Psyllid ID: psy7691


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MHNHAKTQERAARLSESEVEAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVINFDYPNSSEDYIHRIGRTGRCASSGTAYTFFTPNNGKQAKELIAVLTEASQPIPPQLQDLANSNPNSKGG
ccccccccHHHHcccHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEEcccccEEEEEEccccccccHHHHcccccccccccccEEEEEccccHHHHHHHHHHHHHccccccHHHHHHHHHccccccc
ccccEEccHHHHHccHHHHHHHHHHccEEEEccccccccccHHHccccHHHHHHHHHcccccccHHHHccHHHHHccccEEEEEEcccccccEEEEccccccHHHHEEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHcccccHHHHHHHHHccccccc
MHNHAKTQERAARLSESEVEAFRQKKEitvkgnnipcptqeltegcfpnavlqhlkgqgfeeptaiqaqgwpialsgrdmvgiaqtgsgktlAVINfdypnssedyihrigrtgrcassgtaytfftpnngKQAKELIAVLTeasqpippqlqdlansnpnskgg
mhnhaktqeraarlseseveafrqkkeitvkgnniPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVINFDYPNSSEDYIHRIGRTGRCASSGTAYTFFTPNNGKQAKELIAVLTEASqpippqlqdlansnpnskgg
MHNHAKTQERAARLSESEVEAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVINFDYPNSSEDYIHRIGRTGRCASSGTAYTFFTPNNGKQAKELIAVLTEASQPIPPQLQDLANSNPNSKGG
****************************TVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVINFDYPNSSEDYIHRIGRTGRCASSGTAYTFFTPNNGKQAKELIAVL************************
MHNHAKTQERAARLSESEVEAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVINFDYPNSSEDYIHRIGRT**CASSGTAYTFFTPNNGKQAKELIAVLTEASQPIPPQLQD***********
*******************EAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVINFDYPNSSEDYIHRIGRTGRCASSGTAYTFFTPNNGKQAKELIAVLTEASQPIPPQLQDLAN********
*HNHAKTQERAARLSESEVEAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVINFDYPNSSEDYIHRIGRTGRCASSGTAYTFFTPNNGKQAKELIAVLTEASQPIPPQLQDLANSN******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHNHAKTQERAARLSESEVEAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVINFDYPNSSEDYIHRIGRTGRCASSGTAYTFFTPNNGKQAKELIAVLTEASQPIPPQLQDLANSNPNSKGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query165 2.2.26 [Sep-21-2011]
Q4X195 547 ATP-dependent RNA helicas yes N/A 0.490 0.148 0.658 7e-25
A1DGZ7 545 ATP-dependent RNA helicas N/A N/A 0.490 0.148 0.658 7e-25
Q8SRB2 495 ATP-dependent RNA helicas yes N/A 0.521 0.173 0.559 6e-24
A6RGE3 542 ATP-dependent RNA helicas N/A N/A 0.472 0.143 0.628 2e-23
A2QC74 565 ATP-dependent RNA helicas yes N/A 0.515 0.150 0.561 2e-23
Q2U070 554 ATP-dependent RNA helicas yes N/A 0.503 0.149 0.590 2e-23
Q5QMN3 494 DEAD-box ATP-dependent RN yes N/A 0.515 0.172 0.552 3e-23
A1C6C4 549 ATP-dependent RNA helicas N/A N/A 0.472 0.142 0.615 3e-23
Q5B0J9 563 ATP-dependent RNA helicas yes N/A 0.478 0.140 0.607 3e-23
Q4IF76 555 ATP-dependent RNA helicas yes N/A 0.472 0.140 0.589 8e-23
>sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 64/82 (78%), Gaps = 1/82 (1%)

Query: 11  AARLSESEVEAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQG 70
           AAR SE EVE FR+K E+TV+G N+P P +   E  FP  VL  +K QGFE PTAIQ+QG
Sbjct: 93  AAR-SEREVEEFRKKHEMTVQGRNVPRPVENFDEAGFPQYVLSEVKAQGFERPTAIQSQG 151

Query: 71  WPIALSGRDMVGIAQTGSGKTL 92
           WP+ALSGRD+VGIA+TGSGKTL
Sbjct: 152 WPMALSGRDVVGIAETGSGKTL 173




ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing.
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (taxid: 330879)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 Back     alignment and function description
>sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 Back     alignment and function description
>sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 Back     alignment and function description
>sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
383862185 713 PREDICTED: probable ATP-dependent RNA he 0.6 0.138 0.552 5e-26
380014980 728 PREDICTED: probable ATP-dependent RNA he 0.563 0.127 0.554 2e-25
340717724 713 PREDICTED: probable ATP-dependent RNA he 0.563 0.130 0.554 2e-25
350418218 712 PREDICTED: probable ATP-dependent RNA he 0.563 0.130 0.554 2e-25
328780921 726 PREDICTED: probable ATP-dependent RNA he 0.563 0.128 0.554 2e-25
332025289 706 Putative ATP-dependent RNA helicase DDX1 0.539 0.126 0.621 8e-25
307202009 724 Probable ATP-dependent RNA helicase DDX1 0.6 0.136 0.536 9e-25
307183175 705 Probable ATP-dependent RNA helicase DDX1 0.539 0.126 0.621 1e-24
345493222 710 PREDICTED: probable ATP-dependent RNA he 0.6 0.139 0.528 1e-24
258617566 646 DEAD box ATP-dependent RNA helicase-like 0.533 0.136 0.619 2e-24
>gi|383862185|ref|XP_003706564.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 82/125 (65%), Gaps = 26/125 (20%)

Query: 65  AIQAQGWP-IALSG------RDMVGIAQTGSGKTLA------------------VINFDY 99
           AI+ +GWP I++ G      RD V +++  +GKT+                   VINFDY
Sbjct: 372 AIKREGWPAISIHGDKSQPERDYV-LSEFRNGKTMILVATDVAARGLDVEDVKYVINFDY 430

Query: 100 PNSSEDYIHRIGRTGRCASSGTAYTFFTPNNGKQAKELIAVLTEASQPIPPQLQDLANSN 159
           PNSSEDYIHRIGRTGRC S+GTAY +FTPNN +QAKELI+VL EA Q I PQL DLANS 
Sbjct: 431 PNSSEDYIHRIGRTGRCQSAGTAYAYFTPNNARQAKELISVLEEAGQVINPQLADLANSI 490

Query: 160 PNSKG 164
            NS G
Sbjct: 491 KNSYG 495




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380014980|ref|XP_003691490.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Apis florea] Back     alignment and taxonomy information
>gi|340717724|ref|XP_003397328.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350418218|ref|XP_003491789.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328780921|ref|XP_394723.3| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Apis mellifera] Back     alignment and taxonomy information
>gi|332025289|gb|EGI65460.1| Putative ATP-dependent RNA helicase DDX17 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307202009|gb|EFN81574.1| Probable ATP-dependent RNA helicase DDX17 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307183175|gb|EFN70084.1| Probable ATP-dependent RNA helicase DDX17 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345493222|ref|XP_003427025.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|258617566|gb|ACV83780.1| DEAD box ATP-dependent RNA helicase-like protein [Heliconius melpomene] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
FB|FBgn0029979 945 CG10777 [Drosophila melanogast 0.430 0.075 0.690 1.5e-43
ASPGD|ASPL0000006660 563 AN5931 [Emericella nidulans (t 0.478 0.140 0.607 1.4e-42
UNIPROTKB|F1MBQ8 614 DDX5 "Uncharacterized protein" 0.509 0.136 0.583 3.9e-42
UNIPROTKB|J3KTA4 614 DDX5 "Probable ATP-dependent R 0.509 0.136 0.583 3.9e-42
UNIPROTKB|P17844 614 DDX5 "Probable ATP-dependent R 0.509 0.136 0.583 3.9e-42
UNIPROTKB|A5A6J2 614 DDX5 "Probable ATP-dependent R 0.509 0.136 0.583 3.9e-42
UNIPROTKB|Q4R6M5 614 DDX5 "Probable ATP-dependent R 0.509 0.136 0.583 3.9e-42
UNIPROTKB|Q5R4I9 614 DDX5 "Probable ATP-dependent R 0.509 0.136 0.583 3.9e-42
UNIPROTKB|F1PEA6 671 DDX5 "Uncharacterized protein" 0.509 0.125 0.583 5.7e-42
MGI|MGI:105037 614 Ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.509 0.136 0.571 8.3e-42
FB|FBgn0029979 CG10777 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 1.5e-43, Sum P(2) = 1.5e-43
 Identities = 49/71 (69%), Positives = 56/71 (78%)

Query:    94 VINFDYPNSSEDYIHRIGRTGRCASSGTAYTFFTPNNGKQAKELIAVLTEASQPIPPQLQ 153
             VIN+DYPNSSE+Y+HRIGRTGRC   GTAYTFFTP+N KQA+ELI+VL EA Q     L 
Sbjct:   563 VINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFTPDNAKQARELISVLEEAGQTPSQALL 622

Query:   154 DLANSNPNSKG 164
             DLA S P+S G
Sbjct:   623 DLARSMPSSGG 633


GO:0003724 "RNA helicase activity" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
ASPGD|ASPL0000006660 AN5931 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F1MBQ8 DDX5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KTA4 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P17844 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5A6J2 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R6M5 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R4I9 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1PEA6 DDX5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:105037 Ddx5 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q61656DDX5_MOUSE3, ., 6, ., 4, ., 1, 30.57140.50900.1368yesN/A
A2QC74DBP2_ASPNC3, ., 6, ., 4, ., 1, 30.56170.51510.1504yesN/A
Q8SRB2DBP2_ENCCU3, ., 6, ., 4, ., 1, 30.55910.52120.1737yesN/A
Q5B0J9DBP2_EMENI3, ., 6, ., 4, ., 1, 30.60750.47870.1403yesN/A
Q6BY27DBP2_DEBHA3, ., 6, ., 4, ., 1, 30.55690.43030.1324yesN/A
A5A6J2DDX5_PANTR3, ., 6, ., 4, ., 1, 30.58330.50900.1368yesN/A
Q5QMN3RH20_ORYSJ3, ., 6, ., 4, ., 1, 30.55290.51510.1720yesN/A
A3LQW7DBP2_PICST3, ., 6, ., 4, ., 1, 30.56620.49690.1547yesN/A
P17844DDX5_HUMAN3, ., 6, ., 4, ., 1, 30.58330.50900.1368yesN/A
Q6FLF3DBP2_CANGA3, ., 6, ., 4, ., 1, 30.56960.47870.1452yesN/A
Q5R4I9DDX5_PONAB3, ., 6, ., 4, ., 1, 30.58330.50900.1368yesN/A
Q4X195DBP2_ASPFU3, ., 6, ., 4, ., 1, 30.65850.49090.1480yesN/A
Q755N4DBP2_ASHGO3, ., 6, ., 4, ., 1, 30.50540.53330.1579yesN/A
Q9C718RH20_ARATH3, ., 6, ., 4, ., 1, 30.51190.49090.1616yesN/A
Q2U070DBP2_ASPOR3, ., 6, ., 4, ., 1, 30.59030.50300.1498yesN/A
P24783DBP2_YEAST3, ., 6, ., 4, ., 1, 30.52220.52120.1575yesN/A
P24782DBP2_SCHPO3, ., 6, ., 4, ., 1, 30.51640.50300.1509yesN/A
Q6C4D4DBP2_YARLI3, ., 6, ., 4, ., 1, 30.50540.55150.1648yesN/A
Q4IF76DBP2_GIBZE3, ., 6, ., 4, ., 1, 30.58970.47270.1405yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 9e-30
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 4e-27
cd00268203 cd00268, DEADc, DEAD-box helicases 4e-19
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 6e-17
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-16
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 9e-12
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-11
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-11
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 3e-11
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-10
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 7e-10
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 8e-10
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-09
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-09
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 4e-09
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-08
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-08
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-08
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-08
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 3e-08
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 3e-08
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 5e-08
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 8e-08
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-07
PTZ00424 401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-06
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-06
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-06
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-05
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 5e-04
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
 Score =  112 bits (283), Expect = 9e-30
 Identities = 50/94 (53%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 3   NHAKTQERAARLSESEVEAFRQKKEIT-VKGNNIPCPTQELTEGCFPNAVLQHLKGQGFE 61
           N  K     + LS  EV+  R++KEIT + G N+P P        FP+ +L+ LK  GF 
Sbjct: 92  NFYKEHPEVSALSSKEVDEIRKEKEITIIAGENVPKPVVSFEYTSFPDYILKSLKNAGFT 151

Query: 62  EPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVI 95
           EPT IQ QGWPIALSGRDM+GIA+TGSGKTLA +
Sbjct: 152 EPTPIQVQGWPIALSGRDMIGIAETGSGKTLAFL 185


Length = 545

>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 165
KOG0336|consensus 629 99.93
PTZ00110 545 helicase; Provisional 99.93
KOG0341|consensus 610 99.93
KOG0333|consensus 673 99.88
KOG0339|consensus 731 99.87
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.87
KOG0328|consensus 400 99.84
KOG0334|consensus 997 99.83
KOG0330|consensus 476 99.82
KOG0335|consensus 482 99.82
KOG0331|consensus 519 99.79
KOG0326|consensus459 99.71
KOG0340|consensus 442 99.68
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.67
KOG0343|consensus 758 99.66
KOG0346|consensus 569 99.64
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.64
KOG0344|consensus 593 99.64
KOG0332|consensus 477 99.62
KOG0338|consensus 691 99.6
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.59
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.59
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.58
KOG0331|consensus519 99.58
KOG0327|consensus397 99.57
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.56
KOG0348|consensus 708 99.56
KOG0345|consensus 567 99.56
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.53
KOG0342|consensus 543 99.52
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.5
KOG0347|consensus 731 99.5
PTZ00424 401 helicase 45; Provisional 99.46
KOG4284|consensus 980 99.44
KOG0337|consensus 529 99.39
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.39
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.32
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.32
KOG0340|consensus442 99.3
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.29
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.27
KOG0344|consensus593 99.26
KOG0342|consensus543 99.24
PRK02362 737 ski2-like helicase; Provisional 99.19
PRK13767 876 ATP-dependent helicase; Provisional 99.18
PRK00254 720 ski2-like helicase; Provisional 99.12
KOG0334|consensus 997 99.09
KOG0338|consensus 691 99.08
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.06
KOG0350|consensus620 99.04
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.99
KOG0329|consensus 387 98.99
KOG0348|consensus 708 98.99
KOG0347|consensus 731 98.98
KOG0346|consensus 569 98.97
PRK01172 674 ski2-like helicase; Provisional 98.96
KOG0350|consensus 620 98.94
KOG0345|consensus 567 98.92
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 98.91
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 98.88
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 98.87
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 98.86
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.86
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.84
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.78
KOG0343|consensus 758 98.77
COG1205 851 Distinct helicase family with a unique C-terminal 98.76
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.73
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 98.73
PTZ00424401 helicase 45; Provisional 98.68
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.68
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.67
KOG0329|consensus387 98.66
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.66
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.65
PRK14701 1638 reverse gyrase; Provisional 98.64
PRK09401 1176 reverse gyrase; Reviewed 98.64
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.63
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.63
KOG0349|consensus 725 98.56
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.52
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.5
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 98.49
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 98.47
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.47
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 98.43
PRK10689 1147 transcription-repair coupling factor; Provisional 98.37
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.3
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 98.25
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 98.24
PRK09200 790 preprotein translocase subunit SecA; Reviewed 98.16
PHA02558 501 uvsW UvsW helicase; Provisional 98.01
PRK04914 956 ATP-dependent helicase HepA; Validated 97.96
KOG0337|consensus 529 97.9
smart00487 201 DEXDc DEAD-like helicases superfamily. 97.85
COG1202 830 Superfamily II helicase, archaea-specific [General 97.85
PHA02653 675 RNA helicase NPH-II; Provisional 97.8
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 97.76
PRK05298652 excinuclease ABC subunit B; Provisional 97.75
PRK09200 790 preprotein translocase subunit SecA; Reviewed 97.71
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 97.7
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 97.69
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 97.69
PRK05580 679 primosome assembly protein PriA; Validated 97.66
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 97.62
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 97.62
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 97.53
COG1204 766 Superfamily II helicase [General function predicti 97.53
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.46
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 97.35
KOG0349|consensus725 97.35
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.34
KOG0351|consensus 941 97.32
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 97.28
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 97.28
PRK13767 876 ATP-dependent helicase; Provisional 97.27
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 97.26
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 97.18
PRK13766 773 Hef nuclease; Provisional 97.16
TIGR00643630 recG ATP-dependent DNA helicase RecG. 97.15
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 97.13
KOG0952|consensus 1230 97.13
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 97.1
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 97.1
PHA02653 675 RNA helicase NPH-II; Provisional 97.09
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.07
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.02
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 97.02
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 96.99
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 96.92
PRK02362 737 ski2-like helicase; Provisional 96.91
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 96.77
PRK10689 1147 transcription-repair coupling factor; Provisional 96.64
PRK13766 773 Hef nuclease; Provisional 96.64
KOG0351|consensus 941 96.6
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 96.49
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 96.49
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 96.41
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 96.35
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.32
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 96.32
PF1324576 AAA_19: Part of AAA domain 96.18
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 96.13
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 96.04
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 96.03
KOG0352|consensus 641 95.86
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 95.85
PRK12904 830 preprotein translocase subunit SecA; Reviewed 95.74
KOG0354|consensus 746 95.72
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.59
KOG0353|consensus 695 95.52
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 95.51
PRK09694 878 helicase Cas3; Provisional 95.42
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 95.41
smart0049082 HELICc helicase superfamily c-terminal domain. 95.37
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 95.32
KOG0352|consensus 641 95.27
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 95.24
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 95.23
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 95.16
PRK01172 674 ski2-like helicase; Provisional 95.15
PRK00254 720 ski2-like helicase; Provisional 95.14
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 94.9
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 94.81
PHA02558501 uvsW UvsW helicase; Provisional 94.81
KOG0354|consensus 746 94.8
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 94.58
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 93.82
PRK13107 908 preprotein translocase subunit SecA; Reviewed 93.7
PRK05580679 primosome assembly protein PriA; Validated 93.68
KOG0951|consensus 1674 93.5
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 93.46
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 93.32
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 92.94
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 92.47
TIGR00595 505 priA primosomal protein N'. All proteins in this f 91.98
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 91.96
COG5008 375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 91.33
COG1198 730 PriA Primosomal protein N' (replication factor Y) 91.32
TIGR00376 637 DNA helicase, putative. The gene product may repre 91.02
TIGR00595505 priA primosomal protein N'. All proteins in this f 90.83
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 90.74
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 90.46
PRK13897 606 type IV secretion system component VirD4; Provisio 90.39
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 90.36
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 88.65
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 88.62
KOG0353|consensus 695 88.55
PRK09694 878 helicase Cas3; Provisional 87.97
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 87.5
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 87.29
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 87.27
PRK10875 615 recD exonuclease V subunit alpha; Provisional 86.99
PRK11054 684 helD DNA helicase IV; Provisional 86.94
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 86.73
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 86.38
PRK13850 670 type IV secretion system protein VirD4; Provisiona 86.38
PRK13822 641 conjugal transfer coupling protein TraG; Provision 86.16
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 85.72
PRK13889 988 conjugal transfer relaxase TraA; Provisional 85.27
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 85.2
KOG1802|consensus 935 85.03
KOG0947|consensus 1248 84.91
PRK13880 636 conjugal transfer coupling protein TraG; Provision 84.87
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 84.8
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 84.34
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 84.26
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 84.25
PRK13833323 conjugal transfer protein TrbB; Provisional 83.93
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 83.71
PRK13894319 conjugal transfer ATPase TrbB; Provisional 83.69
PRK10536262 hypothetical protein; Provisional 83.64
PF13871 278 Helicase_C_4: Helicase_C-like 83.58
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 83.25
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 83.01
KOG1803|consensus 649 82.91
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 82.78
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 82.59
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 82.56
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 81.65
TIGR02767 623 TraG-Ti Ti-type conjugative transfer system protie 81.31
COG1201 814 Lhr Lhr-like helicases [General function predictio 81.17
PRK13764 602 ATPase; Provisional 80.68
CHL00122 870 secA preprotein translocase subunit SecA; Validate 80.23
>KOG0336|consensus Back     alignment and domain information
Probab=99.93  E-value=2.9e-26  Score=191.01  Aligned_cols=92  Identities=36%  Similarity=0.615  Sum_probs=83.8

Q ss_pred             CCCccCChHhhcCCHHHHHHHHhhcCcEEec-------CCCCCCcccccc-CCCcHHHHHHHHhCCCCCCchHHHHHHHH
Q psy7691           2 HNHAKTQERAARLSESEVEAFRQKKEITVKG-------NNIPCPTQELTE-GCFPNAVLQHLKGQGFEEPTAIQAQGWPI   73 (165)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~-------~~~p~~i~~f~~-l~l~~~l~~~l~~~g~~~~t~~Q~~a~~~   73 (165)
                      ++||++....+++|+++++.+|+++......       ..+|.|.-+|++ ...++++.+++++.||.+|||||.+|||.
T Consensus       174 knfYke~~e~s~ls~~q~~~~r~en~~it~dd~K~gekrpIPnP~ctFddAFq~~pevmenIkK~GFqKPtPIqSQaWPI  253 (629)
T KOG0336|consen  174 KNFYKESNETSNLSKEQLQEWRKENFNITCDDLKEGEKRPIPNPVCTFDDAFQCYPEVMENIKKTGFQKPTPIQSQAWPI  253 (629)
T ss_pred             hhhhhcCchhccCCHHHHHHHHHcCCcEEecccccCCcccCCCCcCcHHHHHhhhHHHHHHHHhccCCCCCcchhcccce
Confidence            7899999999999999999999776544332       458999999987 59999999999999999999999999999


Q ss_pred             HHcCCCeeeecccCCcccce
Q psy7691          74 ALSGRDMVGIAQTGSGKTLA   93 (165)
Q Consensus        74 ~l~G~di~~~a~tgsGKt~~   93 (165)
                      ++.|.|++++|+||+|||++
T Consensus       254 ~LQG~DliGVAQTgtgKtL~  273 (629)
T KOG0336|consen  254 LLQGIDLIGVAQTGTGKTLA  273 (629)
T ss_pred             eecCcceEEEEecCCCcCHH
Confidence            99999999999999999996



>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 1e-22
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 7e-22
2jgn_A185 Ddx3 Helicase Domain Length = 185 5e-13
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 1e-12
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 1e-09
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 3e-09
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 4e-09
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 1e-07
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 1e-07
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-07
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-06
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-06
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 2e-06
2hyi_C413 Structure Of The Human Exon Junction Complex With A 2e-06
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 2e-06
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-06
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 2e-06
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 4e-06
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 7e-06
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 1e-05
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 2e-05
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 5e-05
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 6e-05
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 2e-04
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-04
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 2e-04
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 3e-04
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure

Iteration: 1

Score = 102 bits (254), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 49/84 (58%), Positives = 60/84 (71%) Query: 12 ARLSESEVEAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGW 71 AR + EVE +R+ KEITV+G+N P P E FP V+ + Q F EPTAIQAQGW Sbjct: 15 ARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGW 74 Query: 72 PIALSGRDMVGIAQTGSGKTLAVI 95 P+ALSG DMVG+AQTGSGKTL+ + Sbjct: 75 PVALSGLDMVGVAQTGSGKTLSYL 98
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-42
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 2e-36
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 3e-34
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 7e-32
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-32
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-31
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 2e-31
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 4e-30
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 9e-29
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 3e-27
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 1e-16
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 2e-16
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 7e-16
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 9e-16
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 2e-15
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 2e-15
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 3e-15
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 5e-15
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 9e-14
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 7e-15
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-14
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 3e-13
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 3e-14
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 3e-14
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 3e-13
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-14
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 6e-14
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 4e-14
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 6e-14
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 2e-13
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 6e-14
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-13
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 7e-14
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 2e-13
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 8e-14
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 8e-14
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 8e-14
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 6e-13
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 9e-14
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 9e-07
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-13
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 2e-13
3bor_A237 Human initiation factor 4A-II; translation initiat 2e-13
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-12
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 3e-07
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-12
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-11
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 3e-12
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 5e-11
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 3e-12
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 7e-12
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 3e-10
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 9e-12
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-11
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 7e-10
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 9e-11
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 6e-08
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 5e-05
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
 Score =  140 bits (355), Expect = 2e-42
 Identities = 47/82 (57%), Positives = 58/82 (70%)

Query: 12 ARLSESEVEAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGW 71
          +  +  EVE +R+ KEITV+G+N P P     E  FP  V+  +  Q F EPTAIQAQGW
Sbjct: 1  SMRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGW 60

Query: 72 PIALSGRDMVGIAQTGSGKTLA 93
          P+ALSG DMVG+AQTGSGKTL+
Sbjct: 61 PVALSGLDMVGVAQTGSGKTLS 82


>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.82
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.78
3dkp_A 245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.77
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.7
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.66
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.64
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.63
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.62
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.62
3bor_A237 Human initiation factor 4A-II; translation initiat 99.62
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.6
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.59
1q0u_A 219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.57
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.55
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.55
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.55
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.54
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.51
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.49
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.47
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.44
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.44
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.44
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.42
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.42
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.41
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.41
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.32
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.28
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.23
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.21
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.21
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.13
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.13
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.08
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.05
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.04
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 98.98
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.98
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 98.97
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.95
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.95
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.94
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 98.91
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 98.91
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 98.87
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 98.8
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.76
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.75
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.75
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.74
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 98.16
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.69
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 98.65
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 98.65
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.64
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 98.63
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.62
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.6
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.6
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 98.58
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 98.56
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.56
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.53
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.53
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.51
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.51
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.5
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.47
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 98.47
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.46
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.45
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 98.45
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.43
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.42
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.41
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.38
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 98.37
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.36
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.32
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.28
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.27
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.26
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.23
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.22
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.22
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.21
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.18
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 98.18
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.15
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.13
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 98.11
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.08
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.05
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 98.04
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.03
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.02
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.0
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.0
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 97.98
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.98
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 97.94
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.89
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 97.87
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 97.87
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 97.85
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 97.83
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.82
1yks_A 440 Genome polyprotein [contains: flavivirin protease 97.79
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.78
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 97.75
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 97.74
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 97.64
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 97.62
4gl2_A 699 Interferon-induced helicase C domain-containing P; 97.56
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 97.54
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 97.53
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.41
3h1t_A 590 Type I site-specific restriction-modification syst 97.37
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 97.36
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 97.36
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 97.28
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 97.27
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 97.21
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 97.11
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 97.1
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 97.05
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 97.02
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.93
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 96.82
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 96.78
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.65
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 96.64
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 96.56
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 96.56
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 96.52
3h1t_A590 Type I site-specific restriction-modification syst 96.13
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 95.92
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 95.71
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 95.62
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 95.52
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 95.37
3jux_A 822 Protein translocase subunit SECA; protein transloc 95.03
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 94.6
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 94.04
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 93.65
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 93.39
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 93.3
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 93.11
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 92.73
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 92.7
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 92.56
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 92.56
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 91.78
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 91.74
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 91.37
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 90.76
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 89.72
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 89.31
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 87.97
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 80.82
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
Probab=99.82  E-value=6.2e-20  Score=143.44  Aligned_cols=123  Identities=45%  Similarity=0.687  Sum_probs=105.0

Q ss_pred             cCCHHHHHHHHhhcCcEEecCCCCCCccccccCCCcHHHHHHHHhCCCCCCchHHHHHHHHHHcCCCeeeecccCCcccc
Q psy7691          13 RLSESEVEAFRQKKEITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTL   92 (165)
Q Consensus        13 ~~~~~~~~~~~~~~~i~~~~~~~p~~i~~f~~l~l~~~l~~~l~~~g~~~~t~~Q~~a~~~~l~G~di~~~a~tgsGKt~   92 (165)
                      .+++++++.+++.+.+.+.|.+.|.|+..|+++++++.+.++|.+.||..|+++|.++++.++.|.|++++++||+|||+
T Consensus         2 ~~~~~~~~~~~~~~~i~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~~~~~Q~~~i~~~~~g~~~l~~apTGsGKT~   81 (242)
T 3fe2_A            2 MRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTL   81 (242)
T ss_dssp             ----CHHHHHHHHHTEEEESSCCCCCCSSTTTTTCCHHHHHHHHTTTCCSCCHHHHHHHHHHHHTCCEEEEECTTSCHHH
T ss_pred             CCCHHHHHHHHhcCceEEeCCCCCCccCCHhhcCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCCEEEECCCcCHHHH
Confidence            45778999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeecCCCCChhHHHHhhccCCC-CCCCCceEEEECCCcHHHHHHHHHHHHhc
Q psy7691          93 AVINFDYPNSSEDYIHRIGRTGR-CASSGTAYTFFTPNNGKQAKELIAVLTEA  144 (165)
Q Consensus        93 ~~~~~~lP~~~~~~i~r~gr~~r-~~~~g~~~~~~~p~~~~~~~~i~~~l~~~  144 (165)
                      +|+   +|     .++++.+... ....+..+++++|+ ++++.|+.+.+...
T Consensus        82 ~~~---l~-----~l~~l~~~~~~~~~~~~~~lil~Pt-~~L~~Q~~~~~~~~  125 (242)
T 3fe2_A           82 SYL---LP-----AIVHINHQPFLERGDGPICLVLAPT-RELAQQVQQVAAEY  125 (242)
T ss_dssp             HHH---HH-----HHHHHHTSCCCCTTCCCSEEEECSS-HHHHHHHHHHHHHH
T ss_pred             HHH---HH-----HHHHHHhccccccCCCCEEEEEeCc-HHHHHHHHHHHHHH
Confidence            998   88     6776644322 12346678899999 88888887777653



>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 165
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 1e-13
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 5e-13
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-12
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 3e-11
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 6e-11
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 6e-11
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 8e-11
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-10
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-10
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 5e-10
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 5e-10
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 7e-10
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 1e-09
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 2e-09
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 4e-09
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 4e-09
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 4e-09
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 1e-08
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 3e-08
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 7e-08
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 3e-07
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 8e-07
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-06
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-05
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 6e-05
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 0.002
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase VlgB
species: Flatworm (Dugesia japonica) [TaxId: 6161]
 Score = 64.2 bits (155), Expect = 1e-13
 Identities = 19/71 (26%), Positives = 30/71 (42%)

Query: 27 EITVKGNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQT 86
           +T    +     +   E      +  ++    ++ PT IQ    P  L  RD++  AQT
Sbjct: 8  SVTGPDYSATNVIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQT 67

Query: 87 GSGKTLAVINF 97
          GSGKT A +  
Sbjct: 68 GSGKTAAFLIP 78


>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.82
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.81
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.8
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.8
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.79
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.78
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.68
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.68
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.67
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.45
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.43
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.31
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.28
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.26
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 99.24
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.23
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.15
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.14
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.0
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 98.54
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 98.42
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 98.29
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.12
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.1
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.82
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 97.67
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 97.52
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 97.51
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.35
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.21
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.06
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.86
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.85
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 96.59
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.34
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.18
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 95.17
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.07
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.15
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.2
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 92.78
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 87.05
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 84.13
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 83.62
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 82.97
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 82.33
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 80.86
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.82  E-value=1e-20  Score=144.79  Aligned_cols=102  Identities=24%  Similarity=0.330  Sum_probs=92.7

Q ss_pred             cCCCCCCccccccCCCcHHHHHHHHhCCCCCCchHHHHHHHHHHcCCCeeeecccCCcccceeeecCCCCChhHHHHhhc
Q psy7691          32 GNNIPCPTQELTEGCFPNAVLQHLKGQGFEEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAVINFDYPNSSEDYIHRIG  111 (165)
Q Consensus        32 ~~~~p~~i~~f~~l~l~~~l~~~l~~~g~~~~t~~Q~~a~~~~l~G~di~~~a~tgsGKt~~~~~~~lP~~~~~~i~r~g  111 (165)
                      +.+.|+++.+|+++++++.++++|+++||..||++|.+|||.++.|+|++++|+||||||++|+   +|     .++++.
T Consensus         2 ~~~~~~~~~sF~~l~l~~~l~~~L~~~g~~~pt~iQ~~aip~il~g~dvl~~a~TGsGKT~a~~---lp-----~i~~l~   73 (212)
T d1qdea_           2 QTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFS---IA-----ALQRID   73 (212)
T ss_dssp             CBSCCCCCCCGGGGTCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHH---HH-----HHHHCC
T ss_pred             CCCCcccccChhhCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHcCCCEEeecccccchhhhhH---hh-----hHhhhh
Confidence            5788999999999999999999999999999999999999999999999999999999999999   99     899986


Q ss_pred             cCCCCCCCCceEEEECCCcHHHHHHHHHHHHhcCC
Q psy7691         112 RTGRCASSGTAYTFFTPNNGKQAKELIAVLTEASQ  146 (165)
Q Consensus       112 r~~r~~~~g~~~~~~~p~~~~~~~~i~~~l~~~~~  146 (165)
                      +.    ..++.+++++|+ ++++.|+...+.....
T Consensus        74 ~~----~~~~~~lil~pt-~el~~q~~~~~~~~~~  103 (212)
T d1qdea_          74 TS----VKAPQALMLAPT-RELALQIQKVVMALAF  103 (212)
T ss_dssp             TT----CCSCCEEEECSS-HHHHHHHHHHHHHHTT
T ss_pred             cc----CCCcceEEEccc-HHHhhhhhhhhccccc
Confidence            53    456788899999 8999999888876543



>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure