Psyllid ID: psy7952


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----
MAEGESKDASSAVGKSSSLTGNQQDRKGGKVSEQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRIPPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALRRKVNKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKNYLSMLEYCEQGYFLVILVFPC
ccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHccccEEEEcccccccccccEEccccccccccccEEEEccccccccccccHHHHHccccccccccHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHccccccccccEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHcccccEEEEEccccccccccccEEEEEccccccccHHHHHcccccccccccEEEEccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccc
ccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEccHHHccHHHHHHHHHHHHcccccEEEEEcHHHHHcccccccHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHccccccEEEEEccccccEEEEEEEccccccHHHHHHHHHHHHHcHcccccccEEEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEEEEEEccccccccEEEEEEEcccccHHHHHHHHccccccccccEEEEEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccc
maegeskdassavgksssltgnqqdrkggkvSEQELTAKLKALFGFDSFKCELQKKAIRHILLRThdifvsmptgAVSLVGSVVsarsrvrippgadfilngnvrsrngwispilssfylrfrddktsivtgrsdlYQLELIVSGQTKTENKAILEELRLVKPrikllyvtperavTESFHYLLQHLVRYNKLAYIVVDEahcvsewghdfrptyrrlgelrqftgnsipiialtataepsvkQDIISVLkfnkpykvfktstfrsnLFYDVIFDDLLKDSYAHVKEFIEKClgkdnkanncgiiycrtrehtTDLADALRRKVNKHERSRVQESFMRGEINVITATIsfgmgidrqNVRFVVhwgmpssipayyqesgragrdgLQSYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKNYLSMLEYCEQGYFLVILVFPC
maegeskdassavgksssltgnqqdrkggkvsEQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSarsrvrippgadfilngnvrsrngWISPILSSFYLRFRDDKTSivtgrsdlyqlelivsgqtktenkaileelrlvkpriKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALtataepsvkQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIekclgkdnkannCGIIycrtrehttdladalrrkvnkhersrvqesfmrgeiNVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHsehskksleyvIKTDTSTKREQLELKFKNYLSMLEYCEQGYFLVILVFPC
MAEGESKDASSAVGKSSSLTGNQQDRKGGKVSEQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTgavslvgsvvsarsrvrIPPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALRRKVNKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKNYLSMLEYCEQGYFLVILVFPC
************************************TAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRIPPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALR*************SFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKNYLSMLEYCEQGYFLVILVF**
************************************TAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRIPPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALRRKVNKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHSKKSLE********************YLSMLEYCEQGYFLVILVFPC
********************************EQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRIPPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALR***********QESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKNYLSMLEYCEQGYFLVILVFPC
**************************KGGKVSEQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRIPPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALRRKVNKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKNYLSMLEYCEQGYFLVILVFPC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEGESKDASSAVGKSSSLTGNQQDRKGGKVSEQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRIPPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALRRKVNKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKNYLSMLEYCEQGYFLVILVFPC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query444 2.2.26 [Sep-21-2011]
O94762 991 ATP-dependent DNA helicas no N/A 0.851 0.381 0.400 7e-82
Q9FT72 713 ATP-dependent DNA helicas yes N/A 0.869 0.541 0.320 7e-56
Q9DEY9 1364 Bloom syndrome protein ho N/A N/A 0.795 0.258 0.355 1e-54
O18017 988 Bloom syndrome protein ho no N/A 0.835 0.375 0.353 2e-53
Q9FT74606 ATP-dependent DNA helicas no N/A 0.790 0.579 0.349 7e-53
P54132 1417 Bloom syndrome protein OS no N/A 0.795 0.249 0.358 9e-53
Q9FT70 1150 ATP-dependent DNA helicas no N/A 0.797 0.307 0.349 2e-52
O88700 1416 Bloom syndrome protein ho no N/A 0.795 0.249 0.353 7e-51
Q8L840 1188 ATP-dependent DNA helicas no N/A 0.819 0.306 0.329 2e-50
Q9CL21 632 ATP-dependent DNA helicas yes N/A 0.581 0.408 0.368 2e-48
>sp|O94762|RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=RECQL5 PE=1 SV=2 Back     alignment and function desciption
 Score =  305 bits (780), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 168/419 (40%), Positives = 243/419 (57%), Gaps = 41/419 (9%)

Query: 33  EQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRI 92
           E+ + + LK +FGFDSFK  LQ+ A   ++    D+FV MPTGA   +   + A      
Sbjct: 13  ERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAGKSLCYQLPA------ 66

Query: 93  PPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENK 152
                 +  G        I+ ++S      +D    ++T +  +  L   +S Q   E K
Sbjct: 67  -----LLAKG--------ITIVVSPLIALIQDQVDHLLTLKVRVSSLNSKLSAQ---ERK 110

Query: 153 AILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFR 212
            +L +L   KP+ K+LY+TPE A + SF   L  LV  + L+Y+VVDEAHCVS+WGHDFR
Sbjct: 111 ELLADLEREKPQTKILYITPEMAASSSFQPTLNSLVSRHLLSYLVVDEAHCVSQWGHDFR 170

Query: 213 PTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDV 272
           P Y RLG LR   G++ P +ALTATA P V++D+ + L   KP  +FKT  FR+NLFYDV
Sbjct: 171 PDYLRLGALRSRLGHA-PCVALTATATPQVQEDVFAALHLKKPVAIFKTPCFRANLFYDV 229

Query: 273 IFDDLLKDSYAHVKEFIEKCLGK--DNKANNCGIIYCRTREHTTDLADALR-RKVNKH-- 327
            F +L+ D Y ++K+F  K LG+  D   + CGI+YCRTRE    LA  L  R VN    
Sbjct: 230 QFKELISDPYGNLKDFCLKALGQEADKGLSGCGIVYCRTREACEQLAIELSCRGVNAKAY 289

Query: 328 -------ERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGR 380
                  ER+ VQ  +M  ++ VI ATISFGMG+D+ NVRFV HW +  S+  YYQESGR
Sbjct: 290 HAGLKASERTLVQNDWMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGR 349

Query: 381 AGRDGLQSYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKN------YLSMLEYCEQ 433
           AGRDG  S+CR+Y+S + +  + ++I+ + +  +E+   K  +      + +++ +CE+
Sbjct: 350 AGRDGKPSWCRLYYSRNDRDQVSFLIRKEVAKLQEKRGNKASDKATIMAFDALVTFCEE 408




May have an important role in DNA metabolism.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9DEY9|BLM_XENLA Bloom syndrome protein homolog OS=Xenopus laevis GN=blm PE=2 SV=1 Back     alignment and function description
>sp|O18017|BLM_CAEEL Bloom syndrome protein homolog OS=Caenorhabditis elegans GN=him-6 PE=2 SV=2 Back     alignment and function description
>sp|Q9FT74|RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana GN=RECQL1 PE=2 SV=1 Back     alignment and function description
>sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 Back     alignment and function description
>sp|Q9FT70|RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1 Back     alignment and function description
>sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 Back     alignment and function description
>sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 Back     alignment and function description
>sp|Q9CL21|RECQ_PASMU ATP-dependent DNA helicase RecQ OS=Pasteurella multocida (strain Pm70) GN=recQ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
328713283 1075 PREDICTED: ATP-dependent DNA helicase Q5 0.844 0.348 0.456 1e-91
157110525 846 DNA helicase recq5 [Aedes aegypti] gi|10 0.864 0.453 0.415 6e-86
312373020 1482 hypothetical protein AND_18377 [Anophele 0.894 0.267 0.428 7e-85
347965591 1523 AGAP001255-PA [Anopheles gambiae str. PE 0.849 0.247 0.424 1e-84
170039315 859 ATP-dependent DNA helicase recQ [Culex q 0.851 0.440 0.405 9e-84
270009277 1715 homolog of RecQ [Tribolium castaneum] 0.876 0.226 0.390 4e-82
334322907 996 PREDICTED: ATP-dependent DNA helicase Q5 0.851 0.379 0.411 1e-81
242008765 853 DNA helicase recq5, putative [Pediculus 0.846 0.440 0.419 1e-81
357627528 1133 DNA helicase recq5 [Danaus plexippus] 0.844 0.330 0.385 1e-81
193786741435 unnamed protein product [Homo sapiens] 0.851 0.868 0.400 2e-80
>gi|328713283|ref|XP_001944776.2| PREDICTED: ATP-dependent DNA helicase Q5-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  343 bits (879), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 193/423 (45%), Positives = 256/423 (60%), Gaps = 48/423 (11%)

Query: 36  LTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRIPPG 95
           L  KLK  F   +FK +LQK AI  IL R  D+FVSMPTG+   +   + A   V   P 
Sbjct: 20  LLEKLKHFFHHPTFKSDLQKNAIIAILKRKFDVFVSMPTGSGKSLCYQLPA---VLHSPK 76

Query: 96  ADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAIL 155
              +            SP+++   ++ + D  + +  R+     E I S   ++E K ++
Sbjct: 77  VTIVF-----------SPLIA--LMKDQVDHLTRLKIRA-----ETINSKMPESERKRVI 118

Query: 156 EELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTY 215
            +L   +    LLYVTPE+A T+ F  LL +LVR NKLAYIVVDEAHCVS+WGHDFRP Y
Sbjct: 119 NDLYATQVSTSLLYVTPEQAATDFFKGLLSYLVRKNKLAYIVVDEAHCVSQWGHDFRPDY 178

Query: 216 RRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFD 275
            +LG LR+   + IP IALTATA   V +DI++ L    P   F T  FRSNLFYDVIFD
Sbjct: 179 LKLGMLRELYLH-IPWIALTATASADVVKDIMTALCLKTPVSKFTTPCFRSNLFYDVIFD 237

Query: 276 DLLKDSYAHVKEFIEKCLGKDNK-----------ANNCGIIYCRTREHTTDLADALRRK- 323
           D + +SY H+K+FI++CL  D                CGIIYCRTRE T ++A  L RK 
Sbjct: 238 DSITNSYQHLKDFIDQCLCDDLNCLEGTPNINPLTQPCGIIYCRTRELTEEIATVLSRKG 297

Query: 324 ---------VNKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAY 374
                    +   ER  VQE+FM G I VITAT+SFGMGID+  VRFV+HWG+PSSIPAY
Sbjct: 298 ISIAPYHAGLKDKERLAVQEAFMSGHIQVITATVSFGMGIDKATVRFVIHWGIPSSIPAY 357

Query: 375 YQESGRAGRDGLQSYCRIYHSEHSKKSLEYVIKT-----DTSTKREQLELKFKNYLSMLE 429
           YQESGRAGRDG  + CRIYHS+ +K SL++++K+      T  K+++ +  +  +L M++
Sbjct: 358 YQESGRAGRDGKLARCRIYHSKQAKNSLDFILKSAITQAKTQDKQKKAKGSYSMFLKMIQ 417

Query: 430 YCE 432
           +CE
Sbjct: 418 FCE 420




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157110525|ref|XP_001651140.1| DNA helicase recq5 [Aedes aegypti] gi|108878672|gb|EAT42897.1| AAEL005597-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312373020|gb|EFR20851.1| hypothetical protein AND_18377 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347965591|ref|XP_001238556.3| AGAP001255-PA [Anopheles gambiae str. PEST] gi|333470440|gb|EAU75726.3| AGAP001255-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170039315|ref|XP_001847485.1| ATP-dependent DNA helicase recQ [Culex quinquefasciatus] gi|167862886|gb|EDS26269.1| ATP-dependent DNA helicase recQ [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|270009277|gb|EFA05725.1| homolog of RecQ [Tribolium castaneum] Back     alignment and taxonomy information
>gi|334322907|ref|XP_001377617.2| PREDICTED: ATP-dependent DNA helicase Q5 [Monodelphis domestica] Back     alignment and taxonomy information
>gi|242008765|ref|XP_002425170.1| DNA helicase recq5, putative [Pediculus humanus corporis] gi|212508872|gb|EEB12432.1| DNA helicase recq5, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357627528|gb|EHJ77194.1| DNA helicase recq5 [Danaus plexippus] Back     alignment and taxonomy information
>gi|193786741|dbj|BAG52064.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
UNIPROTKB|Q6P4G0 964 RECQL5 "ATP-dependent DNA heli 0.680 0.313 0.449 2e-72
UNIPROTKB|J3KTQ2480 RECQL5 "ATP-dependent DNA heli 0.813 0.752 0.411 4.1e-72
UNIPROTKB|O94762 991 RECQL5 "ATP-dependent DNA heli 0.813 0.364 0.411 4.1e-72
UNIPROTKB|E1BKM5 987 RECQL5 "Uncharacterized protei 0.844 0.379 0.404 2.9e-71
UNIPROTKB|I3LFW3432 RECQL5 "Uncharacterized protei 0.813 0.835 0.411 6.1e-71
RGD|1310823 973 Recql5 "RecQ protein-like 5" [ 0.844 0.385 0.401 6.1e-71
UNIPROTKB|F1PAG8 989 RECQL5 "Uncharacterized protei 0.844 0.379 0.399 3.3e-69
UNIPROTKB|F1NT69451 F1NT69 "Uncharacterized protei 0.797 0.784 0.415 1.9e-67
UNIPROTKB|F1NWK5 1023 F1NWK5 "Uncharacterized protei 0.797 0.346 0.415 5.4e-67
FB|FBgn0027375 1058 RecQ5 "homolog of RecQ" [Droso 0.842 0.353 0.368 1.6e-55
UNIPROTKB|Q6P4G0 RECQL5 "ATP-dependent DNA helicase Q5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 685 (246.2 bits), Expect = 2.0e-72, Sum P(2) = 2.0e-72
 Identities = 143/318 (44%), Positives = 200/318 (62%)

Query:   111 ISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYV 170
             I+ ++S      +D    ++T +  +  L   +S Q   E K +L +L   KP+ K+LY+
Sbjct:    45 ITIVVSPLIALIQDQVDHLLTLKVRVSSLNSKLSAQ---ERKELLADLEREKPQTKILYI 101

Query:   171 TPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIP 230
             TPE A + SF   L  LV  + L+Y+VVDEAHCVS+WGHDFRP Y RLG LR   G++ P
Sbjct:   102 TPEMAASSSFQPTLNSLVSRHLLSYLVVDEAHCVSQWGHDFRPDYLRLGALRSRLGHA-P 160

Query:   231 IIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIE 290
              +ALTATA P V++D+ + L   KP  +FKT  FR+NLFYDV F +L+ D Y ++K+F  
Sbjct:   161 CVALTATATPQVQEDVFAALHLKKPVAIFKTPCFRANLFYDVQFKELISDPYGNLKDFCL 220

Query:   291 KCLGK--DNKANNCGIIYCRTREHTTDLADALR-RKVNK---H------ERSRVQESFMR 338
             K LG+  D   + CGI+YCRTRE    LA  L  R VN    H      ER+ VQ  +M 
Sbjct:   221 KALGQEADKGLSGCGIVYCRTREACEQLAIELSCRGVNAKAYHAGLKASERTLVQNDWME 280

Query:   339 GEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHS 398
              ++ VI ATISFGMG+D+ NVRFV HW +  S+  YYQESGRAGRDG  S+CR+Y+S + 
Sbjct:   281 EKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRAGRDGKPSWCRLYYSRND 340

Query:   399 KKSLEYVIKTDTSTKREQ 416
             +  + ++I+ + +  +E+
Sbjct:   341 RDQVSFLIRKEVAKLQEK 358


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0006310 "DNA recombination" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|J3KTQ2 RECQL5 "ATP-dependent DNA helicase Q5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O94762 RECQL5 "ATP-dependent DNA helicase Q5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKM5 RECQL5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LFW3 RECQL5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1310823 Recql5 "RecQ protein-like 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAG8 RECQL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NT69 F1NT69 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWK5 F1NWK5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0027375 RecQ5 "homolog of RecQ" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.12LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 8e-87
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 2e-83
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 2e-78
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 2e-66
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 4e-61
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-20
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-14
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-14
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 7e-13
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 5e-10
COG1205 851 COG1205, COG1205, Distinct helicase family with a 9e-10
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-09
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-09
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-07
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 2e-07
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 5e-06
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 1e-05
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisiona 1e-05
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-04
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 1e-04
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 3e-04
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 4e-04
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 0.001
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 0.002
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
 Score =  276 bits (707), Expect = 8e-87
 Identities = 139/414 (33%), Positives = 213/414 (51%), Gaps = 60/414 (14%)

Query: 34  QELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRV-RI 92
           +E    LK +FG+ SF+   Q++ I  +L    D  V MPTG           +S   +I
Sbjct: 3   EEAQQVLKQVFGYASFR-PGQQEIIDALLSG-KDTLVVMPTG---------GGKSLCYQI 51

Query: 93  PPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENK 152
           P     +L G        +SP++S   L  +D    +    +   +   + S  ++ E +
Sbjct: 52  P---ALLLEGLTLV----VSPLIS---LM-KDQ---VDQLEAAGIRAAYLNSTLSREERQ 97

Query: 153 AILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFR 212
            +L   +L   ++KLLY++PER ++  F  LL+ L     ++ + +DEAHC+S+WGHDFR
Sbjct: 98  QVLN--QLKSGQLKLLYISPERLMSPRFLELLKRL----PISLVAIDEAHCISQWGHDFR 151

Query: 213 PTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDV 272
           P YRRLG LR    N  P++ALTATA P V+ DI   L       +F+ S  R NL   V
Sbjct: 152 PDYRRLGRLRAGLPN-PPVLALTATATPRVRDDIREQLGLQDA-NIFRGSFDRPNLALKV 209

Query: 273 IFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALRRK--------- 323
           +      D  A +   + +           GIIYC TR+   +LA+ LR+          
Sbjct: 210 VEKGEPSDQLAFLATVLPQLSK-------SGIIYCLTRKKVEELAEWLRKNGISAGAYHA 262

Query: 324 -VNKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAG 382
            ++  ER RVQ++F+  EI V+ AT +FGMGID+ +VRFV+H+ +P SI +YYQE+GRAG
Sbjct: 263 GLSNEERERVQQAFLNDEIKVMVATNAFGMGIDKPDVRFVIHYDLPGSIESYYQETGRAG 322

Query: 383 RDGLQSYCRIYHSEHSKKSLEYVIKT----DTSTKREQLELKFKNYLSMLEYCE 432
           RDGL +   + +S    +   Y+I+     +   + E  +L+      M+ YCE
Sbjct: 323 RDGLPAEAILLYSPEDIRWQRYLIEQSKPDEEQKQIELAKLR-----QMIAYCE 371


Length = 590

>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 444
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0352|consensus 641 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0331|consensus519 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0330|consensus476 100.0
KOG0328|consensus400 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0338|consensus 691 100.0
KOG0333|consensus673 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0351|consensus 941 100.0
KOG0336|consensus629 100.0
KOG0340|consensus442 100.0
KOG0342|consensus543 100.0
KOG0353|consensus 695 100.0
KOG0345|consensus 567 100.0
KOG0335|consensus482 100.0
KOG0326|consensus459 100.0
KOG0348|consensus 708 100.0
KOG0347|consensus 731 100.0
KOG0343|consensus 758 100.0
KOG0346|consensus 569 100.0
KOG4284|consensus 980 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0332|consensus477 100.0
KOG0341|consensus610 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG0339|consensus 731 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0350|consensus620 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
KOG0327|consensus397 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
KOG0334|consensus 997 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
KOG0329|consensus387 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
KOG0952|consensus 1230 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
KOG0344|consensus593 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
KOG0337|consensus 529 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
KOG0354|consensus 746 100.0
PHA02653 675 RNA helicase NPH-II; Provisional 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
COG1200677 RecG RecG-like helicase [DNA replication, recombin 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.98
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.97
KOG0951|consensus 1674 99.97
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.97
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.97
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.97
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.97
PRK05580679 primosome assembly protein PriA; Validated 99.97
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.96
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.95
PRK09694 878 helicase Cas3; Provisional 99.95
PRK04914 956 ATP-dependent helicase HepA; Validated 99.95
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.95
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.95
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.95
KOG0947|consensus 1248 99.95
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.94
KOG0950|consensus 1008 99.93
KOG0349|consensus725 99.93
KOG0948|consensus 1041 99.93
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.92
COG4096 875 HsdR Type I site-specific restriction-modification 99.92
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.92
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.91
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.9
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.9
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.89
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.88
KOG0949|consensus 1330 99.88
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.88
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.88
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.88
KOG0922|consensus 674 99.88
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.87
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.87
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.86
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.84
KOG4150|consensus 1034 99.84
KOG1123|consensus776 99.82
KOG0926|consensus 1172 99.82
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.81
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.81
KOG0924|consensus 1042 99.81
KOG0923|consensus 902 99.81
KOG0920|consensus 924 99.79
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.79
KOG0385|consensus 971 99.77
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.76
COG4889 1518 Predicted helicase [General function prediction on 99.75
KOG0387|consensus 923 99.72
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.72
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.72
KOG0384|consensus 1373 99.71
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.71
KOG0925|consensus 699 99.69
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.69
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.67
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.67
KOG0951|consensus 1674 99.67
KOG0389|consensus 941 99.64
KOG0390|consensus776 99.64
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.64
PRK05298652 excinuclease ABC subunit B; Provisional 99.64
KOG0953|consensus 700 99.62
smart00487201 DEXDc DEAD-like helicases superfamily. 99.61
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.6
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.58
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.58
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.56
PRK14873665 primosome assembly protein PriA; Provisional 99.55
KOG1000|consensus689 99.55
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.54
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.49
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.49
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.48
KOG0392|consensus1549 99.46
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.42
KOG0386|consensus 1157 99.38
smart0049082 HELICc helicase superfamily c-terminal domain. 99.35
COG0610 962 Type I site-specific restriction-modification syst 99.32
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.24
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.2
KOG0388|consensus1185 99.18
KOG1002|consensus791 99.13
KOG0391|consensus 1958 99.11
KOG4439|consensus901 99.1
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.0
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.99
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.78
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.78
KOG1015|consensus 1567 98.77
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.76
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.61
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.55
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.52
KOG0952|consensus1230 98.49
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.41
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.35
PRK15483 986 type III restriction-modification system StyLTI en 98.2
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.14
KOG0921|consensus 1282 98.13
KOG1016|consensus 1387 98.1
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.0
KOG1803|consensus649 97.99
KOG1513|consensus 1300 97.96
KOG1802|consensus 935 97.91
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.88
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.78
TIGR00376 637 DNA helicase, putative. The gene product may repre 97.74
KOG2340|consensus698 97.71
PRK10536262 hypothetical protein; Provisional 97.7
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.69
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.64
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 97.62
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.56
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 97.42
PF1324576 AAA_19: Part of AAA domain 97.42
KOG1805|consensus1100 97.34
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.31
PRK08181269 transposase; Validated 97.31
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.25
PRK06526254 transposase; Provisional 97.15
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.12
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.95
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.95
KOG1132|consensus 945 96.84
KOG1133|consensus821 96.83
PF13871 278 Helicase_C_4: Helicase_C-like 96.76
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.71
PRK12377248 putative replication protein; Provisional 96.71
KOG0989|consensus346 96.7
PRK08727233 hypothetical protein; Validated 96.68
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 96.67
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.6
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.59
PRK13889 988 conjugal transfer relaxase TraA; Provisional 96.48
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.45
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.4
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.26
PRK06921266 hypothetical protein; Provisional 96.22
KOG2028|consensus554 96.2
PRK07952244 DNA replication protein DnaC; Validated 96.2
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.2
PRK05642234 DNA replication initiation factor; Validated 96.19
PRK14974336 cell division protein FtsY; Provisional 96.11
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.11
PRK06835329 DNA replication protein DnaC; Validated 96.08
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.06
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.05
KOG1131|consensus755 96.05
PRK08084235 DNA replication initiation factor; Provisional 96.04
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.03
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.03
PRK05707328 DNA polymerase III subunit delta'; Validated 96.02
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.99
PRK04296190 thymidine kinase; Provisional 95.98
PRK00149450 dnaA chromosomal replication initiation protein; R 95.98
PRK12422445 chromosomal replication initiation protein; Provis 95.91
PRK14087450 dnaA chromosomal replication initiation protein; P 95.89
KOG0739|consensus439 95.86
PRK14088440 dnaA chromosomal replication initiation protein; P 95.84
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.83
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.82
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.82
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.75
PRK08116268 hypothetical protein; Validated 95.72
PRK06893229 DNA replication initiation factor; Validated 95.72
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.72
PRK09183259 transposase/IS protein; Provisional 95.71
KOG1001|consensus674 95.66
KOG0742|consensus630 95.65
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.61
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 95.57
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 95.55
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.5
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.45
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 95.43
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.35
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.33
PRK13826 1102 Dtr system oriT relaxase; Provisional 95.27
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 95.24
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 95.23
PRK14086617 dnaA chromosomal replication initiation protein; P 95.21
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.2
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.19
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.19
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.18
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.11
PF00004132 AAA: ATPase family associated with various cellula 95.1
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.02
PTZ001121164 origin recognition complex 1 protein; Provisional 95.0
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 94.97
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.96
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 94.94
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 94.87
KOG0383|consensus696 94.86
PLN03025319 replication factor C subunit; Provisional 94.8
PRK08769319 DNA polymerase III subunit delta'; Validated 94.79
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 94.79
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 94.77
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 94.73
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.73
PRK00771437 signal recognition particle protein Srp54; Provisi 94.73
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 94.67
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.67
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 94.65
PRK05595444 replicative DNA helicase; Provisional 94.62
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 94.55
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 94.54
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.49
PRK08939306 primosomal protein DnaI; Reviewed 94.47
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.43
PRK06904472 replicative DNA helicase; Validated 94.37
PRK06964342 DNA polymerase III subunit delta'; Validated 94.31
PRK07940394 DNA polymerase III subunit delta'; Validated 94.27
PRK12402337 replication factor C small subunit 2; Reviewed 94.25
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 94.22
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.1
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 94.03
KOG0741|consensus 744 94.02
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 93.94
TIGR00064272 ftsY signal recognition particle-docking protein F 93.92
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 93.86
PRK09112351 DNA polymerase III subunit delta'; Validated 93.86
KOG0701|consensus 1606 93.84
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 93.84
COG3972 660 Superfamily I DNA and RNA helicases [General funct 93.78
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 93.77
PRK08760476 replicative DNA helicase; Provisional 93.77
KOG1133|consensus 821 93.74
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 93.74
PRK05748448 replicative DNA helicase; Provisional 93.69
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 93.57
KOG0734|consensus752 93.57
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 93.56
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.51
PRK11054 684 helD DNA helicase IV; Provisional 93.51
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 93.49
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 93.48
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 93.41
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 93.4
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.32
PRK07993334 DNA polymerase III subunit delta'; Validated 93.32
PRK11331459 5-methylcytosine-specific restriction enzyme subun 93.32
PRK06871325 DNA polymerase III subunit delta'; Validated 93.27
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 93.25
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 93.24
KOG0744|consensus423 93.24
COG0552340 FtsY Signal recognition particle GTPase [Intracell 93.24
PRK09376416 rho transcription termination factor Rho; Provisio 93.2
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 93.15
PRK08506472 replicative DNA helicase; Provisional 93.04
PRK06090319 DNA polymerase III subunit delta'; Validated 92.97
TIGR00767415 rho transcription termination factor Rho. Members 92.97
PRK05973237 replicative DNA helicase; Provisional 92.92
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 92.89
PRK13341 725 recombination factor protein RarA/unknown domain f 92.89
PRK08699325 DNA polymerase III subunit delta'; Validated 92.88
KOG0738|consensus491 92.87
PRK07471365 DNA polymerase III subunit delta'; Validated 92.86
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 92.84
PRK13894319 conjugal transfer ATPase TrbB; Provisional 92.76
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 92.74
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 92.7
PRK06067234 flagellar accessory protein FlaH; Validated 92.69
PRK13833323 conjugal transfer protein TrbB; Provisional 92.67
PRK13342413 recombination factor protein RarA; Reviewed 92.55
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 92.55
PRK09165497 replicative DNA helicase; Provisional 92.53
PRK05636505 replicative DNA helicase; Provisional 92.53
PRK08840464 replicative DNA helicase; Provisional 92.48
KOG0991|consensus333 92.46
PRK08006471 replicative DNA helicase; Provisional 92.45
PHA03368 738 DNA packaging terminase subunit 1; Provisional 92.43
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.36
PRK07004460 replicative DNA helicase; Provisional 92.33
PRK04195482 replication factor C large subunit; Provisional 92.3
PRK10416318 signal recognition particle-docking protein FtsY; 92.3
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 92.26
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.24
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 92.21
PRK06321472 replicative DNA helicase; Provisional 92.19
TIGR00665434 DnaB replicative DNA helicase. This model describe 92.15
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 92.1
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 91.98
KOG0298|consensus 1394 91.97
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 91.91
COG2255332 RuvB Holliday junction resolvasome, helicase subun 91.59
PRK03992389 proteasome-activating nucleotidase; Provisional 91.57
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 91.56
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 91.52
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 91.48
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 91.43
PRK13897606 type IV secretion system component VirD4; Provisio 91.28
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 91.18
PRK05298 652 excinuclease ABC subunit B; Provisional 91.12
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 91.04
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 91.02
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 90.92
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 90.88
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 90.87
PRK10867433 signal recognition particle protein; Provisional 90.83
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 90.83
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 90.76
PHA03333 752 putative ATPase subunit of terminase; Provisional 90.76
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 90.76
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 90.73
CHL00176638 ftsH cell division protein; Validated 90.71
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 90.7
KOG1132|consensus 945 90.68
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 90.67
PRK10865 857 protein disaggregation chaperone; Provisional 90.62
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 90.6
PHA02542473 41 41 helicase; Provisional 90.54
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 90.54
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 90.4
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 90.35
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 90.19
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 90.08
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 90.04
KOG2170|consensus344 90.03
KOG0733|consensus 802 90.02
PRK07773 886 replicative DNA helicase; Validated 89.99
PRK00440319 rfc replication factor C small subunit; Reviewed 89.95
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 89.91
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 89.86
PRK07399314 DNA polymerase III subunit delta'; Validated 89.84
PRK13822641 conjugal transfer coupling protein TraG; Provision 89.82
PRK11823446 DNA repair protein RadA; Provisional 89.79
PHA02533534 17 large terminase protein; Provisional 89.72
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 89.72
cd03115173 SRP The signal recognition particle (SRP) mediates 89.64
PHA02544316 44 clamp loader, small subunit; Provisional 89.54
COG0606490 Predicted ATPase with chaperone activity [Posttran 89.53
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 89.5
TIGR00959428 ffh signal recognition particle protein. This mode 89.38
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 89.36
PRK08058329 DNA polymerase III subunit delta'; Validated 88.93
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 88.92
PRK13850 670 type IV secretion system protein VirD4; Provisiona 88.89
PRK106891147 transcription-repair coupling factor; Provisional 88.88
PRK13851344 type IV secretion system protein VirB11; Provision 88.84
KOG0733|consensus802 88.68
KOG0732|consensus 1080 88.48
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 88.35
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 88.35
COG0470325 HolB ATPase involved in DNA replication [DNA repli 88.25
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 88.2
PRK13880636 conjugal transfer coupling protein TraG; Provision 88.17
KOG0331|consensus519 87.99
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 87.96
COG0305435 DnaB Replicative DNA helicase [DNA replication, re 87.83
COG1221403 PspF Transcriptional regulators containing an AAA- 87.77
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 87.67
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 87.53
KOG0741|consensus744 87.51
KOG0729|consensus435 87.25
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 87.23
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 86.97
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 86.92
TIGR02974329 phageshock_pspF psp operon transcriptional activat 86.87
smart00382148 AAA ATPases associated with a variety of cellular 86.83
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 86.47
PRK08533230 flagellar accessory protein FlaH; Reviewed 86.47
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 86.47
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 86.37
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 86.35
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 86.34
KOG0344|consensus593 86.21
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 86.12
KOG0333|consensus673 86.09
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 86.0
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 85.79
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 85.73
PRK13876 663 conjugal transfer coupling protein TraG; Provision 85.55
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 85.54
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 85.39
PRK12608380 transcription termination factor Rho; Provisional 85.2
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 85.16
PRK06749428 replicative DNA helicase; Provisional 85.15
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 84.98
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 84.9
cd00983325 recA RecA is a bacterial enzyme which has roles in 84.89
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 84.83
CHL00095821 clpC Clp protease ATP binding subunit 84.78
PRK05917290 DNA polymerase III subunit delta'; Validated 84.75
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 84.74
PHA03372 668 DNA packaging terminase subunit 1; Provisional 84.71
KOG0730|consensus693 84.56
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 84.49
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 84.46
cd01128249 rho_factor Transcription termination factor rho is 84.41
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 84.33
PRK10436462 hypothetical protein; Provisional 84.33
TIGR02767623 TraG-Ti Ti-type conjugative transfer system protie 84.31
PTZ00110545 helicase; Provisional 84.12
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 84.08
TIGR02533486 type_II_gspE general secretory pathway protein E. 83.96
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 83.86
KOG0298|consensus1394 83.71
KOG2228|consensus408 83.71
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 83.46
PHA00350399 putative assembly protein 83.38
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 83.28
KOG0736|consensus953 83.12
PRK09354349 recA recombinase A; Provisional 82.91
PTZ00293211 thymidine kinase; Provisional 82.9
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 82.86
COG0593408 DnaA ATPase involved in DNA replication initiation 82.72
COG4128398 Zot Zonula occludens toxin [General function predi 82.59
TIGR02012321 tigrfam_recA protein RecA. This model describes or 82.4
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 82.19
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 82.0
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 82.0
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 81.88
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 81.84
TIGR02688449 conserved hypothetical protein TIGR02688. Members 81.82
KOG1807|consensus 1025 81.77
PHA02244383 ATPase-like protein 81.73
PRK13531498 regulatory ATPase RavA; Provisional 81.73
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 81.69
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 81.64
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 81.53
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 81.2
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 81.2
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 81.15
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.1e-54  Score=440.12  Aligned_cols=382  Identities=36%  Similarity=0.594  Sum_probs=314.5

Q ss_pred             CCCCCCCC-HHHHHHHHHHHhCCcccCchHHHHHHHHHHccCCcEEEEccCCCcccccccccccceEEeCCCccccccCC
Q psy7952          25 DRKGGKVS-EQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRIPPGADFILNGN  103 (444)
Q Consensus        25 ~~~~~~~~-~~~~~~~l~~~~g~~~~~t~~Q~~~~~~~~~~~~~~ii~apTGsGKT~~a~~~~~~~~~~~~~~~~l~~~~  103 (444)
                      +|....++ ...+...++..||+..|+ ++|.++++.++.| +|+++.+|||+|||++        |++|+    +...+
T Consensus       436 ~W~~~~fpw~~~L~~~lk~~FG~~sFR-p~Q~eaI~aiL~G-rDVLVimPTGSGKSLc--------YQLPA----L~~~G  501 (1195)
T PLN03137        436 KWSSRNFPWTKKLEVNNKKVFGNHSFR-PNQREIINATMSG-YDVFVLMPTGGGKSLT--------YQLPA----LICPG  501 (1195)
T ss_pred             cccccCCCchHHHHHHHHHHcCCCCCC-HHHHHHHHHHHcC-CCEEEEcCCCccHHHH--------HHHHH----HHcCC
Confidence            35544444 567888999999999977 8999999999999 9999999999999999        99999    77777


Q ss_pred             ccceeEEEcchhhhhcccCccchHhhh-cCCCCceeEEEEeCCCChhhHHHHHHHHHhcCCCeeEEEECCCcccccc-HH
Q psy7952         104 VRSRNGWISPILSSFYLRFRDDKTSIV-TGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYVTPERAVTES-FH  181 (444)
Q Consensus       104 ~~~~vlil~P~~~L~~~~q~~~~~~~l-~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Iiv~Tpe~l~~~~-~~  181 (444)
                      .+   |||+|+++|+     .+|+..+ ..+   +.+..+.++....+....+..+....+.++|+|+|||++.... +.
T Consensus       502 iT---LVISPLiSLm-----qDQV~~L~~~G---I~Aa~L~s~~s~~eq~~ilr~l~s~~g~~~ILyvTPERL~~~d~ll  570 (1195)
T PLN03137        502 IT---LVISPLVSLI-----QDQIMNLLQAN---IPAASLSAGMEWAEQLEILQELSSEYSKYKLLYVTPEKVAKSDSLL  570 (1195)
T ss_pred             cE---EEEeCHHHHH-----HHHHHHHHhCC---CeEEEEECCCCHHHHHHHHHHHHhcCCCCCEEEEChHHhhcchHHH
Confidence            77   9999999999     8899988 778   9999999999988888888777655578999999999986421 22


Q ss_pred             HHHHHHHhhCCccEEEEeccccccccCCCcHHHHHHHHHHHHhhCCCCcEEEEeccCCcchHHHHHHHhcCCCCeEEEec
Q psy7952         182 YLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKT  261 (444)
Q Consensus       182 ~~~~~~~~~~~~~~iViDE~H~~~~~~~~~~~~~~~l~~~~~~~~~~~~~v~lSAT~~~~~~~~~~~~l~~~~~~~~~~~  261 (444)
                      ..+........+.+|||||||++++||++|++.|..+..+.+.++. .+++++|||+++...+++...+++..+ .++..
T Consensus       571 ~~L~~L~~~~~LslIVIDEAHcVSqWGhDFRpdYr~L~~Lr~~fp~-vPilALTATAT~~V~eDI~~~L~l~~~-~vfr~  648 (1195)
T PLN03137        571 RHLENLNSRGLLARFVIDEAHCVSQWGHDFRPDYQGLGILKQKFPN-IPVLALTATATASVKEDVVQALGLVNC-VVFRQ  648 (1195)
T ss_pred             HHHHhhhhccccceeccCcchhhhhcccchHHHHHHHHHHHHhCCC-CCeEEEEecCCHHHHHHHHHHcCCCCc-EEeec
Confidence            2233333345689999999999999999999999998877777776 889999999999999999999987766 45666


Q ss_pred             CCCCCCceEEEEEcccchhhHHHHHHHHHHHhccCCCCCceEEEEecccchHHHHHHHHHhh----------cCHHHHHH
Q psy7952         262 STFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALRRK----------VNKHERSR  331 (444)
Q Consensus       262 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~iVf~~s~~~~~~l~~~L~~~----------~~~~~r~~  331 (444)
                      +..++++.|.+.....  .....+..++.    .. ..+.++||||+++++|+.++..|...          |++++|..
T Consensus       649 Sf~RpNL~y~Vv~k~k--k~le~L~~~I~----~~-~~~esgIIYC~SRke~E~LAe~L~~~Gika~~YHAGLs~eeR~~  721 (1195)
T PLN03137        649 SFNRPNLWYSVVPKTK--KCLEDIDKFIK----EN-HFDECGIIYCLSRMDCEKVAERLQEFGHKAAFYHGSMDPAQRAF  721 (1195)
T ss_pred             ccCccceEEEEeccch--hHHHHHHHHHH----hc-ccCCCceeEeCchhHHHHHHHHHHHCCCCeeeeeCCCCHHHHHH
Confidence            7889999887765421  11222333322    21 13567899999999999999999876          89999999


Q ss_pred             HHHHHhcCCccEEEEcCccccccccCCccEEEEeCCCCCHHHHHHHhccCCCCCCceeEEEEecccchhhHHHHHhhccc
Q psy7952         332 VQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHSKKSLEYVIKTDTS  411 (444)
Q Consensus       332 ~~~~f~~g~~~vLvaT~~~~~Gidi~~~~~Vi~~~~p~s~~~~~Qr~GR~~R~g~~g~~~~~~~~~~~~~~~~~~~~~~~  411 (444)
                      +++.|..|+++|||||+++++|||+|+|++|||+++|.|++.|+||+||+||+|..|.|++|++..|...++.++.....
T Consensus       722 vqe~F~~Gei~VLVATdAFGMGIDkPDVR~VIHydlPkSiEsYyQriGRAGRDG~~g~cILlys~~D~~~~~~lI~~~~~  801 (1195)
T PLN03137        722 VQKQWSKDEINIICATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCVLYYSYSDYIRVKHMISQGGV  801 (1195)
T ss_pred             HHHHHhcCCCcEEEEechhhcCCCccCCcEEEEcCCCCCHHHHHhhhcccCCCCCCceEEEEecHHHHHHHHHHHhcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999864432


Q ss_pred             hhH-------------HHHHHHHhhHHHHHHHhhh----------ceeeeec
Q psy7952         412 TKR-------------EQLELKFKNYLSMLEYCEQ----------GYFLVIL  440 (444)
Q Consensus       412 ~~~-------------~~~~~~~~~~~~~~~~~~~----------~~~~~~~  440 (444)
                      ...             ...+....++..|++||+.          .||.+..
T Consensus       802 ~~s~~~~~~~r~~~s~~~~e~~~~~L~~m~~yce~~~~CRR~~lL~yFGE~~  853 (1195)
T PLN03137        802 EQSPMAMGYNRMASSGRILETNTENLLRMVSYCENEVDCRRFLQLVHFGEKF  853 (1195)
T ss_pred             ccchhhhhhcccchhHHHHHHHHHHHHHHHHHHhChHhhHHHHHHHHccccc
Confidence            210             0123457889999999986          4677753



>KOG0352|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4128 Zot Zonula occludens toxin [General function prediction only] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
1oyy_A 523 Structure Of The Recq Catalytic Core Bound To Atp-G 1e-46
1oyw_A 523 Structure Of The Recq Catalytic Core Length = 523 3e-44
2v1x_A 591 Crystal Structure Of Human Recq-Like Dna Helicase L 2e-37
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 5e-08
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 6e-06
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 7e-06
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 3e-05
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 1e-04
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 1e-04
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 1e-04
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 4e-04
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 5e-04
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 6e-04
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 7e-04
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure

Iteration: 1

Score = 184 bits (466), Expect = 1e-46, Method: Compositional matrix adjust. Identities = 127/415 (30%), Positives = 210/415 (50%), Gaps = 55/415 (13%) Query: 40 LKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTXXXXXXXXXXXXXXXXXIPPGADFI 99 L+ FG+ F+ ++ I +L D V MPT IP + Sbjct: 17 LQETFGYQQFRPG--QEEIIDTVLSGRDCLVVMPTGGGKSLCYQ--------IPA---LL 63 Query: 100 LNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENKAILEELR 159 LNG +SP++S K + +++ + S QT+ + ++ R Sbjct: 64 LNGLTVV----VSPLISLM-------KDQVDQLQANGVAAACLNSTQTREQQLEVMTGCR 112 Query: 160 LVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLG 219 +I+LLY+ PER + ++F L+HL +N + + VDEAHC+S+WGHDFRP Y LG Sbjct: 113 --TGQIRLLYIAPERLMLDNF---LEHLAHWNPV-LLAVDEAHCISQWGHDFRPEYAALG 166 Query: 220 ELRQ-FTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTF-RSNLFYDVIFDDL 277 +LRQ F ++P +ALTATA+ + +QDI+ +L N P + + S+F R N+ Y + Sbjct: 167 QLRQRFP--TLPFMALTATADDTTRQDIVRLLGLNDP--LIQISSFDRPNIRY------M 216 Query: 278 LKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALRRK----------VNKH 327 L + + + + + + K+ GIIYC +R D A L+ K + + Sbjct: 217 LMEKFKPLDQLMRYVQEQRGKS---GIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENN 273 Query: 328 ERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQ 387 R+ VQE F R ++ ++ AT++FGMGI++ NVRFVVH+ +P +I +YYQE+GRAGRDGL Sbjct: 274 VRADVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLP 333 Query: 388 SYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKNYLSMLEYCEQGYFLVILVF 442 + +++ L ++ + + +E N + + LV+L + Sbjct: 334 AEAMLFYDPADMAWLRRCLEEKPQGQLQDIERHKLNAMGAFAEAQTCRRLVLLNY 388
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 1e-104
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 8e-06
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 4e-99
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 2e-05
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 3e-10
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 2e-09
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 8e-09
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 2e-08
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 3e-08
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 5e-08
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 9e-08
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-07
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-07
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 2e-07
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-07
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 4e-07
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 6e-07
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-06
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-06
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 2e-06
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 3e-06
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 4e-06
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 5e-06
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-05
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 3e-05
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 5e-05
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 6e-05
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 6e-05
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 7e-05
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 3e-04
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 4e-04
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 6e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-04
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
 Score =  320 bits (821), Expect = e-104
 Identities = 92/301 (30%), Positives = 146/301 (48%), Gaps = 27/301 (8%)

Query: 144 SGQTKTENKAILEELRLVKPRIKLLYVTPERAVTE-SFHYLLQHLVRYNKLAYIVVDEAH 202
           +  +K   K +  E+      +KL+YVTPE+      F   L+      +   I VDE H
Sbjct: 116 ASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVH 175

Query: 203 CVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTS 262
           C S+WGHDFRP Y+ LG L++   N   +I LTATA   V  D   +L   K    F  S
Sbjct: 176 CCSQWGHDFRPDYKALGILKRQFPN-ASLIGLTATATNHVLTDAQKILCIEKC-FTFTAS 233

Query: 263 TFRSNLFYDVIF-DDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALR 321
             R NL+Y+V       +D    + + I             GIIYC +++ +  +  +L+
Sbjct: 234 FNRPNLYYEVRQKPSNTEDFIEDIVKLI-----NGRYKGQSGIIYCFSQKDSEQVTVSLQ 288

Query: 322 RK----------VNKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSI 371
                       +   +++ V   +   EI V+ AT++FGMGID+ +VRFV+H  M  S+
Sbjct: 289 NLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSM 348

Query: 372 PAYYQESGRAGRDGLQSYCRIYHSEHSKKSLEYVIKTDTSTKREQLELKFKNYLSMLEYC 431
             YYQESGRAGRD +++ C +Y+       +  ++  + +  +++L         M+ YC
Sbjct: 349 ENYYQESGRAGRDDMKADCILYYGFGDIFRISSMVVME-NVGQQKLY-------EMVSYC 400

Query: 432 E 432
           +
Sbjct: 401 Q 401


>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.98
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.98
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.97
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.97
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.97
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.97
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.95
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.95
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.95
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.95
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.94
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.93
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.93
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.93
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.93
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.93
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.93
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.92
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.92
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.92
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.92
3bor_A237 Human initiation factor 4A-II; translation initiat 99.92
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.91
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.91
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.91
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.9
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.9
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.88
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.87
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.87
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.86
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.86
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.86
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.86
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.84
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.83
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.71
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.81
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.79
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.78
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.73
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.69
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.69
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.67
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.56
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.51
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 98.03
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.86
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.71
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.68
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.6
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.55
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.18
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.53
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.5
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.49
3co5_A143 Putative two-component system transcriptional RES 96.26
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.04
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 96.01
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.75
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.54
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 95.52
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.51
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.09
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.03
3bos_A242 Putative DNA replication factor; P-loop containing 94.83
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.79
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 94.76
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.68
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.64
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.61
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.5
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.41
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.37
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.23
2r6a_A454 DNAB helicase, replicative helicase; replication, 94.16
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.13
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 94.05
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.98
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 93.82
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.58
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.49
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.38
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 93.37
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 93.37
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.34
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.33
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.33
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 93.32
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 93.26
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 93.26
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.19
2v1u_A387 Cell division control protein 6 homolog; DNA repli 92.93
3pvs_A447 Replication-associated recombination protein A; ma 92.92
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 92.9
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 92.89
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 92.87
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 92.52
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 92.5
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 92.48
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 92.28
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 92.27
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 92.24
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 92.2
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 92.17
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.99
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 91.91
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 91.87
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 90.85
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 90.83
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 89.83
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 89.63
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 88.78
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 88.67
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 88.66
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 88.37
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 88.02
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 87.09
1u94_A356 RECA protein, recombinase A; homologous recombinat 87.01
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 86.94
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 86.77
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 86.62
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 86.37
1xp8_A366 RECA protein, recombinase A; recombination, radior 85.83
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 85.76
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 85.71
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 85.41
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 85.17
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 85.13
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 84.4
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 83.7
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 83.36
2z43_A324 DNA repair and recombination protein RADA; archaea 82.83
1ojl_A304 Transcriptional regulatory protein ZRAR; response 82.47
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 82.26
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 81.89
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 81.64
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 81.46
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 81.44
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 81.2
3io5_A333 Recombination and repair protein; storage dimer, i 80.93
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 80.67
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 80.5
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 80.31
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
Probab=100.00  E-value=4e-52  Score=422.22  Aligned_cols=376  Identities=29%  Similarity=0.513  Sum_probs=309.3

Q ss_pred             CCCCCcCCCCCCCCC-HHHHHHHHHHHhCCcccCchHHHHHHHHHHccCCcEEEEccCCCcccccccccccceEEeCCCc
Q psy7952          18 SLTGNQQDRKGGKVS-EQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRIPPGA   96 (444)
Q Consensus        18 ~~~~~~~~~~~~~~~-~~~~~~~l~~~~g~~~~~t~~Q~~~~~~~~~~~~~~ii~apTGsGKT~~a~~~~~~~~~~~~~~   96 (444)
                      ..+....+|....++ ...+.+.|++.||+..++ ++|.++++.++.| +++++.+|||+|||++        |++|+  
T Consensus        13 ~~~~~~~~w~~~~~~l~~~l~~~L~~~fg~~~~r-p~Q~~~i~~il~g-~d~lv~~pTGsGKTl~--------~~lpa--   80 (591)
T 2v1x_A           13 EYDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFR-PLQLETINVTMAG-KEVFLVMPTGGGKSLC--------YQLPA--   80 (591)
T ss_dssp             ---CCGGGGCCSCSTTHHHHHHHHHHTSCCCSCC-TTHHHHHHHHHTT-CCEEEECCTTSCTTHH--------HHHHH--
T ss_pred             CCCcchhccccccCCCCHHHHHHHHHHhCCCCCC-HHHHHHHHHHHcC-CCEEEEECCCChHHHH--------HHHHH--
Confidence            344455666665554 778999999999999844 8999999999999 9999999999999999        88888  


Q ss_pred             cccccCCccceeEEEcchhhhhcccCccchHhhh-cCCCCceeEEEEeCCCChhhHHHHHHHHHhcCCCeeEEEECCCcc
Q psy7952          97 DFILNGNVRSRNGWISPILSSFYLRFRDDKTSIV-TGRSDLYQLELIVSGQTKTENKAILEELRLVKPRIKLLYVTPERA  175 (444)
Q Consensus        97 ~~l~~~~~~~~vlil~P~~~L~~~~q~~~~~~~l-~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Iiv~Tpe~l  175 (444)
                        +...+..   ||++|+++|+     .++++.+ ..+   +.+..++++....+.......+....+.++|+|+||+++
T Consensus        81 --l~~~g~~---lVisP~~~L~-----~q~~~~l~~~g---i~~~~l~~~~~~~~~~~~~~~l~~~~~~~~Ilv~Tpe~L  147 (591)
T 2v1x_A           81 --LCSDGFT---LVICPLISLM-----EDQLMVLKQLG---ISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKI  147 (591)
T ss_dssp             --HTSSSEE---EEECSCHHHH-----HHHHHHHHHHT---CCEEECCSSCCHHHHHHHHHHHHCTTCCCCEEEECHHHH
T ss_pred             --HHcCCcE---EEEeCHHHHH-----HHHHHHHHhcC---CcEEEEeCCCCHHHHHHHHHHhhcccCCCCEEEEChhHh
Confidence              6655555   9999999999     7888888 667   889999999988877777666654467899999999998


Q ss_pred             ccc-cHHHHHHHHHhhCCccEEEEeccccccccCCCcHHHHHHHHHHHHhhCCCCcEEEEeccCCcchHHHHHHHhcCCC
Q psy7952         176 VTE-SFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNK  254 (444)
Q Consensus       176 ~~~-~~~~~~~~~~~~~~~~~iViDE~H~~~~~~~~~~~~~~~l~~~~~~~~~~~~~v~lSAT~~~~~~~~~~~~l~~~~  254 (444)
                      ... .|...+.......++++|||||||++.+||++|++.+..+..+...+++ .+++++|||+++....++...++++.
T Consensus       148 ~~~~~~~~~l~~~~~~~~i~~iViDEAH~is~~g~dfr~~~~~l~~l~~~~~~-~~ii~lSAT~~~~v~~~i~~~l~~~~  226 (591)
T 2v1x_A          148 AKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPN-ASLIGLTATATNHVLTDAQKILCIEK  226 (591)
T ss_dssp             HSCHHHHHHHHHHHHTTCEEEEEEETGGGGSTTCTTCCGGGGGGGHHHHHCTT-SEEEEEESSCCHHHHHHHHHHTTCCS
T ss_pred             hccHHHHHHHHhhhhccCCcEEEEECcccccccccccHHHHHHHHHHHHhCCC-CcEEEEecCCCHHHHHHHHHHhCCCC
Confidence            642 3444555566678999999999999999999999988877666666665 89999999999999899999988876


Q ss_pred             CeEEEecCCCCCCceEEEEEcccchhhHHHHHHHHHHHhccCCCCCceEEEEecccchHHHHHHHHHhh----------c
Q psy7952         255 PYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGIIYCRTREHTTDLADALRRK----------V  324 (444)
Q Consensus       255 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~iVf~~s~~~~~~l~~~L~~~----------~  324 (444)
                      +. .+..+..++++.+.+......   .......+.+++.... .+.++||||++++.++.++..|...          +
T Consensus       227 ~~-~~~~~~~r~nl~~~v~~~~~~---~~~~~~~l~~~l~~~~-~~~~~IVf~~sr~~~e~la~~L~~~g~~~~~~h~~l  301 (591)
T 2v1x_A          227 CF-TFTASFNRPNLYYEVRQKPSN---TEDFIEDIVKLINGRY-KGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANL  301 (591)
T ss_dssp             CE-EEECCCCCTTEEEEEEECCSS---HHHHHHHHHHHHTTTT-TTCEEEEECSSHHHHHHHHHHHHHTTCCEEEECTTS
T ss_pred             cE-EEecCCCCcccEEEEEeCCCc---HHHHHHHHHHHHHHhc-cCCCeEEEeCcHHHHHHHHHHHHHCCCCEEEecCCC
Confidence            64 455667788988887765422   1223333444443322 5789999999999999999999876          8


Q ss_pred             CHHHHHHHHHHHhcCCccEEEEcCccccccccCCccEEEEeCCCCCHHHHHHHhccCCCCCCceeEEEEecccchhhHHH
Q psy7952         325 NKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVHWGMPSSIPAYYQESGRAGRDGLQSYCRIYHSEHSKKSLEY  404 (444)
Q Consensus       325 ~~~~r~~~~~~f~~g~~~vLvaT~~~~~Gidi~~~~~Vi~~~~p~s~~~~~Qr~GR~~R~g~~g~~~~~~~~~~~~~~~~  404 (444)
                      ++.+|..+++.|++|+.+|||||+++++|||+|++++||++++|.|...|+||+||+||.|++|.|++++.+.|...+..
T Consensus       302 ~~~~R~~~~~~F~~g~~~VlVAT~a~~~GID~p~V~~VI~~~~p~s~~~y~Qr~GRaGR~G~~g~~i~l~~~~D~~~~~~  381 (591)
T 2v1x_A          302 EPEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGFGDIFRISS  381 (591)
T ss_dssp             CHHHHHHHHHHHHTTSSSEEEECTTSCTTCCCSCEEEEEESSCCSSHHHHHHHHTTSCTTSSCEEEEEEECHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEechhhcCCCcccccEEEEeCCCCCHHHHHHHhccCCcCCCCceEEEEEChHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             HHhhccchhHHHHHHHHhhHHHHHHHhh
Q psy7952         405 VIKTDTSTKREQLELKFKNYLSMLEYCE  432 (444)
Q Consensus       405 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~  432 (444)
                      ++..+.        .....+.+|+.||+
T Consensus       382 ~~~~~~--------~~~~~l~~~~~~~~  401 (591)
T 2v1x_A          382 MVVMEN--------VGQQKLYEMVSYCQ  401 (591)
T ss_dssp             HTTTST--------THHHHHHHHHHHHT
T ss_pred             HHhhhh--------hhHHHHHHHHHHHh
Confidence            876432        13455677888876



>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 444
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 1e-19
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 7e-14
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 8e-14
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-13
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-13
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 5e-12
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 3e-11
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 1e-10
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 1e-08
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 7e-08
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 8e-08
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 1e-07
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 4e-07
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 7e-07
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 2e-06
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 8e-06
d1tf5a4175 c.37.1.19 (A:396-570) Translocation ATPase SecA, n 1e-05
d2eyqa5211 c.37.1.19 (A:779-989) Transcription-repair couplin 5e-05
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 9e-04
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 0.004
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecQ helicase domain
species: Escherichia coli [TaxId: 562]
 Score = 84.7 bits (208), Expect = 1e-19
 Identities = 58/229 (25%), Positives = 100/229 (43%), Gaps = 32/229 (13%)

Query: 33  EQELTAKLKALFGFDSFKCELQKKAIRHILLRTHDIFVSMPTGAVSLVGSVVSARSRVRI 92
           E      L+  FG+  F+   Q++ I  +L    D  V MPTG     G  +  +    +
Sbjct: 10  ESGAKQVLQETFGYQQFR-PGQEEIIDTVLSG-RDCLVVMPTGG----GKSLCYQIPALL 63

Query: 93  PPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIVTGRSDLYQLELIVSGQTKTENK 152
             G   +++  +      +  + ++       + T     + ++                
Sbjct: 64  LNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCR----------- 112

Query: 153 AILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFR 212
                      +I+LLY+ PER + ++F       + +     + VDEAHC+S+WGHDFR
Sbjct: 113 ---------TGQIRLLYIAPERLMLDNFL----EHLAHWNPVLLAVDEAHCISQWGHDFR 159

Query: 213 PTYRRLGELRQFTGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKT 261
           P Y  LG+LRQ     +P +ALTATA+ + +QDI+ +L  N P  +  +
Sbjct: 160 PEYAALGQLRQRFPT-LPFMALTATADDTTRQDIVRLLGLNDP-LIQIS 206


>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.97
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.96
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.96
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.95
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.95
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.94
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.93
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.92
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.92
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.92
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.91
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.91
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.91
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.9
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.89
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.88
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.88
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.85
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.84
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.83
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.77
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.77
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.76
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.76
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.76
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.74
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.71
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.66
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.66
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.66
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.64
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.6
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.58
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.56
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.19
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.18
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.18
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.15
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.14
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.08
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.51
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.48
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.45
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.15
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.89
d2qy9a2211 GTPase domain of the signal recognition particle r 96.69
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.63
d1okkd2207 GTPase domain of the signal recognition particle r 96.58
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.45
d1vmaa2213 GTPase domain of the signal recognition particle r 96.43
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.42
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.37
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.22
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.18
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.91
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 94.81
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.67
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 94.64
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.58
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.49
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 94.32
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.36
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.49
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 92.43
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.35
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.18
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 92.17
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 92.13
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 91.28
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.85
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 90.37
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 90.36
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.31
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 90.13
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 90.11
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 89.83
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.72
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 88.51
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 88.36
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 87.41
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 87.29
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 86.76
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 85.97
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 85.63
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 85.55
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 85.53
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 84.84
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 84.17
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 84.01
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 83.53
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 82.78
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 82.64
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 82.48
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 82.19
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.88
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 81.85
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 81.7
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 80.63
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 80.63
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 80.48
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 80.32
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 80.01
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]
Probab=99.97  E-value=3.6e-32  Score=253.58  Aligned_cols=265  Identities=15%  Similarity=0.088  Sum_probs=166.3

Q ss_pred             CcEEEEccCCCcccccccccccceEEeCCCccccccCCccceeEEEcchhhhhcccCccchHhhh-cCCCCceeEEEEeC
Q psy7952          66 HDIFVSMPTGAVSLVGSVVSARSRVRIPPGADFILNGNVRSRNGWISPILSSFYLRFRDDKTSIV-TGRSDLYQLELIVS  144 (444)
Q Consensus        66 ~~~ii~apTGsGKT~~a~~~~~~~~~~~~~~~~l~~~~~~~~vlil~P~~~L~~~~q~~~~~~~l-~~~~~~i~~~~~~~  144 (444)
                      +++++.||||+|||++        |+.++ +.....  ...+++|++|+++|+     .|..+.+ ..+   +.......
T Consensus        10 ~~~lv~~~TGsGKT~~--------~l~~~-~~~~~~--~~~~~lvi~Ptr~La-----~q~~~~l~~~~---~~~~~~~~   70 (305)
T d2bmfa2          10 RLTIMDLHPGAGKTKR--------YLPAI-VREAIK--RGLRTLILAPTRVVA-----AEMEEALRGLP---IRYQTPAI   70 (305)
T ss_dssp             CEEEECCCTTSSTTTT--------HHHHH-HHHHHH--HTCCEEEEESSHHHH-----HHHHHHTTTSC---CBCCC---
T ss_pred             CcEEEEECCCCCHHHH--------HHHHH-HHHHHh--cCCEEEEEccHHHHH-----HHHHHHHhcCC---cceeeeEE
Confidence            8999999999999988        54344 221222  223569999999999     6666666 333   21111111


Q ss_pred             CCChhhHHHHHHHHHhcCCCeeEEEECCCccccccHHHHHHHHHhhCCccEEEEeccccccccCCCcHHHHHHHHHHHHh
Q psy7952         145 GQTKTENKAILEELRLVKPRIKLLYVTPERAVTESFHYLLQHLVRYNKLAYIVVDEAHCVSEWGHDFRPTYRRLGELRQF  224 (444)
Q Consensus       145 ~~~~~~~~~~~~~~~~~~~~~~Iiv~Tpe~l~~~~~~~~~~~~~~~~~~~~iViDE~H~~~~~~~~~~~~~~~l~~~~~~  224 (444)
                      ...             ......++++|++.+.     ........+.+++++|+||+|++..++..++..+.   . ...
T Consensus        71 ~~~-------------~~~~~~i~~~t~~~l~-----~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~---~-~~~  128 (305)
T d2bmfa2          71 RAE-------------HTGREIVDLMCHATFT-----MRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYIS---T-RVE  128 (305)
T ss_dssp             ------------------CCCSEEEEEHHHHH-----HHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHH---H-HHH
T ss_pred             eec-------------ccCccccccCCcHHHH-----HHHhcCccccceeEEEeeeeeecchhhHHHHHHHH---H-hhc
Confidence            000             1346789999988753     23333444678999999999998765532222221   1 122


Q ss_pred             hCCCCcEEEEeccCCcchHHHHHHHhcCCCCeEEEecCCCCCCceEEEEEcccchhhHHHHHHHHHHHhccCCCCCceEE
Q psy7952         225 TGNSIPIIALTATAEPSVKQDIISVLKFNKPYKVFKTSTFRSNLFYDVIFDDLLKDSYAHVKEFIEKCLGKDNKANNCGI  304 (444)
Q Consensus       225 ~~~~~~~v~lSAT~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~i  304 (444)
                      .+ ..+++++|||++.....    ......+........              ...........+.+       .+++++
T Consensus       129 ~~-~~~~v~~SAT~~~~~~~----~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~-------~~~~~l  182 (305)
T d2bmfa2         129 MG-EAAGIFMTATPPGSRDP----FPQSNAPIMDEEREI--------------PERSWNSGHEWVTD-------FKGKTV  182 (305)
T ss_dssp             HT-SCEEEEECSSCTTCCCS----SCCCSSCEEEEECCC--------------CCSCCSSCCHHHHS-------SCSCEE
T ss_pred             cc-cceEEEeecCCCcceee----ecccCCcceEEEEec--------------cHHHHHHHHHHHHh-------hCCCEE
Confidence            23 37899999998764321    000111111111100              00000000111111       478899


Q ss_pred             EEecccchHHHHHHHHHhh------cCHHHHHHHHHHHhcCCccEEEEcCccccccccCCccEEEE----------eC--
Q psy7952         305 IYCRTREHTTDLADALRRK------VNKHERSRVQESFMRGEINVITATISFGMGIDRQNVRFVVH----------WG--  366 (444)
Q Consensus       305 Vf~~s~~~~~~l~~~L~~~------~~~~~r~~~~~~f~~g~~~vLvaT~~~~~Gidi~~~~~Vi~----------~~--  366 (444)
                      |||++++++++++..|.+.      +...........|++|..++++||+++++|+|++ ++.||.          ++  
T Consensus       183 vf~~~~~~~~~l~~~L~~~~~~~~~l~~~~~~~~~~~~~~~~~~~lvaT~~~~~G~~~~-~~~Vi~~~~~~~~~~~~~~~  261 (305)
T d2bmfa2         183 WFVPSIKAGNDIAACLRKNGKKVIQLSRKTFDSEYIKTRTNDWDFVVTTDISEMGANFK-AERVIDPRRCMKPVILTDGE  261 (305)
T ss_dssp             EECSCHHHHHHHHHHHHHHTCCCEECCTTCHHHHGGGGGTSCCSEEEECGGGGTTCCCC-CSEEEECCEEEEEEEECSSS
T ss_pred             EEeccHHHHHHHHHHHHhCCCCEEEeCCcChHHHHhhhhccchhhhhhhHHHHhcCCCC-ccEEEEcCCceeeeEecCCC
Confidence            9999999999999999876      3333344556678899999999999999999995 555442          33  


Q ss_pred             --------CCCCHHHHHHHhccCCCCCCceeEEEEecccc
Q psy7952         367 --------MPSSIPAYYQESGRAGRDGLQSYCRIYHSEHS  398 (444)
Q Consensus       367 --------~p~s~~~~~Qr~GR~~R~g~~g~~~~~~~~~~  398 (444)
                              .|.|..+|+||+||+||.|+++..+.++....
T Consensus       262 ~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~~~~  301 (305)
T d2bmfa2         262 ERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGEP  301 (305)
T ss_dssp             CEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEECSCC
T ss_pred             CceEEeccccCCHHHHhhhhcCcCcCCCCceEEEEECCCC
Confidence                    35689999999999999999988887776543



>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure