575 1392 Lrpprc "leucine-rich pentatric 0.178 0.115 0.497 2.6e-39
UNIPROTKB|I3LIC2 1395 LRPPRC "Uncharacterized protei 0.161 0.104 0.535 3e-39
UNIPROTKB|P42704 1394 LRPPRC "Leucine-rich PPR motif 0.161 0.104 0.529 2.9e-38
UNIPROTKB|F1NGU3 1342 LRPPRC "Uncharacterized protei 0.161 0.108 0.509 3.1e-38
UNIPROTKB|E1BPX9 1396 LOC100850455 "Uncharacterized 0.161 0.104 0.509 3.9e-38
MGI|MGI:1919666 1392 Lrpprc "leucine-rich PPR-motif 0.162 0.105 0.509 8.4e-38
UNIPROTKB|C9JCA9359 LRPPRC "Leucine-rich PPR motif 0.161 0.406 0.529 3e-37
TAIR|locus:2827701874 AT2G17140 [Arabidopsis thalian 0.577 0.596 0.215 1e-14
FB|FBgn0032679 bsf "bicoid stability factor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 523 (189.2 bits), Expect = 1.3e-66, Sum P(4) = 1.3e-66
 Identities = 110/228 (48%), Positives = 158/228 (69%)

Query:    77 LDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQ 136
             L+VP++ISHYNALLRVYL+NEH F+PTDFLA++E++GIEPNRVTYQ      +LI++YCQ
Sbjct:   134 LNVPMNISHYNALLRVYLENEHGFAPTDFLAEIEAKGIEPNRVTYQ------RLIARYCQ 187

Query:   137 DGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQT 196
              G+IEGAT+ILEFMR K+ P++E VFN+LI GHSQAND+ SA+GIL +M QAGLEPSA T
Sbjct:   188 QGDIEGATRILEFMRAKSLPVNENVFNSLILGHSQANDLESAKGILGVMKQAGLEPSADT 247

Query:   197 YTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMS 256
             YT L+C +A+HGD+ ++K  +   + Q E+ L     L +++  ++ +  + E +  +++
Sbjct:   248 YTTLLCAFARHGDLAAVKETLAECE-QKEIIL-LDKDLLDIVYTLTVN-GNGEHVDDVLT 304

Query:   257 QAGLEPSA-QTYTKLMCGYAKHGDMDSVRRLL-AQSGSSLVNGDYLDI 302
             +  L P   Q    ++      G  D   +LL     SS VNG+ +D+
Sbjct:   305 KLRLSPGFNQDAVNVILRLVNKGHEDVGLKLLRVMPRSSRVNGEPVDV 352


GO:0003730 "mRNA 3'-UTR binding" evidence=NAS;IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0034518 "RNA cap binding complex" evidence=IDA
UNIPROTKB|B8ZZ38 LRPPRC "Leucine-rich PPR motif-containing protein, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306575 Lrpprc "leucine-rich pentatricopeptide repeat containing" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LIC2 LRPPRC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P42704 LRPPRC "Leucine-rich PPR motif-containing protein, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGU3 LRPPRC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPX9 LOC100850455 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1919666 Lrpprc "leucine-rich PPR-motif containing" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|C9JCA9 LRPPRC "Leucine-rich PPR motif-containing protein, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2827701 AT2G17140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query902
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-06
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 3e-04
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 0.002
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 0.002
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 0.002
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.004
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
 Score = 44.3 bits (106), Expect = 4e-06
 Identities = 13/45 (28%), Positives = 24/45 (53%)

Query: 162 FNALIYGHSQANDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAK 206
           +N LI G+ +   +  A  +   M + G++P+  TY+ L+ G  K
Sbjct: 6   YNTLIDGYCKKGKVEEALKLFNEMKKRGIKPNVYTYSILIDGLCK 50


This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. Length = 50

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 902
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
KOG4318|consensus 1088 99.92
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.79
PRK11788389 tetratricopeptide repeat protein; Provisional 99.74
PRK11788389 tetratricopeptide repeat protein; Provisional 99.7
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.69
KOG4318|consensus 1088 99.67
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.65
KOG4422|consensus625 99.65
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.6
KOG4626|consensus 966 99.6
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.59
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.59
KOG4422|consensus625 99.59
KOG4626|consensus 966 99.53
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.53
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.53
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.5
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.44
PRK14574822 hmsH outer membrane protein; Provisional 99.43
PRK14574822 hmsH outer membrane protein; Provisional 99.34
KOG2002|consensus 1018 99.33
KOG2002|consensus1018 99.27
PF1304150 PPR_2: PPR repeat family 99.22
KOG2076|consensus895 99.18
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.13
PF1304150 PPR_2: PPR repeat family 99.12
KOG2076|consensus895 99.11
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.07
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.07
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.04
KOG0593|consensus396 99.02
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.0
KOG0495|consensus913 98.99
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.95
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.9
KOG1915|consensus677 98.89
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.89
KOG2003|consensus840 98.88
KOG0495|consensus913 98.87
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.87
KOG1126|consensus638 98.82
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.79
KOG1126|consensus638 98.71
KOG3785|consensus557 98.7
PRK12370553 invasion protein regulator; Provisional 98.69
KOG2003|consensus840 98.68
KOG0547|consensus606 98.67
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.65
KOG1155|consensus559 98.64
KOG0547|consensus606 98.62
KOG1840|consensus508 98.62
KOG1155|consensus559 98.6
KOG1840|consensus508 98.59
PRK12370553 invasion protein regulator; Provisional 98.54
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.54
PF1285434 PPR_1: PPR repeat 98.53
KOG2047|consensus835 98.5
PF1285434 PPR_1: PPR repeat 98.48
KOG1915|consensus677 98.45
KOG1156|consensus700 98.45
KOG2376|consensus652 98.42
KOG3785|consensus557 98.4
KOG3617|consensus1416 98.39
KOG1129|consensus478 98.37
KOG1156|consensus700 98.37
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.33
KOG1129|consensus478 98.26
KOG2047|consensus835 98.23
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.23
KOG1173|consensus611 98.23
KOG3616|consensus 1636 98.18
PRK11189296 lipoprotein NlpI; Provisional 98.14
KOG1174|consensus564 98.13
KOG3616|consensus1636 98.07
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.05
KOG1173|consensus611 98.05
PRK11189296 lipoprotein NlpI; Provisional 98.04
KOG3617|consensus1416 98.03
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.0
KOG2376|consensus652 97.99
KOG4340|consensus459 97.96
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.94
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.93
KOG4162|consensus799 97.91
KOG1174|consensus564 97.89
KOG4162|consensus799 97.87
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.86
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.84
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.81
KOG1914|consensus656 97.8
PRK04841903 transcriptional regulator MalT; Provisional 97.79
PRK04841903 transcriptional regulator MalT; Provisional 97.78
KOG0985|consensus1666 97.76
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.75
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.69
KOG1128|consensus777 97.68
KOG1070|consensus1710 97.63
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.62
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.57
KOG1125|consensus579 97.55
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.51
KOG1070|consensus1710 97.44
KOG1127|consensus1238 97.37
KOG2053|consensus 932 97.33
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.31
KOG4340|consensus459 97.31
KOG1125|consensus579 97.29
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.29
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.27
KOG1127|consensus1238 97.25
KOG0624|consensus504 97.24
KOG1128|consensus777 97.24
PRK15359144 type III secretion system chaperone protein SscB; 97.21
PLN02789320 farnesyltranstransferase 97.21
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.19
PRK10370198 formate-dependent nitrite reductase complex subuni 97.19
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.17
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.15
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 97.06
KOG0985|consensus1666 97.05
KOG3081|consensus299 97.05
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.05
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.04
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.03
KOG0624|consensus504 97.0
PRK15359144 type III secretion system chaperone protein SscB; 96.96
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.95
PLN02789320 farnesyltranstransferase 96.95
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.93
KOG3081|consensus299 96.92
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.9
PRK10370198 formate-dependent nitrite reductase complex subuni 96.89
KOG0548|consensus539 96.79
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.78
KOG0548|consensus539 96.76
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 96.76
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.76
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.71
KOG2280|consensus829 96.7
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.67
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.67
KOG3060|consensus289 96.63
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.6
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.6
KOG2053|consensus932 96.56
KOG2041|consensus1189 96.48
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.47
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.44
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.42
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.34
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.01
KOG1538|consensus1081 95.92
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.9
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.9
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.86
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.84
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.79
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 95.74
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.68
KOG1914|consensus656 95.67
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.63
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.42
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 95.36
KOG3060|consensus289 95.3
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.29
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.18
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.04
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 94.96
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.89
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.81
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.57
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.57
PF12688120 TPR_5: Tetratrico peptide repeat 94.46
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.46
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.39
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.25
KOG1538|consensus1081 94.21
PRK10153517 DNA-binding transcriptional activator CadC; Provis 94.16
PF12688120 TPR_5: Tetratrico peptide repeat 94.07
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 93.99
PRK10153517 DNA-binding transcriptional activator CadC; Provis 93.92
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 93.44
PF1337173 TPR_9: Tetratricopeptide repeat 93.32
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 93.24
KOG3941|consensus406 93.01
KOG0553|consensus304 92.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.76
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.51
KOG1920|consensus1265 92.36
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.27
smart00299140 CLH Clathrin heavy chain repeat homology. 92.13
PRK10803263 tol-pal system protein YbgF; Provisional 92.04
COG4700251 Uncharacterized protein conserved in bacteria cont 91.75
PRK10803263 tol-pal system protein YbgF; Provisional 91.69
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 91.69
KOG3941|consensus406 91.34
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.24
PF03704146 BTAD: Bacterial transcriptional activator domain; 90.63
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.5
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 90.17
KOG1130|consensus639 89.67
COG4235287 Cytochrome c biogenesis factor [Posttranslational 89.62
KOG2796|consensus366 89.45
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 89.09
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 88.73
PF13281374 DUF4071: Domain of unknown function (DUF4071) 88.71
COG4700251 Uncharacterized protein conserved in bacteria cont 88.63
KOG2796|consensus366 88.44
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 88.4
KOG1920|consensus1265 88.21
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 88.15
PF13281374 DUF4071: Domain of unknown function (DUF4071) 87.32
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 87.31
COG4105254 ComL DNA uptake lipoprotein [General function pred 87.2
COG3629280 DnrI DNA-binding transcriptional activator of the 87.11
PF13170297 DUF4003: Protein of unknown function (DUF4003) 86.83
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.77
KOG2041|consensus1189 86.74
KOG0553|consensus304 86.65
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.46
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 86.41
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 86.18
PF1337173 TPR_9: Tetratricopeptide repeat 86.06
PRK15331165 chaperone protein SicA; Provisional 85.58
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 85.57
COG4235287 Cytochrome c biogenesis factor [Posttranslational 85.4
KOG2610|consensus491 85.24
smart00299140 CLH Clathrin heavy chain repeat homology. 85.17
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 84.45
PTZ00036440 glycogen synthase kinase; Provisional 84.4
COG1729262 Uncharacterized protein conserved in bacteria [Fun 83.78
COG3898531 Uncharacterized membrane-bound protein [Function u 83.52
KOG0550|consensus486 81.97
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 81.57
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 81.38
KOG0659|consensus318 80.69
KOG4555|consensus175 80.14
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.6e-63  Score=615.41  Aligned_cols=655  Identities=14%  Similarity=0.107  Sum_probs=576.4

Q ss_pred             HHHHHHHHHHHhcccCCCCCCcCcccccCccccccCCCCCCCCHHHHHHHHHHHHHCCCchHHHHHHHHHHHCCCCCCHH
Q psy767           40 VLLVLLFVYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRV  119 (902)
Q Consensus        40 ~~~~~~~~~l~~~~~~~g~~~~A~~~f~~~~~~~~~~~g~~pd~~~yn~li~~~~~~g~~~~A~~l~~~M~~~g~~pd~~  119 (902)
                      ..+...++.++.++++.|++++|..+|+.|..     .|++|+..+|+.++.+|.+.+.++.+.+++..+.+.|..|+..
T Consensus        48 ~~~~~~~n~~i~~l~~~g~~~~A~~l~~~m~~-----~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~  122 (857)
T PLN03077         48 SSSTHDSNSQLRALCSHGQLEQALKLLESMQE-----LRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVR  122 (857)
T ss_pred             ccchhhHHHHHHHHHhCCCHHHHHHHHHHHHh-----cCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCch
Confidence            34566788999999999999999999999987     7899999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhHHHHHHHHHcCCHHHHHHHHHHhhhCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHCCCCCCHHHHHH
Q psy767          120 TYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMSQAGLEPSAQTYTK  199 (902)
Q Consensus       120 t~~~ll~~~~li~~~~~~g~~~~A~~l~~~m~~~~~~p~~~~yn~Li~~~~~~g~~~~A~~l~~~M~~~g~~pd~~ty~~  199 (902)
                      .++++      |++|++.|+++.|.++|++|.+    ||..+||+||.+|++.|++++|+++|++|...|+.||..||++
T Consensus       123 ~~n~l------i~~~~~~g~~~~A~~~f~~m~~----~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~  192 (857)
T PLN03077        123 LGNAM------LSMFVRFGELVHAWYVFGKMPE----RDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPC  192 (857)
T ss_pred             HHHHH------HHHHHhCCChHHHHHHHhcCCC----CCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHH
Confidence            99999      9999999999999999999975    5679999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCChhHHHHHHHhcccCCCccchhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCC
Q psy767          200 LMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGD  279 (902)
Q Consensus       200 ll~a~~~~g~~~~a~~l~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~l~~~m~~~g~~pd~~ty~~LI~a~~~~g~  279 (902)
                      ++++|+..+++..+.+++..+.+.+..++...++.++..|+++|+++.|.++|++|.    .||.++||+||.+|++.|+
T Consensus       193 ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~----~~d~~s~n~li~~~~~~g~  268 (857)
T PLN03077        193 VLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMP----RRDCISWNAMISGYFENGE  268 (857)
T ss_pred             HHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCC----CCCcchhHHHHHHHHhCCC
Confidence            999999999999999999999999999999999999999999999999999999997    6899999999999999999


Q ss_pred             HHHHHHHHHHhccCCCCCCHHHHHHHHHHcCCcccHHHHHHHHHHhhhhhcccccchHHhcCCCCCHHHHHHHHHHHHHc
Q psy767          280 MDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKH  359 (902)
Q Consensus       280 ~~~A~~lf~~m~~~~~~p~~~tl~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~m~~~g~~p~~~t~~~Li~~y~~~  359 (902)
                      +++|+++|.+|...|+.|+..++..++..|...+..+.+.+++.            .+.+.|+.||..+||+||.+|+++
T Consensus       269 ~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~------------~~~~~g~~~d~~~~n~Li~~y~k~  336 (857)
T PLN03077        269 CLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHG------------YVVKTGFAVDVSVCNSLIQMYLSL  336 (857)
T ss_pred             HHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHH------------HHHHhCCccchHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999986            489999999999999999999999


Q ss_pred             CCHHHHHHHHHHcCCCCCcccHHHHHHHHHHcCChHHHHHHHHHcccCCCCCCCHHH---HHHHHHHcCCHHHHHHHHHH
Q psy767          360 GDMDSIRRLLAQNGSSLVNGDYLDIIHALAVSGHGEYIDEIISKIQPGVGYSADAAN---HIYHLINKGQIDAAYRIVNT  436 (902)
Q Consensus       360 g~~~~A~~~~~~m~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~~g~~pd~~t---~i~~l~~~g~~~~A~~~~~~  436 (902)
                      |++++|.++|++|.. ++..+|+++|.+|++.|++++|+++|++|.+ .|+.||..|   ++.+|++.|++++|.++++.
T Consensus       337 g~~~~A~~vf~~m~~-~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~-~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~  414 (857)
T PLN03077        337 GSWGEAEKVFSRMET-KDAVSWTAMISGYEKNGLPDKALETYALMEQ-DNVSPDEITIASVLSACACLGDLDVGVKLHEL  414 (857)
T ss_pred             CCHHHHHHHHhhCCC-CCeeeHHHHHHHHHhCCCHHHHHHHHHHHHH-hCCCCCceeHHHHHHHHhccchHHHHHHHHHH
Confidence            999999999999975 4777899999999999999999999999998 899999886   58889999999999999999


Q ss_pred             HHhccCCCCCcccchhhHHHhhhhcCCCCCccccchHH-HHHHHHhcCChHHHHHHHHHHHHccCCCCCccchHHHHHHH
Q psy767          437 LARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAAN-HIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRH  515 (902)
Q Consensus       437 m~~~~~i~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~-li~~~~k~g~~~~A~~l~~~m~~~~~~~~~~~~~~n~li~~  515 (902)
                      |.+. ++.++.                       .+++ +|.+|+++|++++|.++|+.|...      +..+||++|.+
T Consensus       415 ~~~~-g~~~~~-----------------------~~~n~Li~~y~k~g~~~~A~~vf~~m~~~------d~vs~~~mi~~  464 (857)
T PLN03077        415 AERK-GLISYV-----------------------VVANALIEMYSKCKCIDKALEVFHNIPEK------DVISWTSIIAG  464 (857)
T ss_pred             HHHh-CCCcch-----------------------HHHHHHHHHHHHcCCHHHHHHHHHhCCCC------CeeeHHHHHHH
Confidence            9876 333332                       3444 888899999999999999999764      45689999999


Q ss_pred             HHHcCCCHHHHHHHHHHHHHCCCCCChhhHHHHHHHhcccccccCcchhhHhhhhhccCcch---------------HHH
Q psy767          516 MVKTNQPIDKVLAVCHRLTDENLHPRAFNLAVLIKAHVLKEDYTGAVETFEYCVNQFRATPW---------------KGE  580 (902)
Q Consensus       516 ~~~~g~~~~~A~~l~~~m~~~g~~Pd~~t~~~ll~a~~~~~~~~g~~~~~~~~~~~~~a~~~---------------~~~  580 (902)
                      |++.|+ .++|+.+|++|.. ++.||..||++++.++ +   +.|.++.         +.++               ...
T Consensus       465 ~~~~g~-~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~-~---~~g~l~~---------~~~i~~~~~~~g~~~~~~~~na  529 (857)
T PLN03077        465 LRLNNR-CFEALIFFRQMLL-TLKPNSVTLIAALSAC-A---RIGALMC---------GKEIHAHVLRTGIGFDGFLPNA  529 (857)
T ss_pred             HHHCCC-HHHHHHHHHHHHh-CCCCCHhHHHHHHHHH-h---hhchHHH---------hHHHHHHHHHhCCCccceechH
Confidence            999999 9999999999986 6999999999999998 6   6676655         3220               011


Q ss_pred             HHHHHHHhhHHHhhhhhhhcccccccchhhhHHHHHhh----hHHHHHHHHHHHHHHhCCCCChHHHHHhhhccCC-CCC
Q psy767          581 LLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLMLSF----LDAEVLRILQVAEAEFGVGSNTETLRDYVLPVLS-PPN  655 (902)
Q Consensus       581 ll~~m~~~g~~~~~~~~~~~~~~i~p~~~~~~~li~~~----~~~~al~ll~~m~~~~g~~P~~~t~~~lv~~~~~-~~~  655 (902)
                      +++.+.+.|+.+.+..+|.-.   .|+..+|+.+|.+.    ..++|+++|++| .+.|+.||..||..++.+|.+ +..
T Consensus       530 Li~~y~k~G~~~~A~~~f~~~---~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M-~~~g~~Pd~~T~~~ll~a~~~~g~v  605 (857)
T PLN03077        530 LLDLYVRCGRMNYAWNQFNSH---EKDVVSWNILLTGYVAHGKGSMAVELFNRM-VESGVNPDEVTFISLLCACSRSGMV  605 (857)
T ss_pred             HHHHHHHcCCHHHHHHHHHhc---CCChhhHHHHHHHHHHcCCHHHHHHHHHHH-HHcCCCCCcccHHHHHHHHhhcChH
Confidence            566777788888888888765   56689999999544    499999999999 999999999999999999998 444


Q ss_pred             CChHHHHHHHH-hcCCCCccchHHHHHHH-HHhcCHHHHHHHHHHhhhhhchhhccchhhhhhhccCCchhHHHHHHHHH
Q psy767          656 QVSGEVFSQLR-SVGVTIGSITSAYVVHM-LRQHNLKEAALLAKSFRAHYAKVVVRPVLAVSYLRTQDLPSLVTVVRAVC  733 (902)
Q Consensus       656 ~~~~~~~~~l~-~~g~~~~~~~~~~l~~~-~~~g~~~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  733 (902)
                      +...++++.|+ +.|+.|+..++.+|+.+ +|.|++++|.+++++|+..++..+|...+. +|+..++.+......+.+.
T Consensus       606 ~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~-ac~~~~~~e~~e~~a~~l~  684 (857)
T PLN03077        606 TQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLN-ACRIHRHVELGELAAQHIF  684 (857)
T ss_pred             HHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHH-HHHHcCChHHHHHHHHHHH
Confidence            44555899998 79999999999999999 799999999999999987788777766555 6788888887777766665


Q ss_pred             hhhhcCCCcchhhhhhhhhhhhhhhhhhhHHHHH-HHHHHHHhhcCcchhhHHHHHHHHHHhccccccccch
Q psy767          734 ENWEKGEEGEKEEEGEEKTAGQLIDMDRIFAGNV-LLDIYKATRQDPNVVSHLEQLLNAFVEHAIPISAFSS  804 (902)
Q Consensus       734 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  804 (902)
                      + ++                      |++...++ |.+++.+..+    .+...++.+.+++.|+.-++..+
T Consensus       685 ~-l~----------------------p~~~~~y~ll~n~ya~~g~----~~~a~~vr~~M~~~g~~k~~g~s  729 (857)
T PLN03077        685 E-LD----------------------PNSVGYYILLCNLYADAGK----WDEVARVRKTMRENGLTVDPGCS  729 (857)
T ss_pred             h-hC----------------------CCCcchHHHHHHHHHHCCC----hHHHHHHHHHHHHcCCCCCCCcc
Confidence            2 22                      22233333 4456654443    57789999999999999877654



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4318|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4318|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4422|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3941|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG3941|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query902
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-07
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 3e-05
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-04
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-04
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 3e-04
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 5e-04
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 72.2 bits (176), Expect = 5e-13
 Identities = 77/443 (17%), Positives = 129/443 (29%), Gaps = 129/443 (29%)

Query: 39  LVLLVLLFVYLNSKWCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHY-NALLRVYLDNE 97
           L +L  L   ++  W S       N+           EL   L    Y N LL V L N 
Sbjct: 199 LEMLQKLLYQIDPNWTSRSD-HSSNIK--LRIHSIQAELRRLLKSKPYENCLL-V-LLN- 252

Query: 98  HTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKY---CQDGNIEGATKILEFMRDKT 154
                                      + N+K  + +   C         KIL   R K 
Sbjct: 253 ---------------------------VQNAKAWNAFNLSC---------KILLTTRFK- 275

Query: 155 FPISEGVFNALI---YGHSQANDMAS------AEGIL---TMMSQAGLEPSAQTYTKL-- 200
                 V + L      H   +  +        + +L          L     T      
Sbjct: 276 -----QVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRL 330

Query: 201 -MCG-----------YAKHGDMDSIKTKIPS----LKP--QSELFLCFS-FQL-----TN 236
            +               KH + D + T I S    L+P    ++F   S F       T 
Sbjct: 331 SIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTI 390

Query: 237 LLILVSSDMAS--AEGILTMMSQAGL---EPSAQTYT----------KLMCGYAKHG--- 278
           LL L+  D+       ++  + +  L   +P   T +          KL   YA H    
Sbjct: 391 LLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIV 450

Query: 279 DMDSVRRLLAQSGSSLVNGD---YLDIIHALAVSGHGEYIDEVSAIVCFVNICFHWLEG- 334
           D  ++ +            D   Y  I H L    H E +     +  F++  F +LE  
Sbjct: 451 DHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMV--FLD--FRFLEQK 506

Query: 335 ------PMMSQAGLEPSAQ---TYTKLMCGYAKHGDM--DSIRRLLAQNGSSLVNGDYLD 383
                    +   +  + Q    Y   +C      +   ++I   L +   +L+   Y D
Sbjct: 507 IRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKIEENLICSKYTD 566

Query: 384 IIHALAVSG-HGEYIDEIISKIQ 405
           ++  +A+        +E   ++Q
Sbjct: 567 LLR-IALMAEDEAIFEEAHKQVQ 588


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query902
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.86
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.85
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.76
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.74
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.73
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.73
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.63
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.59
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.58
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.58
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.57
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.52
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.51
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.49
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.48
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.47
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.47
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.45
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.44
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.42
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.42
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.42
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.39
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.38
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.35
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.35
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.31
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.28
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.25
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.22
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.2
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.17
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.16
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.15
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.14
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.12
3u4t_A272 TPR repeat-containing protein; structural genomics 99.1
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.1
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.09
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.0
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.0
3u4t_A272 TPR repeat-containing protein; structural genomics 98.95
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.91
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.91
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.89
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.89
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.87
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.87
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.84
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.84
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.82
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.81
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.76
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.76
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.75
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.75
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.73
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.72
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.72
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.69
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.62
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.61
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.59
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.59
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.55
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.55
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.54
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.52
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.52
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.5
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.48
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.48
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.47
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.4
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.36
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.32
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.32
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.24
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.23
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.22
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.14
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.13
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.03
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.03
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.0
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.0
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.99
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.95
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.94
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.92
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.92
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 97.9
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.9
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 97.88
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.87
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.85
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.81
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.78
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.78
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.78
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.74
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.74
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.72
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.7
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.69
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.67
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.67
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.66
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.66
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.63
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.6
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.59
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.57
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.57
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.56
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.55
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.55
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.54
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.49
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.48
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.45
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.43
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.43
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.42
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.39
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.36
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.36
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.35
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.34
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.33
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.32
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.31
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.31
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.3
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.29
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.29
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.24
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.23
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.21
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.21
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.21
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.19
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.17
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.14
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.09
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.01
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.99
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.98
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 96.94
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.88
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 96.83
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.82
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.8
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.77
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.76
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.75
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.7
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.68
3k9i_A117 BH0479 protein; putative protein binding protein, 96.59
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.54
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.5
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.48
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.45
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 96.43
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.31
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.31
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.26
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 96.22
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.2
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.05
3k9i_A117 BH0479 protein; putative protein binding protein, 95.95
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 95.93
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 95.91
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.89
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.86
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.81
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.74
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.56
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.55
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.46
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.38
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.22
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.96
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 94.94
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.71
1klx_A138 Cysteine rich protein B; structural genomics, heli 94.34
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.26
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 93.85
3qww_A433 SET and MYND domain-containing protein 2; methyltr 93.74
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.52
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 93.07
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 92.92
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 92.88
3qww_A433 SET and MYND domain-containing protein 2; methyltr 92.66
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.28
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 91.97
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 90.87
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 90.79
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 89.61
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 89.42
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 88.96
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 88.68
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 87.09
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 87.01
1pc2_A152 Mitochondria fission protein; unknown function; NM 85.29
1pc2_A152 Mitochondria fission protein; unknown function; NM 84.9
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 84.55
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 84.26
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 83.94
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 83.34
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 82.9
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 82.37
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.36
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 81.04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 80.55
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 80.5
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 80.2
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=99.97  E-value=1.2e-29  Score=301.89  Aligned_cols=451  Identities=11%  Similarity=-0.035  Sum_probs=344.9

Q ss_pred             ccCCCCCCcCcccccCccccccCCCCCCCCHHHHHHHHHHHHHCCCchHHHHHHHHHHHCCCCCCHHHHHHHHHhHHHHH
Q psy767           53 WCSEPSLGPGNLPCEDPFSVHTGELDVPLDISHYNALLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLIS  132 (902)
Q Consensus        53 ~~~~g~~~~A~~~f~~~~~~~~~~~g~~pd~~~yn~li~~~~~~g~~~~A~~l~~~M~~~g~~pd~~t~~~ll~~~~li~  132 (902)
                      +.+.|.+..++..|..++.         +++..|+.++..|.+.|++++|..+|++|..  ..|+..++..+      +.
T Consensus        63 ~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l------~~  125 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSL---------SREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWL------AQ  125 (597)
T ss_dssp             ----------------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHH------HH
T ss_pred             ccccCccCCCCCccccchH---------HHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHH------HH
Confidence            4556777777777777776         7899999999999999999999999999984  56788889888      99


Q ss_pred             HHHHcCCHHHHHHHHHHhhhCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHH-HC--------------CCCCCHHHH
Q psy767          133 KYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYGHSQANDMASAEGILTMMS-QA--------------GLEPSAQTY  197 (902)
Q Consensus       133 ~~~~~g~~~~A~~l~~~m~~~~~~p~~~~yn~Li~~~~~~g~~~~A~~l~~~M~-~~--------------g~~pd~~ty  197 (902)
                      +|.+.|++++|..+|+.+...  +++..+|+.++.+|.+.|++++|+++|+++. ..              |..++..+|
T Consensus       126 ~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  203 (597)
T 2xpi_A          126 VYCCTGDYARAKCLLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMC  203 (597)
T ss_dssp             HHHHTTCHHHHHHHHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHH
T ss_pred             HHHHcCcHHHHHHHHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHH
Confidence            999999999999999988643  6788999999999999999999999999532 21              233458899


Q ss_pred             HHHHHHHHHcCChhHHHHHHHhcccCCCccchhhHHHH--------------------------------------HHHH
Q psy767          198 TKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLT--------------------------------------NLLI  239 (902)
Q Consensus       198 ~~ll~a~~~~g~~~~a~~l~~~~~~~~~~~~~~~~~~~--------------------------------------~~~~  239 (902)
                      +.++.+|.+.|++++|.++|+++...++... ..+..+                                      ...+
T Consensus       204 ~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~-~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  282 (597)
T 2xpi_A          204 YLRGQVYTNLSNFDRAKECYKEALMVDAKCY-EAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKT  282 (597)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHHCTTCH-HHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTT
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhCchhh-HHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHH
Confidence            9999999999999999999999987543321 111111                                      2223


Q ss_pred             HhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHhccCCCCCCHHHHHHHHHHcCCcccHHHHH
Q psy767          240 LVSSDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVS  319 (902)
Q Consensus       240 ~~~g~~~~A~~l~~~m~~~g~~pd~~ty~~LI~a~~~~g~~~~A~~lf~~m~~~~~~p~~~tl~~~l~~~~~~~~~~~~~  319 (902)
                      ...|++++|.++|+++...  +++..+|+.++.+|.+.|++++|+++|+++.                            
T Consensus       283 ~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~----------------------------  332 (597)
T 2xpi_A          283 SHEDELRRAEDYLSSINGL--EKSSDLLLCKADTLFVRSRFIDVLAITTKIL----------------------------  332 (597)
T ss_dssp             TTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHH----------------------------
T ss_pred             cCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHHHHhcCHHHHHHHHHHHH----------------------------
Confidence            4578889999999888765  5889999999999999999999999998742                            


Q ss_pred             HHHHHhhhhhcccccchHHhcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHcC-CCCC-cccHHHHHHHHHHcCChHHH
Q psy767          320 AIVCFVNICFHWLEGPMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIRRLLAQNG-SSLV-NGDYLDIIHALAVSGHGEYI  397 (902)
Q Consensus       320 ~l~~~~~~~~~~~~~~~m~~~g~~p~~~t~~~Li~~y~~~g~~~~A~~~~~~m~-~~~~-~~~~~~li~~~~~~g~~~~A  397 (902)
                                         +.+ +.+..+|+.++.+|.+.|++++|..+|+++. ..+. ...|+.++..|.+.|++++|
T Consensus       333 -------------------~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A  392 (597)
T 2xpi_A          333 -------------------EID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGIYYLCVNKISEA  392 (597)
T ss_dssp             -------------------HHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTSHHHHHHHHHHHHHTTCHHHH
T ss_pred             -------------------HcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHhccHHHH
Confidence                               222 2266788999999999999999999999863 2233 23488899999999999999


Q ss_pred             HHHHHHcccCCCCCCCHH----HHHHHHHHcCCHHHHHHHHHHHHhccCCCCCcccchhhHHHhhhhcCCCCCccccchH
Q psy767          398 DEIISKIQPGVGYSADAA----NHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAA  473 (902)
Q Consensus       398 ~~l~~~m~~~~g~~pd~~----t~i~~l~~~g~~~~A~~~~~~m~~~~~i~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~  473 (902)
                      .++|+++.+   ..|+..    .+...+.+.|++++|.++|+++.+...   ...                     ....
T Consensus       393 ~~~~~~~~~---~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~---~~~---------------------~~~~  445 (597)
T 2xpi_A          393 RRYFSKSST---MDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQ---GTH---------------------LPYL  445 (597)
T ss_dssp             HHHHHHHHH---HCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTT---TCS---------------------HHHH
T ss_pred             HHHHHHHHH---hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCc---cch---------------------HHHH
Confidence            999999987   445433    256778899999999999999886522   111                     0234


Q ss_pred             HHHHHHHhcCChHHHHHHHHHHHHccCCCCCccchHHHHHHHHHHcCCCHHHHHHHHHHHHHC----CCCCC--hhhHHH
Q psy767          474 NHIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDE----NLHPR--AFNLAV  547 (902)
Q Consensus       474 ~li~~~~k~g~~~~A~~l~~~m~~~~~~~~~~~~~~n~li~~~~~~g~~~~~A~~l~~~m~~~----g~~Pd--~~t~~~  547 (902)
                      .+...|.+.|++++|.++|+.+....   +.++.+|+.++..|.+.|+ +++|+++|++|.+.    +..|+  ..+|..
T Consensus       446 ~l~~~~~~~g~~~~A~~~~~~~~~~~---~~~~~~~~~l~~~~~~~g~-~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~  521 (597)
T 2xpi_A          446 FLGMQHMQLGNILLANEYLQSSYALF---QYDPLLLNELGVVAFNKSD-MQTAINHFQNALLLVKKTQSNEKPWAATWAN  521 (597)
T ss_dssp             HHHHHHHHHTCHHHHHHHHHHHHHHC---CCCHHHHHHHHHHHHHTTC-HHHHHHHHHHHHHHHHHSCCCSGGGHHHHHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhC---CCChHHHHHHHHHHHHhCC-HHHHHHHHHHHHHhhhccccchhhHHHHHHH
Confidence            47777999999999999999998763   2356789999999999999 99999999999876    78898  789999


Q ss_pred             HHHHhcccccccCcchhhHhhhhhccCcchHHHHHHHHHHhhHHHhhhhhhhcccccccchhhhHHHH----HhhhHHHH
Q psy767          548 LIKAHVLKEDYTGAVETFEYCVNQFRATPWKGELLKRFIQAEDAACLQRITDLSTSIHGEVNSLYDLM----LSFLDAEV  623 (902)
Q Consensus       548 ll~a~~~~~~~~g~~~~~~~~~~~~~a~~~~~~ll~~m~~~g~~~~~~~~~~~~~~i~p~~~~~~~li----~~~~~~~a  623 (902)
                      +..++ +   +.|+.++         |..    +|+++.+.+             +-+  +..+..+.    ..|.+++|
T Consensus       522 l~~~~-~---~~g~~~~---------A~~----~~~~~~~~~-------------p~~--~~~~~~l~~~~~~~g~~~~A  569 (597)
T 2xpi_A          522 LGHAY-R---KLKMYDA---------AID----ALNQGLLLS-------------TND--ANVHTAIALVYLHKKIPGLA  569 (597)
T ss_dssp             HHHHH-H---HTTCHHH---------HHH----HHHHHHHHS-------------SCC--HHHHHHHHHHHHHTTCHHHH
T ss_pred             HHHHH-H---HhcCHHH---------HHH----HHHHHHHhC-------------CCC--hHHHHHHHHHHHHhCCHHHH
Confidence            99888 7   8999999         888    888887764             112  33443333    34449999


Q ss_pred             HHHHHHHHHHhCCCCC
Q psy767          624 LRILQVAEAEFGVGSN  639 (902)
Q Consensus       624 l~ll~~m~~~~g~~P~  639 (902)
                      ++.++++ .+.  .|+
T Consensus       570 ~~~~~~~-l~~--~p~  582 (597)
T 2xpi_A          570 ITHLHES-LAI--SPN  582 (597)
T ss_dssp             HHHHHHH-HHH--CTT
T ss_pred             HHHHHHH-Hhc--CCC
Confidence            9999999 443  455



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 902
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-05
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-05
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-05
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-05
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-05
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-05
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 5e-05
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 6e-05
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 7e-05
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 8e-05
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 9e-05
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-04
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-04
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 1e-04
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-04
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-04
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-04
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-04
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-04
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 3e-04
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 3e-04
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 4e-04
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-04
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-04
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 5e-04
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 6e-04
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 6e-04
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 7e-04
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 0.002
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 0.002
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 0.003
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 0.004
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Twitchin, kinase domain
species: California sea hare (Aplysia californica), twk43 [TaxId: 6500]
 Score = 46.2 bits (109), Expect = 1e-05
 Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 3/54 (5%)

Query: 851 RCLDKDPLRRWSCDQLLRHPYFNGYYFEVPDEM---QYEEITQVSRLPTKDKNK 901
             L K+P +R +    L HP+  G +  +   +   +Y +I Q  +    D   
Sbjct: 265 NLLQKEPRKRLTVHDALEHPWLKGDHSNLTSRIPSSRYNKIRQKIKEKYADWPA 318


>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query902
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.66
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.64
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.05
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.04
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.55
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.51
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.44
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.41
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.34
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.15
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.04
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.03
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.0
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 97.97
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.57
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.48
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.45
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.39
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.37
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.28
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.23
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.21
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.21
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.13
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.12
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.91
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 96.88
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 96.73
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.72
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.64
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.21
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.18
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.12
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.95
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.76
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.75
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 95.75
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 95.63
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.62
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.61
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 94.57
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 94.53
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 94.52
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 94.29
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 93.52
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 92.99
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 92.14
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 91.75
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 91.49
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 90.89
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 89.8
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 87.9
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 87.85
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 86.6
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 85.85
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 84.81
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 84.33
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 84.21
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 84.11
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 83.28
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 82.8
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 82.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 80.24
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66  E-value=1.5e-13  Score=149.18  Aligned_cols=371  Identities=13%  Similarity=0.054  Sum_probs=272.8

Q ss_pred             HHHHHHHCCCchHHHHHHHHHHHCCCCCCHHHHHHHHHhHHHHHHHHHcCCHHHHHHHHHHhhhCCCCCCHHHHHHHHHH
Q psy767           89 LLRVYLDNEHTFSPTDFLAKLESQGIEPNRVTYQQLISNSKLISKYCQDGNIEGATKILEFMRDKTFPISEGVFNALIYG  168 (902)
Q Consensus        89 li~~~~~~g~~~~A~~l~~~M~~~g~~pd~~t~~~ll~~~~li~~~~~~g~~~~A~~l~~~m~~~~~~p~~~~yn~Li~~  168 (902)
                      +...+.+.|++++|.+.|+++.+... -+...+..+      ...|.+.|++++|...|+...+.+ |-+..+|..+...
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~p-~~~~~~~~l------a~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~   76 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQEP-DNTGVLLLL------SSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNV   76 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHCT-TCHHHHHHH------HHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhCC-CCHHHHHHH------HHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHH
Confidence            34557788999999999999987532 256677777      889999999999999999987765 5567889999999


Q ss_pred             HHhCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChhHHHHHHHhcccCCCccchhhHHHHHHHHHhcCCHHHH
Q psy767          169 HSQANDMASAEGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSIKTKIPSLKPQSELFLCFSFQLTNLLILVSSDMASA  248 (902)
Q Consensus       169 ~~~~g~~~~A~~l~~~M~~~g~~pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A  248 (902)
                      |.+.|++++|+..+........ .+...+..........+....+............. ...............+....+
T Consensus        77 ~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~  154 (388)
T d1w3ba_          77 YKERGQLQEAIEHYRHALRLKP-DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPD-LYCVRSDLGNLLKALGRLEEA  154 (388)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTT-CTHHHHHHHHHHHTTSCHHHH
T ss_pred             hhhhcccccccccccccccccc-ccccccccccccccccccccccccccccccccccc-cccccccccccccccchhhhh
Confidence            9999999999999999988753 34455555555555556655555544443332222 222333344445567778888


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHhccCCCCCCHHHHHHHHHHcCCcccHHHHHHHHHHhhhh
Q psy767          249 EGILTMMSQAGLEPSAQTYTKLMCGYAKHGDMDSVRRLLAQSGSSLVNGDYLDIIHALAVSGHGEYIDEVSAIVCFVNIC  328 (902)
Q Consensus       249 ~~l~~~m~~~g~~pd~~ty~~LI~a~~~~g~~~~A~~lf~~m~~~~~~p~~~tl~~~l~~~~~~~~~~~~~~l~~~~~~~  328 (902)
                      ...+....... +.+...+..+...+...|++++|...+.+...                                    
T Consensus       155 ~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~------------------------------------  197 (388)
T d1w3ba_         155 KACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVT------------------------------------  197 (388)
T ss_dssp             HHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHH------------------------------------
T ss_pred             HHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHH------------------------------------
Confidence            88777776653 45677888888999999999999999986321                                    


Q ss_pred             hcccccchHHhcCCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHcCC-CCCc-ccHHHHHHHHHHcCChHHHHHHHHHcc
Q psy767          329 FHWLEGPMMSQAGLEP-SAQTYTKLMCGYAKHGDMDSIRRLLAQNGS-SLVN-GDYLDIIHALAVSGHGEYIDEIISKIQ  405 (902)
Q Consensus       329 ~~~~~~~~m~~~g~~p-~~~t~~~Li~~y~~~g~~~~A~~~~~~m~~-~~~~-~~~~~li~~~~~~g~~~~A~~l~~~m~  405 (902)
                                   ..| +..+|..+...|...|++++|...|.+... .+.. ..+..+...+...|++++|.+.|++..
T Consensus       198 -------------~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al  264 (388)
T d1w3ba_         198 -------------LDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAI  264 (388)
T ss_dssp             -------------HCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred             -------------hCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
Confidence                         123 456788888999999999999999987422 2222 236778889999999999999999988


Q ss_pred             cCCCCCCCHHH----HHHHHHHcCCHHHHHHHHHHHHhccCCCCCcccchhhHHHhhhhcCCCCCccccchHHHHHHHHh
Q psy767          406 PGVGYSADAAN----HIYHLINKGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPGVGYSADAANHIYHLIN  481 (902)
Q Consensus       406 ~~~g~~pd~~t----~i~~l~~~g~~~~A~~~~~~m~~~~~i~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~li~~~~k  481 (902)
                      +   ..|+...    +...+...|++++|.+.++.........+.                        ....+...+.+
T Consensus       265 ~---~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~------------------------~~~~l~~~~~~  317 (388)
T d1w3ba_         265 E---LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHAD------------------------SLNNLANIKRE  317 (388)
T ss_dssp             H---TCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHH------------------------HHHHHHHHHHT
T ss_pred             H---hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccch------------------------hhhHHHHHHHH
Confidence            7   5666543    345567899999999999988765322111                        13345566889


Q ss_pred             cCChHHHHHHHHHHHHccCCCCCccchHHHHHHHHHHcCCCHHHHHHHHHHHHHCCCCCC-hhhHHHHHHHh
Q psy767          482 KGQIDAAYRIVNTLARSANINGEQLPVGGFLVRHMVKTNQPIDKVLAVCHRLTDENLHPR-AFNLAVLIKAH  552 (902)
Q Consensus       482 ~g~~~~A~~l~~~m~~~~~~~~~~~~~~n~li~~~~~~g~~~~~A~~l~~~m~~~g~~Pd-~~t~~~ll~a~  552 (902)
                      .|++++|.+.|++....   .|..+.++..+...+...|+ +++|+..|++..+  +.|+ ...|..+..++
T Consensus       318 ~~~~~~A~~~~~~al~~---~p~~~~~~~~la~~~~~~g~-~~~A~~~~~~al~--l~P~~~~a~~~lg~~~  383 (388)
T d1w3ba_         318 QGNIEEAVRLYRKALEV---FPEFAAAHSNLASVLQQQGK-LQEALMHYKEAIR--ISPTFADAYSNMGNTL  383 (388)
T ss_dssp             TTCHHHHHHHHHHHTTS---CTTCHHHHHHHHHHHHTTTC-CHHHHHHHHHHHT--TCTTCHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHh---CCCCHHHHHHHHHHHHHcCC-HHHHHHHHHHHHH--hCCCCHHHHHHHHHHH
Confidence            99999999999988765   33456788889999999999 9999999999776  4675 55666666544



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure