Psyllid ID: psy7836


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MQAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVAGDTIYNMIKLDEIMVDHVSTYLEYRKRINYEGAGKVEWGERAANIGVTLYNTNTILSEIECLDFIF
ccEEEEEcccEEEEEEEcccccHHHHHHHHHHHHccccccccEEEcccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHHccccccccccccccEEEEEEEcccccccHHHHccccccccccccccccccccccc
ccEEEEEEccEEEEEEEcccccHHHHHHHHHHHHccccccEEccEEEcccEEEEcccccccccccccccccEcccccHccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEcccHHHHHHHHHcccccccccccccEEEEEEEEccccccccccccccHHccccccHccHHHHHHHcc
MQAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFiaqggdptgtgtggesiygkpfkdeiHSRLRFVRRGLVAMAnagkddngsqFFFTLaatpelnskhtifgkVAGDTIYNMIKLDEIMVDHVSTYLEYRKRInyegagkvewgeRAANIGVTLYNTNTILSEIECLDFIF
mqavllktsvgdidielwsrEAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVAGDTIYNMIKLDEIMVDHVSTYLEYRKRINYegagkvewgerAANIGVTLyntntilseiecldfif
MQAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQggdptgtgtggESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVAGDTIYNMIKLDEIMVDHVSTYLEYRKRINYEGAGKVEWGERAANIGVTLYNTNTILSEIECLDFIF
***VLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVAGDTIYNMIKLDEIMVDHVSTYLEYRKRINYEGAGKVEWGERAANIGVTLYNTNTILSEIECLDFI*
*QAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVAGDTIYNMIKLDEIMVDHVSTYLEYRKRINYEGAGKVEWG*******************IECLDFIF
MQAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVAGDTIYNMIKLDEIMVDHVSTYLEYRKRINYEGAGKVEWGERAANIGVTLYNTNTILSEIECLDFIF
*QAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVAGDTIYNMIKLDEIMVDHVSTYLEYRKRINYEGAGKVEWGERAANIGVTLYNTNTILSEIECLDFIF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVAGDTIYNMIKLDEIMVDHVSTYLEYRKRINYEGAGKVEWGERAANIGVTLYNTNTILSEIECLDFIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q4R713 473 Peptidyl-prolyl cis-trans N/A N/A 0.719 0.287 0.786 1e-63
Q6UX04 472 Peptidyl-prolyl cis-trans yes N/A 0.719 0.288 0.786 2e-63
Q5R7W3 473 Peptidyl-prolyl cis-trans yes N/A 0.719 0.287 0.786 2e-63
Q3TKY6 469 Peptidyl-prolyl cis-trans yes N/A 0.719 0.289 0.794 3e-55
Q5XIB2 468 Peptidyl-prolyl cis-trans yes N/A 0.719 0.290 0.786 8e-55
Q17QX9 473 Peptidyl-prolyl cis-trans yes N/A 0.719 0.287 0.794 8e-55
Q7ZW86 470 Peptidyl-prolyl cis-trans yes N/A 0.719 0.289 0.786 7e-54
Q6GLX7 477 Peptidyl-prolyl cis-trans N/A N/A 0.714 0.283 0.777 5e-53
P0C1J2 524 Peptidyl-prolyl isomerase N/A N/A 0.777 0.280 0.614 6e-52
O42941 463 Peptidylprolyl isomerase yes N/A 0.724 0.295 0.642 2e-51
>sp|Q4R713|CWC27_MACFA Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Macaca fascicularis GN=CWC27 PE=2 SV=1 Back     alignment and function desciption
 Score =  242 bits (618), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 107/136 (78%), Positives = 119/136 (87%)

Query: 4   VLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTG 63
           VLLKT+ GDIDIELWS+EAPKACRNF+QLC+E YY+NTI HRVV GFI QGGDPTGTG+G
Sbjct: 15  VLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGSG 74

Query: 64  GESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVA 123
           GESIYG PFKDE HSRLRF RRGLVAMANAG  DNGSQFFFTL    ELN+KHTIFGKV 
Sbjct: 75  GESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVT 134

Query: 124 GDTIYNMIKLDEIMVD 139
           GDT+YNM++L E+ +D
Sbjct: 135 GDTVYNMLRLSEVDID 150




PPIases accelerate the folding of proteins.
Macaca fascicularis (taxid: 9541)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q6UX04|CWC27_HUMAN Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Homo sapiens GN=CWC27 PE=1 SV=1 Back     alignment and function description
>sp|Q5R7W3|CWC27_PONAB Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Pongo abelii GN=CWC27 PE=2 SV=1 Back     alignment and function description
>sp|Q3TKY6|CWC27_MOUSE Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Mus musculus GN=Cwc27 PE=1 SV=1 Back     alignment and function description
>sp|Q5XIB2|CWC27_RAT Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Rattus norvegicus GN=Cwc27 PE=2 SV=1 Back     alignment and function description
>sp|Q17QX9|CWC27_BOVIN Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Bos taurus GN=CWC27 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZW86|CWC27_DANRE Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Danio rerio GN=cwc27 PE=2 SV=1 Back     alignment and function description
>sp|Q6GLX7|CWC27_XENLA Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Xenopus laevis GN=cwc27 PE=2 SV=1 Back     alignment and function description
>sp|P0C1J2|CWC27_RHIO9 Peptidyl-prolyl isomerase cwc27 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cwc27 PE=3 SV=1 Back     alignment and function description
>sp|O42941|CYP7_SCHPO Peptidylprolyl isomerase cyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
345492954 1051 PREDICTED: hypothetical protein LOC10011 0.719 0.129 0.816 1e-65
328780427 1125 PREDICTED: hypothetical protein LOC72521 0.719 0.120 0.801 1e-65
307189916 1138 Peptidyl-prolyl cis-trans isomerase SDCC 0.719 0.119 0.794 4e-65
332028661 422 Peptidyl-prolyl cis-trans isomerase SDCC 0.724 0.324 0.795 5e-65
350400564 1133 PREDICTED: hypothetical protein LOC10074 0.719 0.120 0.786 8e-65
350400566 1130 PREDICTED: hypothetical protein LOC10074 0.719 0.120 0.786 9e-65
322783215 1502 hypothetical protein SINV_05567 [Solenop 0.724 0.091 0.795 1e-64
307203595 511 Peptidyl-prolyl cis-trans isomerase SDCC 0.724 0.268 0.781 2e-64
195493589 502 GE21848 [Drosophila yakuba] gi|194180583 0.798 0.300 0.741 3e-64
193713663 472 PREDICTED: peptidyl-prolyl cis-trans iso 0.719 0.288 0.816 7e-64
>gi|345492954|ref|XP_001601140.2| PREDICTED: hypothetical protein LOC100116714 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 111/136 (81%), Positives = 127/136 (93%)

Query: 4   VLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTG 63
           V++KTS+GDID+ELW++EAPKACRNF+QLCMEGYY+NTI HRV+KGFI QGGDPTGTG G
Sbjct: 15  VVMKTSIGDIDLELWTKEAPKACRNFIQLCMEGYYDNTIFHRVIKGFIVQGGDPTGTGEG 74

Query: 64  GESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVA 123
           GESIYG PFKDE H+RLRF RRGL+AMANAGKDDNGSQFFFTLAATPEL +KHTIFGKV 
Sbjct: 75  GESIYGAPFKDEFHTRLRFCRRGLLAMANAGKDDNGSQFFFTLAATPELQNKHTIFGKVG 134

Query: 124 GDTIYNMIKLDEIMVD 139
           G+TIYNMIKL++ +VD
Sbjct: 135 GETIYNMIKLEDALVD 150




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328780427|ref|XP_001121087.2| PREDICTED: hypothetical protein LOC725211 [Apis mellifera] Back     alignment and taxonomy information
>gi|307189916|gb|EFN74152.1| Peptidyl-prolyl cis-trans isomerase SDCCAG10 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332028661|gb|EGI68695.1| Peptidyl-prolyl cis-trans isomerase SDCCAG10 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350400564|ref|XP_003485881.1| PREDICTED: hypothetical protein LOC100749467 isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350400566|ref|XP_003485882.1| PREDICTED: hypothetical protein LOC100749467 isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|322783215|gb|EFZ10801.1| hypothetical protein SINV_05567 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307203595|gb|EFN82624.1| Peptidyl-prolyl cis-trans isomerase SDCCAG10 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195493589|ref|XP_002094482.1| GE21848 [Drosophila yakuba] gi|194180583|gb|EDW94194.1| GE21848 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|193713663|ref|XP_001950714.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CWC27 homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
FB|FBgn0036207 502 CG10907 [Drosophila melanogast 0.724 0.272 0.715 1.5e-51
UNIPROTKB|E1BZD0 332 CWC27 "Uncharacterized protein 0.719 0.409 0.727 3.6e-50
UNIPROTKB|E1C0I5 473 CWC27 "Uncharacterized protein 0.719 0.287 0.727 3.6e-50
UNIPROTKB|D6REK3 381 CWC27 "Peptidyl-prolyl cis-tra 0.719 0.356 0.713 3.6e-50
UNIPROTKB|Q6UX04 472 CWC27 "Peptidyl-prolyl cis-tra 0.719 0.288 0.713 3.6e-50
UNIPROTKB|F1SKU1 313 CWC27 "Uncharacterized protein 0.719 0.434 0.713 5.8e-50
MGI|MGI:1914535 469 Cwc27 "CWC27 spliceosome-assoc 0.719 0.289 0.713 5.8e-50
UNIPROTKB|F1MBE0 473 CWC27 "Peptidyl-prolyl cis-tra 0.719 0.287 0.713 7.4e-50
UNIPROTKB|Q17QX9 473 CWC27 "Peptidyl-prolyl cis-tra 0.719 0.287 0.713 7.4e-50
RGD|1310697 468 Cwc27 "CWC27 spliceosome-assoc 0.719 0.290 0.705 7.4e-50
FB|FBgn0036207 CG10907 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 535 (193.4 bits), Expect = 1.5e-51, P = 1.5e-51
 Identities = 98/137 (71%), Positives = 113/137 (82%)

Query:     4 VLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQXXXXXXXXXX 63
             VLLKT+VGDIDIELW+RE PKACRNFVQLC+EGYY NT  HR+VKGFI Q          
Sbjct:    15 VLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTG 74

Query:    64 XESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVA 123
              ESIYG+PFKDE HSRLR+ RRGLV MAN+GKDDNGSQFFFT A TPEL +K+T+FGK+ 
Sbjct:    75 GESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKIT 134

Query:   124 GDTIYNMIKLDEIMVDH 140
             GDTIYNM+KL++ +VDH
Sbjct:   135 GDTIYNMLKLEDGIVDH 151




GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS
GO:0006457 "protein folding" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
UNIPROTKB|E1BZD0 CWC27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0I5 CWC27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D6REK3 CWC27 "Peptidyl-prolyl cis-trans isomerase CWC27 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6UX04 CWC27 "Peptidyl-prolyl cis-trans isomerase CWC27 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKU1 CWC27 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1914535 Cwc27 "CWC27 spliceosome-associated protein homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MBE0 CWC27 "Peptidyl-prolyl cis-trans isomerase CWC27 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QX9 CWC27 "Peptidyl-prolyl cis-trans isomerase CWC27 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1310697 Cwc27 "CWC27 spliceosome-associated protein homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3TKY6CWC27_MOUSE5, ., 2, ., 1, ., 80.79410.71950.2899yesN/A
Q5XIB2CWC27_RAT5, ., 2, ., 1, ., 80.78670.71950.2905yesN/A
P0CP92CWC27_CRYNJ5, ., 2, ., 1, ., 80.57340.75130.2892yesN/A
Q17QX9CWC27_BOVIN5, ., 2, ., 1, ., 80.79410.71950.2875yesN/A
Q8X191PPIL1_ASPNG5, ., 2, ., 1, ., 80.53780.62960.7345yesN/A
Q4WCR3PPIL1_ASPFU5, ., 2, ., 1, ., 80.56300.62960.7391yesN/A
Q5R7W3CWC27_PONAB5, ., 2, ., 1, ., 80.78670.71950.2875yesN/A
Q6UX04CWC27_HUMAN5, ., 2, ., 1, ., 80.78670.71950.2881yesN/A
Q7ZW86CWC27_DANRE5, ., 2, ., 1, ., 80.78670.71950.2893yesN/A
O42941CYP7_SCHPO5, ., 2, ., 1, ., 80.64230.72480.2958yesN/A
Q5AUG9CWC27_EMENI5, ., 2, ., 1, ., 80.50660.70370.2383yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.921
4th Layer5.2.1.80.914

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 3e-97
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 1e-58
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 1e-58
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 1e-57
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 1e-57
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 2e-57
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 2e-53
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 1e-52
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 2e-43
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 1e-37
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 7e-33
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 2e-29
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 2e-23
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 2e-22
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 1e-13
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 2e-12
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 2e-07
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
 Score =  278 bits (713), Expect = 3e-97
 Identities = 107/137 (78%), Positives = 119/137 (86%)

Query: 4   VLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTG 63
           V+LKT+ GDIDIELWS+EAPKACRNF+QLC+EGYY+NTI HRVV GFI QGGDPTGTGTG
Sbjct: 8   VILKTTAGDIDIELWSKEAPKACRNFIQLCLEGYYDNTIFHRVVPGFIIQGGDPTGTGTG 67

Query: 64  GESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVA 123
           GESIYG+PFKDE HSRLRF RRGLV MANAG D NGSQFFFTL    ELN+KHT+FGKV 
Sbjct: 68  GESIYGEPFKDEFHSRLRFNRRGLVGMANAGDDSNGSQFFFTLDKADELNNKHTLFGKVT 127

Query: 124 GDTIYNMIKLDEIMVDH 140
           GDTIYN++KL E+  D 
Sbjct: 128 GDTIYNLLKLAEVETDK 144


C. elegans CeCYP-16, compared to the archetypal cyclophilin Human cyclophilin A has, a reduced peptidylprolyl cis- trans isomerase activity, is cyclosporin insensitive and shows an altered substrate preference favoring, hydrophobic, acidic or amide amino acids. Most members of this subfamily have a glutamate residue in the active site at the position equivalent to a tryptophan (W121 in Human cyclophilin A), which has been shown to be important for cyclophilin binding. Length = 171

>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
KOG0881|consensus164 100.0
KOG0546|consensus 372 100.0
KOG0880|consensus217 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
KOG0882|consensus558 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
KOG0883|consensus518 100.0
PTZ00221249 cyclophilin; Provisional 100.0
KOG0885|consensus 439 100.0
KOG0879|consensus177 100.0
KOG0884|consensus161 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PTZ00060183 cyclophilin; Provisional 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
KOG0111|consensus298 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0415|consensus 479 100.0
KOG0865|consensus167 99.97
KOG0882|consensus 558 97.88
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 96.7
PRK00969 508 hypothetical protein; Provisional 96.63
PRK00969 508 hypothetical protein; Provisional 95.56
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 95.29
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 94.93
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 82.36
>KOG0881|consensus Back     alignment and domain information
Probab=100.00  E-value=3.2e-51  Score=299.97  Aligned_cols=153  Identities=48%  Similarity=0.825  Sum_probs=148.2

Q ss_pred             CcEEEEEecceeEEEEEcCCCChHHHHHHHHHHhcCccCCceEEEeecCcEEecCCCCCCCCCCCcccCCCCCCcccCCc
Q psy7836           1 MQAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRL   80 (189)
Q Consensus         1 ~~~v~~~T~~G~i~ieL~~~~aP~t~~nF~~L~~~g~Y~g~~f~rv~~~~~iqgGd~~~~~~~~~~~~g~~~~~E~~~~l   80 (189)
                      +..|.++|++|.|.+|||-+.||+||+||.+|++.|||+|..|||++++|+||||||+++|.||.++||..|.||.++.|
T Consensus         9 ~~~V~LeTsmG~i~~ElY~kHaP~TC~NF~eLarrgYYn~v~FHRii~DFmiQGGDPTGTGRGGaSIYG~kF~DEi~~dL   88 (164)
T KOG0881|consen    9 PPNVTLETSMGKITLELYWKHAPRTCQNFAELARRGYYNGVIFHRIIKDFMIQGGDPTGTGRGGASIYGDKFEDEIHSDL   88 (164)
T ss_pred             CCeEEEeecccceehhhhhhcCcHHHHHHHHHHhcccccceeeeehhhhheeecCCCCCCCCCccccccchhhhhhhhhh
Confidence            34799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccceEEEEeccCCCCCCceEEEEcCCCCCCCCCCeEEEEEE-cCcchhhhhhhhcccCCCCCcccCeEEEEEee
Q psy7836          81 RFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVA-GDTIYNMIKLDEIMVDHVSTYLEYRKRINYEG  155 (189)
Q Consensus        81 ~~~~~G~vsm~~~~~~~~~sqFfI~l~~~~~ld~~~~vFG~V~-G~~v~~l~~i~~~~~~~~~~P~~~i~I~~~~~  155 (189)
                      +|..+|.|||||.+||+|||||||+|++.+||||+|++||||. ||++  +.++..+.+++.++|..+++|.+...
T Consensus        89 khTGAGILsMANaGPnTNgSQFFiTLAPt~~LDGKHTIFGRV~~Gm~v--ikr~G~v~Td~~DRPi~~~kIika~~  162 (164)
T KOG0881|consen   89 KHTGAGILSMANAGPNTNGSQFFITLAPTQWLDGKHTIFGRVCSGMEV--IKRMGMVETDNSDRPIDEVKIIKAYP  162 (164)
T ss_pred             cccchhhhhhhccCCCCCCceEEEEecCccccCCcceeehhhhhhHHH--HHhhcceecCCCCCCccceeeEeeec
Confidence            9999999999999999999999999999999999999999999 9988  99999999999999999999998543



>KOG0546|consensus Back     alignment and domain information
>KOG0880|consensus Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG0883|consensus Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>KOG0885|consensus Back     alignment and domain information
>KOG0879|consensus Back     alignment and domain information
>KOG0884|consensus Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0865|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 5e-55
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 6e-35
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 1e-30
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 1e-30
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 1e-30
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 2e-27
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 3e-27
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 3e-27
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 3e-26
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 4e-26
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 6e-26
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 2e-23
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 6e-19
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 6e-19
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 1e-18
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 2e-17
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 3e-17
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 3e-17
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 1e-16
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 2e-16
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 3e-16
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 4e-16
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 4e-16
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 4e-16
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 5e-16
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 5e-16
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 6e-16
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 2e-15
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 2e-15
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 2e-15
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 3e-15
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 4e-15
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 5e-15
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 6e-15
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 1e-14
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 1e-14
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 1e-14
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 2e-14
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 2e-14
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 2e-14
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 2e-14
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 2e-14
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 2e-14
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 2e-14
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 2e-14
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 2e-14
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 2e-14
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 2e-14
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 2e-14
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 3e-14
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 5e-14
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 8e-14
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 8e-14
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 8e-14
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 8e-14
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 8e-14
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 9e-14
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 1e-13
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 3e-13
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 3e-13
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 4e-13
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 4e-13
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 4e-13
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 5e-13
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 9e-13
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 1e-12
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 9e-12
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 9e-12
1dyw_A173 Biochemical And Structural Characterization Of A Di 2e-11
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 1e-10
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 1e-10
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 2e-10
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 9e-07
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 4e-06
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure

Iteration: 1

Score = 209 bits (533), Expect = 5e-55, Method: Compositional matrix adjust. Identities = 97/136 (71%), Positives = 108/136 (79%) Query: 4 VLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQXXXXXXXXXX 63 VLLKT+ GDIDIELWS+EAPKACRNF+QLC+E YY+NTI HRVV GFI Q Sbjct: 27 VLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGSG 86 Query: 64 XESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVA 123 ESIYG PFKDE HSRLRF RRGLVAMANAG DNGSQFFFTL ELN+KHTIFGKV Sbjct: 87 GESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVT 146 Query: 124 GDTIYNMIKLDEIMVD 139 GDT+YNM++L E+ +D Sbjct: 147 GDTVYNMLRLSEVDID 162
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2hq6_A185 Serologically defined colon cancer antigen 10; pro 3e-90
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 5e-85
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 8e-85
2b71_A196 Cyclophilin-like protein; structural genomics, str 3e-84
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 2e-83
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 2e-83
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 2e-83
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-82
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 2e-80
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 1e-79
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 4e-76
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 2e-60
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 1e-42
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 1e-42
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 1e-42
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 1e-41
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-41
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 1e-41
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 2e-41
1z81_A229 Cyclophilin; structural genomics, structural genom 3e-41
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 2e-40
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 2e-40
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 4e-40
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 5e-40
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-39
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-39
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 2e-39
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 2e-39
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 2e-39
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 4e-39
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 4e-39
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 4e-39
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 6e-39
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 7e-36
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 7e-36
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
 Score =  261 bits (668), Expect = 3e-90
 Identities = 107/136 (78%), Positives = 119/136 (87%)

Query: 4   VLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTG 63
           VLLKT+ GDIDIELWS+EAPKACRNF+QLC+E YY+NTI HRVV GFI QGGDPTGTG+G
Sbjct: 27  VLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGSG 86

Query: 64  GESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVA 123
           GESIYG PFKDE HSRLRF RRGLVAMANAG  DNGSQFFFTL    ELN+KHTIFGKV 
Sbjct: 87  GESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVT 146

Query: 124 GDTIYNMIKLDEIMVD 139
           GDT+YNM++L E+ +D
Sbjct: 147 GDTVYNMLRLSEVDID 162


>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
Probab=100.00  E-value=1.6e-51  Score=318.98  Aligned_cols=152  Identities=43%  Similarity=0.752  Sum_probs=146.7

Q ss_pred             cEEEEEecceeEEEEEcCCCChHHHHHHHHHHhcCccCCceEEEeecCcEEecCCCCCCCCCCCcccCCCCCCcccCCcc
Q psy7836           2 QAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRLR   81 (189)
Q Consensus         2 ~~v~~~T~~G~i~ieL~~~~aP~t~~nF~~L~~~g~Y~g~~f~rv~~~~~iqgGd~~~~~~~~~~~~g~~~~~E~~~~l~   81 (189)
                      .+|+++|++|+|+||||++.||+||+||++||+.|||+|+.|||++|+||+||||+.+++.+++++|++.|++|..+.++
T Consensus         6 ~~v~~~T~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~fhRvi~~f~iQgGd~~~~g~gg~si~g~~~~dE~~~~l~   85 (160)
T 2fu0_A            6 KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGYYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLN   85 (160)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCBTTBC
T ss_pred             CEEEEEecCccEEEEEeCCCChHHHHHHHHHhccCccCCCEEEEEECCCEEEeCCcCCCCCCCCcccCCCccccccCCcc
Confidence            37999999999999999999999999999999999999999999999999999999988999999999999999988899


Q ss_pred             cccceEEEEeccCCCCCCceEEEEcCCCCCCCCCCeEEEEEE-cCcchhhhhhhhcccCCCCCcccCeEEEEEee
Q psy7836          82 FVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVA-GDTIYNMIKLDEIMVDHVSTYLEYRKRINYEG  155 (189)
Q Consensus        82 ~~~~G~vsm~~~~~~~~~sqFfI~l~~~~~ld~~~~vFG~V~-G~~v~~l~~i~~~~~~~~~~P~~~i~I~~~~~  155 (189)
                      |+++|+|||||.++++++|||||++.++||||++|+|||+|+ ||++  +++|++++++.+++|.++|+|.+|++
T Consensus        86 h~~~G~lsmA~~gp~s~~SQFfI~~~~~~~Ldg~~tvFG~Vv~G~dv--v~~I~~~~t~~~~~P~~~v~I~~~~v  158 (160)
T 2fu0_A           86 HSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKI--VLDIEKVRTDKRDKPLEDIKILNIKI  158 (160)
T ss_dssp             SSSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHH--HHHHHTSCBCTTSCBSSCCBEEEEEE
T ss_pred             cCCceEEEEecCCCCCcccEEEEECCCCCccCCCcEEEEEEEcCHHH--HHHHHhCCcCCCCCcCCCeEEEEEEE
Confidence            999999999999999999999999999999999999999999 9988  99999999998999999999999875



>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 3e-41
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 3e-40
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 2e-33
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 1e-30
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 3e-30
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 1e-29
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-29
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 7e-28
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 1e-27
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 2e-27
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 6e-26
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 2e-25
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 5e-25
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 6e-25
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 1e-24
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-24
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-23
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 8e-23
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 3e-22
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 3e-21
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 1e-20
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 3e-20
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  134 bits (339), Expect = 3e-41
 Identities = 74/130 (56%), Positives = 93/130 (71%), Gaps = 1/130 (0%)

Query: 4   VLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTG 63
           V L+TS+G I +EL+ + APK C+NF +L   GYYN T  HR++K F+ QGGDPTGTG G
Sbjct: 14  VYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRG 73

Query: 64  GESIYGKPFKDEIHSRLRFVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKV- 122
           G SIYGK F+DE+H  L+F   G++AMANAG D NGSQFF TLA T  L+ KHTIFG+V 
Sbjct: 74  GASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVC 133

Query: 123 AGDTIYNMIK 132
            G  + N + 
Sbjct: 134 QGIGMVNRVG 143


>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Putative cyclophilin PFE0505w
species: Plasmodium falciparum [TaxId: 5833]
Probab=100.00  E-value=2.5e-46  Score=286.41  Aligned_cols=152  Identities=43%  Similarity=0.752  Sum_probs=146.2

Q ss_pred             cEEEEEecceeEEEEEcCCCChHHHHHHHHHHhcCccCCceEEEeecCcEEecCCCCCCCCCCCcccCCCCCCcccCCcc
Q psy7836           2 QAVLLKTSVGDIDIELWSREAPKACRNFVQLCMEGYYNNTIIHRVVKGFIAQGGDPTGTGTGGESIYGKPFKDEIHSRLR   81 (189)
Q Consensus         2 ~~v~~~T~~G~i~ieL~~~~aP~t~~nF~~L~~~g~Y~g~~f~rv~~~~~iqgGd~~~~~~~~~~~~g~~~~~E~~~~l~   81 (189)
                      .+|+|+|++|+|+||||.+.||+||+||++||++|||+|+.|||+++++++|+|++.+.+.++.+.++..+++|..+.++
T Consensus         2 ~~~~i~T~~G~i~ieL~~~~aP~tv~nF~~l~~~g~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~~~~~~~~   81 (155)
T d2fu0a1           2 KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGYYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLN   81 (155)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCBTTBC
T ss_pred             ceEEEEEcccEEEEEEcCCCChHHHHHHhhHhhCCccccceeeeeeecceeeccCCCCCCcCCcccCCCccccccccccc
Confidence            47899999999999999999999999999999999999999999999999999999888888888889999999998899


Q ss_pred             cccceEEEEeccCCCCCCceEEEEcCCCCCCCCCCeEEEEEE-cCcchhhhhhhhcccCCCCCcccCeEEEEEee
Q psy7836          82 FVRRGLVAMANAGKDDNGSQFFFTLAATPELNSKHTIFGKVA-GDTIYNMIKLDEIMVDHVSTYLEYRKRINYEG  155 (189)
Q Consensus        82 ~~~~G~vsm~~~~~~~~~sqFfI~l~~~~~ld~~~~vFG~V~-G~~v~~l~~i~~~~~~~~~~P~~~i~I~~~~~  155 (189)
                      |.++|+++|++.++++++|||||++.+.|+||++|+|||+|+ ||++  |++|++++++++++|+++|+|.+|++
T Consensus        82 ~~~~~~~~~~~~~~~s~~sqFfI~~~~~~~ld~~~tvFG~Vi~G~~v--v~~I~~~~t~~~~~P~~~i~I~~v~i  154 (155)
T d2fu0a1          82 HSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKI--VLDIEKVRTDKRDKPLEDIKILNIKI  154 (155)
T ss_dssp             SSSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHH--HHHHHTSCBCTTSCBSSCCBEEEEEE
T ss_pred             cCCccEEEecccCCCCCCccceecccCccccccceEEEEEEeccHHH--HHHHHhCCCCCCCCcCCCcEEEEEEE
Confidence            999999999999999999999999999999999999999999 9988  99999999999999999999999876



>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure